# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 13.0000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint 427 551 5.1573 6.4467 9.6700 107.0345 Constraint 427 545 4.3444 5.4306 8.1458 107.0345 Constraint 427 540 8.2813 10.3517 15.5275 107.0345 Constraint 427 533 8.3726 10.4657 15.6986 107.0345 Constraint 427 526 5.8083 7.2604 10.8906 107.0345 Constraint 418 545 7.9544 9.9430 14.9145 107.0345 Constraint 418 526 8.2992 10.3740 15.5609 107.0345 Constraint 410 526 8.6572 10.8215 16.2323 107.0345 Constraint 402 551 7.2400 9.0500 13.5750 107.0345 Constraint 402 526 5.7178 7.1472 10.7208 107.0345 Constraint 287 369 8.8866 11.1082 16.6623 107.0345 Constraint 280 374 8.1748 10.2185 15.3277 107.0345 Constraint 280 369 4.9922 6.2402 9.3603 107.0345 Constraint 280 358 5.5931 6.9913 10.4870 107.0345 Constraint 255 410 9.3707 11.7134 17.5701 107.0345 Constraint 255 402 5.3952 6.7440 10.1159 107.0345 Constraint 255 374 5.4505 6.8131 10.2196 107.0345 Constraint 255 369 4.5704 5.7130 8.5694 107.0345 Constraint 255 358 5.6349 7.0436 10.5654 107.0345 Constraint 243 410 8.6712 10.8389 16.2584 107.0345 Constraint 243 402 5.8440 7.3050 10.9575 107.0345 Constraint 243 374 5.3650 6.7063 10.0594 107.0345 Constraint 243 369 6.6409 8.3012 12.4517 107.0345 Constraint 243 358 8.5329 10.6662 15.9993 107.0345 Constraint 427 610 5.3669 6.7087 10.0630 106.1609 Constraint 427 615 5.9508 7.4385 11.1577 106.0609 Constraint 280 383 7.4586 9.3233 13.9849 106.0345 Constraint 274 383 9.0684 11.3355 17.0033 106.0345 Constraint 274 374 8.2278 10.2848 15.4272 106.0345 Constraint 274 369 4.9792 6.2240 9.3360 106.0345 Constraint 274 358 8.2426 10.3033 15.4549 106.0345 Constraint 263 402 8.8045 11.0056 16.5084 106.0345 Constraint 263 391 9.0019 11.2524 16.8786 106.0345 Constraint 263 383 7.9167 9.8959 14.8439 106.0345 Constraint 263 374 6.8068 8.5085 12.7627 106.0345 Constraint 263 369 5.1919 6.4898 9.7347 106.0345 Constraint 263 358 8.7381 10.9226 16.3839 106.0345 Constraint 255 391 6.2447 7.8059 11.7089 106.0345 Constraint 255 383 3.8239 4.7799 7.1698 106.0345 Constraint 243 391 4.4009 5.5011 8.2516 106.0345 Constraint 243 383 5.5785 6.9732 10.4598 106.0345 Constraint 418 615 6.4038 8.0048 12.0072 105.0610 Constraint 402 615 8.9266 11.1583 16.7374 105.0610 Constraint 434 551 7.4311 9.2888 13.9332 105.0345 Constraint 434 545 6.1666 7.7083 11.5624 105.0345 Constraint 434 615 4.4399 5.5499 8.3248 104.1609 Constraint 434 610 5.0027 6.2534 9.3801 104.1609 Constraint 418 610 8.5120 10.6400 15.9600 104.0611 Constraint 410 615 9.2286 11.5358 17.3037 104.0611 Constraint 402 610 8.5477 10.6846 16.0269 104.0611 Constraint 427 517 8.0560 10.0700 15.1050 104.0348 Constraint 402 545 7.9248 9.9060 14.8589 104.0348 Constraint 243 526 8.3632 10.4540 15.6810 104.0348 Constraint 446 545 5.1155 6.3943 9.5915 104.0348 Constraint 446 526 7.4871 9.3589 14.0384 104.0348 Constraint 446 517 7.6196 9.5245 14.2868 104.0348 Constraint 287 350 8.4112 10.5140 15.7710 104.0348 Constraint 280 350 4.7849 5.9812 8.9718 104.0348 Constraint 255 350 4.9044 6.1304 9.1957 104.0348 Constraint 243 350 9.0028 11.2536 16.8803 104.0348 Constraint 418 551 9.2905 11.6132 17.4198 104.0346 Constraint 463 551 7.5290 9.4112 14.1168 104.0345 Constraint 463 545 5.8445 7.3056 10.9583 104.0345 Constraint 463 533 8.2698 10.3372 15.5058 104.0345 Constraint 391 463 7.3645 9.2056 13.8085 104.0345 Constraint 243 463 8.6519 10.8148 16.2222 104.0345 Constraint 427 559 8.5941 10.7426 16.1139 104.0345 Constraint 402 533 8.8387 11.0484 16.5726 104.0345 Constraint 312 610 7.1449 8.9311 13.3966 103.1612 Constraint 274 350 8.3567 10.4458 15.6687 103.0348 Constraint 263 350 9.0576 11.3220 16.9830 103.0348 Constraint 402 470 7.5546 9.4432 14.1648 103.0345 Constraint 418 649 7.9641 9.9551 14.9327 102.8610 Constraint 410 649 4.6359 5.7949 8.6923 102.8610 Constraint 402 649 6.6336 8.2920 12.4381 102.8610 Constraint 446 615 8.2562 10.3202 15.4803 102.0613 Constraint 255 319 6.2861 7.8577 11.7865 102.0359 Constraint 455 545 8.3051 10.3814 15.5720 102.0348 Constraint 455 526 8.3771 10.4713 15.7070 102.0348 Constraint 402 502 8.6086 10.7607 16.1411 101.9127 Constraint 243 502 8.0263 10.0328 15.0493 101.9127 Constraint 374 649 8.0073 10.0091 15.0137 101.8611 Constraint 255 649 8.6318 10.7898 16.1847 101.8611 Constraint 243 649 7.9087 9.8858 14.8288 101.8611 Constraint 463 649 9.0077 11.2597 16.8895 101.8610 Constraint 391 649 3.8450 4.8062 7.2094 101.8610 Constraint 446 610 8.8840 11.1051 16.6576 101.0614 Constraint 255 526 8.7609 10.9511 16.4266 101.0406 Constraint 319 383 7.8703 9.8379 14.7569 101.0359 Constraint 446 551 8.2161 10.2702 15.4052 101.0349 Constraint 446 540 8.6489 10.8111 16.2167 101.0348 Constraint 255 463 9.4871 11.8589 17.7884 101.0345 Constraint 463 540 8.6253 10.7816 16.1724 101.0345 Constraint 234 551 7.7676 9.7095 14.5642 101.0345 Constraint 234 533 7.2763 9.0954 13.6431 101.0345 Constraint 234 526 4.1983 5.2479 7.8719 101.0345 Constraint 234 427 7.3862 9.2328 13.8492 101.0345 Constraint 234 418 8.2142 10.2677 15.4015 101.0345 Constraint 234 410 6.7533 8.4417 12.6625 101.0345 Constraint 234 402 3.7955 4.7444 7.1166 101.0345 Constraint 427 642 8.1308 10.1635 15.2452 100.8612 Constraint 418 642 6.9738 8.7173 13.0759 100.8612 Constraint 410 642 5.4265 6.7831 10.1747 100.8612 Constraint 402 642 4.7055 5.8818 8.8228 100.8612 Constraint 255 642 6.2359 7.7949 11.6923 100.8612 Constraint 243 642 7.8388 9.7985 14.6977 100.8612 Constraint 383 649 5.5109 6.8887 10.3330 100.8611 Constraint 427 601 9.0392 11.2990 16.9485 100.8611 Constraint 234 374 9.4876 11.8595 17.7892 100.7345 Constraint 434 601 6.7822 8.4778 12.7167 100.0610 Constraint 255 324 8.8434 11.0542 16.5813 100.0359 Constraint 255 551 9.0159 11.2699 16.9048 100.0349 Constraint 234 391 5.4829 6.8536 10.2804 100.0345 Constraint 234 383 7.6844 9.6055 14.4083 100.0345 Constraint 391 470 7.5431 9.4288 14.1432 100.0345 Constraint 358 649 9.0210 11.2763 16.9144 99.8613 Constraint 358 642 6.8688 8.5860 12.8790 99.8613 Constraint 463 642 8.4268 10.5335 15.8002 99.8612 Constraint 391 642 5.1629 6.4536 9.6805 99.8612 Constraint 383 642 3.6126 4.5158 6.7736 99.8612 Constraint 319 402 8.8244 11.0305 16.5458 99.0359 Constraint 295 369 9.6471 12.0589 18.0883 99.0345 Constraint 350 610 8.7841 10.9801 16.4702 98.9395 Constraint 255 427 9.6829 12.1036 18.1554 98.9130 Constraint 234 502 5.3901 6.7376 10.1064 98.9127 Constraint 427 573 5.6833 7.1041 10.6561 98.7064 Constraint 434 568 7.5960 9.4950 14.2425 98.2918 Constraint 551 626 7.2362 9.0453 13.5680 98.1609 Constraint 434 626 6.4190 8.0238 12.0356 98.1609 Constraint 427 626 4.6672 5.8340 8.7510 98.1609 Constraint 418 626 5.6141 7.0176 10.5265 98.1609 Constraint 402 626 4.8551 6.0689 9.1033 98.1609 Constraint 280 340 7.6658 9.5822 14.3734 98.0362 Constraint 234 545 8.0685 10.0856 15.1284 98.0348 Constraint 234 517 7.4562 9.3203 13.9805 98.0348 Constraint 234 463 4.3970 5.4962 8.2443 98.0345 Constraint 234 512 8.4750 10.5937 15.8906 98.0345 Constraint 173 533 8.6542 10.8177 16.2266 97.9918 Constraint 173 526 8.2392 10.2990 15.4484 97.9918 Constraint 173 502 6.2149 7.7686 11.6529 97.9918 Constraint 173 402 8.2363 10.2954 15.4431 97.9918 Constraint 173 374 8.2101 10.2626 15.3939 97.9918 Constraint 173 369 7.9656 9.9569 14.9354 97.9918 Constraint 173 274 7.0882 8.8602 13.2904 97.9918 Constraint 173 263 3.5223 4.4029 6.6043 97.9918 Constraint 173 255 6.3021 7.8777 11.8165 97.9918 Constraint 173 243 4.1927 5.2408 7.8613 97.9918 Constraint 319 610 7.8032 9.7540 14.6309 97.9405 Constraint 374 642 7.8284 9.7855 14.6783 97.8615 Constraint 369 642 9.0372 11.2965 16.9447 97.8615 Constraint 350 642 5.5233 6.9041 10.3562 97.8615 Constraint 427 568 7.7662 9.7077 14.5616 97.4139 Constraint 410 626 6.7465 8.4332 12.6497 97.1610 Constraint 526 626 8.4824 10.6030 15.9045 97.1610 Constraint 463 626 7.4372 9.2965 13.9447 97.1609 Constraint 391 526 8.8916 11.1145 16.6717 97.0406 Constraint 234 470 6.8536 8.5670 12.8504 97.0345 Constraint 165 551 6.2309 7.7886 11.6829 96.9918 Constraint 165 533 5.7726 7.2157 10.8236 96.9918 Constraint 165 526 5.3035 6.6293 9.9440 96.9918 Constraint 165 502 5.8692 7.3365 11.0047 96.9918 Constraint 165 427 8.3074 10.3843 15.5764 96.9918 Constraint 165 402 5.4622 6.8278 10.2417 96.9918 Constraint 165 383 7.8518 9.8148 14.7222 96.9918 Constraint 165 374 9.2492 11.5615 17.3422 96.9918 Constraint 165 369 8.4749 10.5937 15.8905 96.9918 Constraint 165 280 8.5366 10.6708 16.0062 96.9918 Constraint 165 274 7.1908 8.9885 13.4828 96.9918 Constraint 165 263 4.9756 6.2195 9.3293 96.9918 Constraint 165 255 4.7855 5.9818 8.9727 96.9918 Constraint 165 243 5.2669 6.5837 9.8755 96.9918 Constraint 234 649 8.5974 10.7467 16.1201 96.8610 Constraint 434 573 4.9223 6.1528 9.2293 96.7064 Constraint 255 626 7.4820 9.3526 14.0288 96.0611 Constraint 434 634 7.5278 9.4097 14.1145 96.0611 Constraint 427 634 6.2921 7.8651 11.7977 96.0611 Constraint 418 634 3.2879 4.1099 6.1648 96.0611 Constraint 410 634 3.9887 4.9859 7.4789 96.0611 Constraint 402 634 5.9884 7.4856 11.2283 96.0611 Constraint 319 551 8.7718 10.9647 16.4471 96.0362 Constraint 234 455 8.6231 10.7789 16.1683 96.0348 Constraint 165 391 7.9266 9.9082 14.8623 95.9919 Constraint 146 551 7.2253 9.0317 13.5475 95.9918 Constraint 146 402 7.4473 9.3091 13.9636 95.9918 Constraint 146 295 8.8236 11.0295 16.5442 95.9918 Constraint 146 287 5.3888 6.7359 10.1039 95.9918 Constraint 146 280 4.1534 5.1917 7.7876 95.9918 Constraint 146 274 5.4411 6.8014 10.2021 95.9918 Constraint 146 255 4.3282 5.4103 8.1154 95.9918 Constraint 263 502 8.7001 10.8752 16.3128 95.9184 Constraint 446 573 7.7899 9.7373 14.6060 95.2921 Constraint 340 610 8.2317 10.2897 15.4345 95.1626 Constraint 446 626 8.5298 10.6622 15.9933 95.1612 Constraint 483 551 8.5803 10.7254 16.0881 95.1140 Constraint 410 483 8.3586 10.4483 15.6724 95.1140 Constraint 391 626 8.3201 10.4001 15.6002 95.0611 Constraint 383 626 7.0291 8.7863 13.1795 95.0611 Constraint 463 634 7.1968 8.9960 13.4939 95.0611 Constraint 402 517 9.1101 11.3876 17.0814 95.0419 Constraint 173 383 8.9513 11.1891 16.7836 94.9921 Constraint 146 610 8.4073 10.5091 15.7636 94.9919 Constraint 146 383 7.3346 9.1683 13.7524 94.9919 Constraint 146 374 9.3031 11.6289 17.4434 94.9919 Constraint 146 369 6.9838 8.7298 13.0947 94.9919 Constraint 146 358 7.7879 9.7349 14.6023 94.9919 Constraint 146 263 6.3270 7.9088 11.8632 94.9919 Constraint 146 243 8.2199 10.2748 15.4123 94.9919 Constraint 130 610 5.2032 6.5040 9.7559 94.9919 Constraint 130 551 5.6725 7.0906 10.6359 94.9919 Constraint 130 427 8.2350 10.2937 15.4406 94.9919 Constraint 130 402 8.8924 11.1155 16.6732 94.9919 Constraint 130 319 4.4815 5.6019 8.4028 94.9919 Constraint 130 287 6.9444 8.6805 13.0207 94.9919 Constraint 130 280 7.5272 9.4090 14.1135 94.9919 Constraint 130 274 9.4691 11.8364 17.7546 94.9919 Constraint 130 255 8.0941 10.1176 15.1764 94.9919 Constraint 165 463 7.6147 9.5184 14.2775 94.9918 Constraint 157 551 8.5925 10.7406 16.1109 94.9918 Constraint 157 369 7.3258 9.1573 13.7359 94.9918 Constraint 157 287 6.3210 7.9013 11.8519 94.9918 Constraint 157 280 6.3031 7.8789 11.8183 94.9918 Constraint 157 274 3.6001 4.5001 6.7502 94.9918 Constraint 157 263 3.7862 4.7328 7.0992 94.9918 Constraint 157 255 5.6878 7.1098 10.6646 94.9918 Constraint 319 642 8.4043 10.5054 15.7581 94.8625 Constraint 234 642 8.0264 10.0330 15.0496 94.8612 Constraint 319 626 7.2405 9.0506 13.5759 94.1623 Constraint 350 626 6.1151 7.6439 11.4658 94.1613 Constraint 340 626 7.6532 9.5665 14.3498 94.1612 Constraint 350 615 9.6876 12.1095 18.1642 94.0628 Constraint 391 634 7.6682 9.5852 14.3779 94.0612 Constraint 165 545 8.6166 10.7708 16.1561 93.9921 Constraint 165 350 8.6365 10.7956 16.1934 93.9921 Constraint 157 533 8.1108 10.1385 15.2077 93.9919 Constraint 157 402 9.1688 11.4610 17.1916 93.9919 Constraint 157 383 9.4453 11.8066 17.7099 93.9919 Constraint 157 374 9.6935 12.1169 18.1753 93.9919 Constraint 157 243 7.6195 9.5244 14.2866 93.9919 Constraint 130 324 7.9265 9.9081 14.8622 93.9919 Constraint 312 601 8.2297 10.2872 15.4307 93.1670 Constraint 545 626 8.3508 10.4385 15.6578 93.1624 Constraint 463 615 9.7794 12.2242 18.3363 93.0623 Constraint 455 626 9.4709 11.8386 17.7579 93.0614 Constraint 455 634 7.1599 8.9499 13.4249 93.0614 Constraint 446 634 8.0467 10.0584 15.0876 93.0614 Constraint 434 593 8.4574 10.5718 15.8577 93.0611 Constraint 434 526 9.1295 11.4119 17.1179 93.0347 Constraint 146 319 3.5506 4.4383 6.6574 92.9931 Constraint 173 391 8.2539 10.3173 15.4760 92.9922 Constraint 146 533 9.1216 11.4020 17.1031 92.9921 Constraint 418 483 8.1068 10.1335 15.2002 92.9921 Constraint 146 350 5.0594 6.3243 9.4864 92.9921 Constraint 146 312 6.7030 8.3788 12.5682 92.9921 Constraint 146 306 5.7834 7.2293 10.8439 92.9921 Constraint 130 573 7.0495 8.8119 13.2178 92.9920 Constraint 165 512 8.6752 10.8440 16.2660 92.9919 Constraint 470 649 8.3938 10.4923 15.7384 92.8610 Constraint 402 483 7.4876 9.3595 14.0392 92.1143 Constraint 350 634 9.1585 11.4482 17.1722 92.0615 Constraint 383 634 7.9891 9.9863 14.9795 92.0614 Constraint 383 463 9.6505 12.0631 18.0946 92.0349 Constraint 183 526 6.6372 8.2965 12.4448 91.9978 Constraint 183 517 9.0329 11.2911 16.9366 91.9978 Constraint 183 512 8.4535 10.5668 15.8502 91.9978 Constraint 183 502 4.5314 5.6643 8.4964 91.9978 Constraint 183 402 7.6593 9.5741 14.3612 91.9978 Constraint 183 263 7.0993 8.8741 13.3112 91.9978 Constraint 183 255 8.2430 10.3038 15.4556 91.9978 Constraint 165 319 8.5327 10.6659 15.9989 91.9931 Constraint 157 319 7.6677 9.5846 14.3770 91.9931 Constraint 146 324 6.6447 8.3059 12.4588 91.9931 Constraint 130 350 6.9970 8.7463 13.1194 91.9922 Constraint 130 312 4.1896 5.2370 7.8555 91.9922 Constraint 130 306 5.5745 6.9682 10.4522 91.9922 Constraint 157 350 8.8184 11.0230 16.5345 91.9921 Constraint 165 234 4.2718 5.3398 8.0097 91.9918 Constraint 350 649 9.3000 11.6250 17.4375 91.8628 Constraint 446 568 8.2740 10.3425 15.5137 91.2978 Constraint 146 642 8.5430 10.6788 16.0181 90.9923 Constraint 130 559 7.7075 9.6344 14.4516 90.9919 Constraint 234 626 8.2790 10.3488 15.5232 90.0611 Constraint 183 491 7.2271 9.0339 13.5509 89.9978 Constraint 183 483 7.7972 9.7465 14.6197 89.9978 Constraint 183 463 8.0722 10.0903 15.1354 89.9978 Constraint 165 642 8.9843 11.2304 16.8456 89.9923 Constraint 86 615 8.1687 10.2109 15.3163 89.9921 Constraint 86 610 6.1167 7.6458 11.4687 89.9921 Constraint 86 312 5.2774 6.5967 9.8951 89.9921 Constraint 78 615 6.1605 7.7007 11.5510 89.9921 Constraint 78 610 3.9378 4.9223 7.3834 89.9921 Constraint 78 573 7.5600 9.4500 14.1750 89.9921 Constraint 78 427 8.2322 10.2903 15.4354 89.9921 Constraint 78 350 6.3820 7.9776 11.9663 89.9921 Constraint 78 312 4.1760 5.2199 7.8299 89.9921 Constraint 165 559 9.0891 11.3614 17.0421 89.9918 Constraint 146 626 7.5703 9.4629 14.1943 89.9918 Constraint 255 340 9.4491 11.8114 17.7170 89.4152 Constraint 312 626 8.7696 10.9620 16.4430 89.1669 Constraint 234 483 5.7452 7.1815 10.7722 89.1140 Constraint 183 391 7.6231 9.5289 14.2933 88.9981 Constraint 183 533 8.2361 10.2951 15.4426 88.9978 Constraint 130 615 9.0530 11.3163 16.9744 88.9976 Constraint 157 306 8.3486 10.4357 15.6536 88.9924 Constraint 78 551 8.2150 10.2687 15.4030 88.9921 Constraint 78 306 7.3888 9.2360 13.8540 88.9921 Constraint 78 280 9.0332 11.2914 16.9372 88.9921 Constraint 157 234 8.5585 10.6981 16.0471 88.9919 Constraint 146 234 8.6998 10.8748 16.3121 88.9919 Constraint 130 626 7.0054 8.7567 13.1350 88.9919 Constraint 234 491 7.4209 9.2761 13.9142 88.2921 Constraint 470 545 9.7807 12.2258 18.3388 88.0406 Constraint 165 483 8.6725 10.8406 16.2609 87.9979 Constraint 146 340 8.0654 10.0818 15.1227 87.9934 Constraint 157 324 9.5752 11.9691 17.9536 87.9932 Constraint 86 319 8.4515 10.5644 15.8466 87.9921 Constraint 78 434 8.4453 10.5566 15.8349 87.9921 Constraint 78 319 5.1711 6.4638 9.6958 87.9921 Constraint 78 146 7.1263 8.9079 13.3618 87.9921 Constraint 68 615 4.0477 5.0596 7.5894 87.9921 Constraint 68 610 5.7713 7.2141 10.8212 87.9921 Constraint 68 434 7.9683 9.9604 14.9406 87.9921 Constraint 68 427 9.0982 11.3728 17.0592 87.9921 Constraint 68 418 9.7931 12.2413 18.3620 87.9921 Constraint 68 350 8.6585 10.8231 16.2347 87.9921 Constraint 68 319 8.9407 11.1758 16.7637 87.9921 Constraint 62 615 5.7424 7.1780 10.7670 87.9921 Constraint 62 434 9.2568 11.5710 17.3566 87.9921 Constraint 62 427 8.4196 10.5245 15.7867 87.9921 Constraint 62 418 8.4442 10.5552 15.8329 87.9921 Constraint 62 402 7.8133 9.7667 14.6500 87.9921 Constraint 62 383 7.2520 9.0651 13.5976 87.9921 Constraint 62 350 4.9646 6.2058 9.3087 87.9921 Constraint 54 615 5.2321 6.5401 9.8102 87.9921 Constraint 54 418 6.9954 8.7443 13.1164 87.9921 Constraint 54 410 8.0414 10.0517 15.0776 87.9921 Constraint 54 402 9.2904 11.6130 17.4194 87.9921 Constraint 54 350 9.1248 11.4060 17.1089 87.9921 Constraint 43 418 8.9750 11.2187 16.8281 87.9921 Constraint 43 410 8.0105 10.0131 15.0197 87.9921 Constraint 43 402 8.9425 11.1782 16.7673 87.9921 Constraint 43 391 8.7387 10.9233 16.3850 87.9921 Constraint 43 350 7.4524 9.3156 13.9733 87.9921 Constraint 78 340 4.8662 6.0827 9.1240 87.9921 Constraint 165 626 8.5088 10.6359 15.9539 87.9919 Constraint 340 642 8.5706 10.7132 16.0698 87.8628 Constraint 234 540 9.4958 11.8698 17.8046 87.7406 Constraint 295 350 9.6108 12.0135 18.0203 87.0348 Constraint 146 427 9.3784 11.7230 17.5845 86.9976 Constraint 130 340 7.4173 9.2716 13.9075 86.9935 Constraint 146 329 9.0990 11.3738 17.0607 86.9934 Constraint 62 610 6.8783 8.5979 12.8968 86.9922 Constraint 54 610 8.9195 11.1493 16.7240 86.9922 Constraint 62 649 9.0501 11.3126 16.9689 86.9922 Constraint 78 402 9.4036 11.7545 17.6318 86.9921 Constraint 62 358 8.2514 10.3142 15.4713 86.9921 Constraint 62 319 6.8432 8.5539 12.8309 86.9921 Constraint 62 255 8.5290 10.6613 15.9919 86.9921 Constraint 62 146 8.5686 10.7108 16.0662 86.9921 Constraint 54 427 8.9631 11.2038 16.8058 86.9921 Constraint 86 601 4.5202 5.6503 8.4754 86.9921 Constraint 86 329 7.6922 9.6152 14.4228 86.9921 Constraint 78 329 7.0593 8.8241 13.2362 86.9921 Constraint 470 634 8.4983 10.6229 15.9344 86.8613 Constraint 545 615 9.2154 11.5192 17.2788 86.8612 Constraint 234 446 9.4244 11.7805 17.6708 86.4140 Constraint 234 634 9.1174 11.3968 17.0951 86.0613 Constraint 263 526 9.7047 12.1309 18.1963 86.0407 Constraint 130 434 9.4955 11.8694 17.8040 85.9976 Constraint 130 329 8.2715 10.3393 15.5090 85.9935 Constraint 43 615 8.8075 11.0093 16.5140 85.9923 Constraint 130 584 8.9863 11.2329 16.8493 85.9922 Constraint 130 545 9.4257 11.7822 17.6732 85.9922 Constraint 78 601 5.6995 7.1243 10.6865 85.9922 Constraint 86 584 7.7289 9.6611 14.4917 85.9922 Constraint 62 130 8.2320 10.2900 15.4349 85.9922 Constraint 86 573 8.5026 10.6282 15.9424 85.9921 Constraint 78 324 8.1846 10.2308 15.3461 85.9921 Constraint 62 340 5.0014 6.2517 9.3776 85.9921 Constraint 130 533 9.0193 11.2741 16.9112 85.9920 Constraint 280 642 9.4224 11.7779 17.6669 85.8615 Constraint 312 573 9.4798 11.8497 17.7746 85.4156 Constraint 68 312 8.0845 10.1056 15.1584 84.9978 Constraint 62 410 8.9479 11.1849 16.7774 84.9934 Constraint 86 340 7.1279 8.9099 13.3648 84.9934 Constraint 54 383 9.5730 11.9662 17.9493 84.9924 Constraint 43 383 6.7859 8.4824 12.7236 84.9924 Constraint 78 642 8.8671 11.0839 16.6258 84.9924 Constraint 68 642 9.0931 11.3664 17.0495 84.9924 Constraint 62 642 4.9766 6.2207 9.3310 84.9924 Constraint 165 540 9.3219 11.6524 17.4786 84.9922 Constraint 54 649 8.6877 10.8597 16.2895 84.9922 Constraint 43 649 6.2472 7.8090 11.7135 84.9922 Constraint 68 340 6.2604 7.8254 11.7382 84.9921 Constraint 97 312 5.1091 6.3863 9.5795 84.9921 Constraint 189 502 5.0647 6.3309 9.4964 84.7451 Constraint 189 263 8.6442 10.8053 16.2079 84.7451 Constraint 223 463 7.9399 9.9248 14.8872 84.7348 Constraint 340 615 8.6960 10.8700 16.3049 84.1625 Constraint 526 610 9.2100 11.5125 17.2687 84.0683 Constraint 255 634 9.9251 12.4063 18.6095 84.0672 Constraint 165 517 8.9487 11.1859 16.7788 83.9981 Constraint 146 526 9.1252 11.4065 17.1097 83.9980 Constraint 62 312 8.1801 10.2251 15.3377 83.9978 Constraint 418 573 9.4370 11.7962 17.6943 83.9924 Constraint 68 601 5.0424 6.3030 9.4546 83.9922 Constraint 86 593 5.4326 6.7908 10.1862 83.9921 Constraint 97 610 5.5060 6.8826 10.3238 83.9921 Constraint 97 306 7.8677 9.8347 14.7520 83.9921 Constraint 223 502 8.0482 10.0603 15.0904 83.6130 Constraint 434 584 7.1895 8.9869 13.4804 83.0924 Constraint 463 610 9.5687 11.9609 17.9413 83.0624 Constraint 234 350 9.9790 12.4738 18.7107 83.0366 Constraint 54 434 8.8292 11.0365 16.5547 82.9924 Constraint 43 358 8.0592 10.0739 15.1109 82.9924 Constraint 54 642 6.3027 7.8783 11.8175 82.9924 Constraint 43 642 4.4348 5.5435 8.3152 82.9924 Constraint 62 601 8.7066 10.8832 16.3248 82.9923 Constraint 78 593 7.6729 9.5912 14.3867 82.9922 Constraint 97 573 6.3676 7.9595 11.9393 82.9921 Constraint 223 402 9.0342 11.2928 16.9392 82.7348 Constraint 340 601 9.0830 11.3537 17.0306 82.0627 Constraint 78 255 9.4175 11.7719 17.6578 81.9978 Constraint 130 601 8.1932 10.2415 15.3623 81.9977 Constraint 68 573 9.1121 11.3901 17.0852 81.9924 Constraint 36 391 7.6741 9.5927 14.3890 81.9924 Constraint 36 383 8.2698 10.3373 15.5059 81.9924 Constraint 243 626 9.7991 12.2488 18.3732 81.9923 Constraint 97 584 6.3183 7.8979 11.8469 81.9921 Constraint 86 626 9.4769 11.8462 17.7692 81.9921 Constraint 78 626 5.5545 6.9432 10.4147 81.9921 Constraint 68 626 6.1792 7.7240 11.5860 81.9921 Constraint 62 626 4.0164 5.0205 7.5307 81.9921 Constraint 97 601 6.2160 7.7699 11.6549 81.9921 Constraint 165 287 9.6823 12.1029 18.1543 81.9919 Constraint 391 660 6.1104 7.6380 11.4570 81.8631 Constraint 223 391 7.5996 9.4995 14.2493 81.7352 Constraint 350 427 9.8610 12.3262 18.4893 81.2935 Constraint 358 626 9.4240 11.7800 17.6699 81.1922 Constraint 312 593 8.6055 10.7569 16.1354 81.1684 Constraint 312 551 9.2327 11.5409 17.3114 81.0366 Constraint 157 295 9.7938 12.2423 18.3634 80.9933 Constraint 78 584 8.7911 10.9888 16.4832 80.9925 Constraint 36 418 7.5429 9.4287 14.1430 80.9925 Constraint 36 410 5.6668 7.0836 10.6253 80.9925 Constraint 36 402 8.8595 11.0744 16.6116 80.9925 Constraint 173 280 9.8521 12.3151 18.4726 80.9924 Constraint 110 312 8.1735 10.2169 15.3253 80.9922 Constraint 97 615 9.3161 11.6451 17.4676 80.9921 Constraint 189 491 6.6023 8.2528 12.3793 79.9978 Constraint 130 593 8.4110 10.5137 15.7705 79.9976 Constraint 36 649 4.3355 5.4194 8.1291 79.9924 Constraint 36 642 5.7545 7.1931 10.7896 79.9924 Constraint 68 634 8.2276 10.2845 15.4268 79.9923 Constraint 62 634 6.1422 7.6778 11.5166 79.9923 Constraint 54 626 5.8571 7.3214 10.9820 79.9921 Constraint 374 660 5.2109 6.5136 9.7704 79.8634 Constraint 383 660 6.1641 7.7051 11.5577 79.8633 Constraint 223 470 6.3094 7.8867 11.8301 79.7348 Constraint 157 526 9.0636 11.3295 16.9942 78.9981 Constraint 157 502 8.5984 10.7480 16.1220 78.9978 Constraint 117 312 7.1953 8.9941 13.4912 78.9935 Constraint 68 593 8.5596 10.6995 16.0493 78.9922 Constraint 43 626 7.0492 8.8115 13.2173 78.9922 Constraint 97 593 4.8366 6.0458 9.0687 78.9921 Constraint 43 340 8.5376 10.6720 16.0080 78.9921 Constraint 223 491 8.1735 10.2168 15.3252 78.9921 Constraint 97 319 7.9275 9.9094 14.8641 77.9934 Constraint 54 634 4.3544 5.4429 8.1644 77.9923 Constraint 43 634 5.9034 7.3792 11.0688 77.9923 Constraint 165 410 9.7935 12.2419 18.3628 77.9920 Constraint 358 660 7.5046 9.3807 14.0711 77.7415 Constraint 223 483 7.6138 9.5173 14.2759 77.1140 Constraint 243 470 9.4117 11.7646 17.6469 77.0345 Constraint 62 324 9.2804 11.6004 17.4007 76.9978 Constraint 54 601 9.6927 12.1159 18.1738 76.9923 Constraint 78 634 9.5255 11.9069 17.8603 76.9923 Constraint 97 551 7.9488 9.9360 14.9040 76.9921 Constraint 223 526 8.8170 11.0213 16.5319 76.6130 Constraint 165 491 8.8981 11.1226 16.6839 75.9984 Constraint 306 610 9.7457 12.1822 18.2733 75.9982 Constraint 189 463 7.9330 9.9162 14.8743 75.9978 Constraint 189 526 6.7281 8.4101 12.6151 75.7451 Constraint 434 559 9.3138 11.6423 17.4634 74.9980 Constraint 86 306 8.5166 10.6457 15.9685 74.9978 Constraint 97 340 8.8859 11.1074 16.6611 74.9936 Constraint 62 329 8.7083 10.8853 16.3280 74.9924 Constraint 62 280 9.3543 11.6929 17.5394 74.9924 Constraint 312 615 9.7528 12.1910 18.2864 74.1685 Constraint 391 483 9.3919 11.7398 17.6097 74.1213 Constraint 255 533 9.8657 12.3322 18.4983 74.0349 Constraint 280 402 9.7484 12.1855 18.2783 74.0347 Constraint 97 559 8.3579 10.4474 15.6711 73.9921 Constraint 263 533 9.6586 12.0733 18.1100 73.9187 Constraint 189 391 7.6153 9.5191 14.2786 73.4527 Constraint 173 491 9.6193 12.0241 18.0362 72.9984 Constraint 189 483 7.0642 8.8302 13.2453 72.9978 Constraint 243 660 7.5277 9.4096 14.1144 72.9942 Constraint 62 391 9.7354 12.1693 18.2539 72.9934 Constraint 212 470 7.1905 8.9882 13.4822 72.7406 Constraint 157 358 9.8683 12.3354 18.5030 71.9994 Constraint 146 391 9.9279 12.4099 18.6149 71.9991 Constraint 117 287 7.9378 9.9222 14.8833 71.9960 Constraint 36 634 4.9296 6.1620 9.2430 71.9926 Constraint 36 626 8.5209 10.6511 15.9766 71.9926 Constraint 280 626 9.7473 12.1842 18.2763 71.3143 Constraint 117 306 7.0586 8.8233 13.2349 70.9963 Constraint 146 559 9.6594 12.0743 18.1115 70.9926 Constraint 455 649 9.7143 12.1429 18.2144 70.8685 Constraint 434 540 9.4816 11.8521 17.7781 70.2992 Constraint 54 340 8.6159 10.7699 16.1548 69.9992 Constraint 78 287 9.4127 11.7659 17.6489 69.9978 Constraint 68 329 8.9160 11.1450 16.7175 69.9978 Constraint 97 626 9.5683 11.9603 17.9405 69.9921 Constraint 189 402 7.9037 9.8796 14.8194 69.7467 Constraint 526 634 9.8817 12.3521 18.5282 69.0674 Constraint 189 470 8.4483 10.5604 15.8406 68.9992 Constraint 212 502 8.5837 10.7297 16.0945 68.6187 Constraint 130 526 9.4930 11.8662 17.7994 67.9981 Constraint 173 512 9.6539 12.0673 18.1010 67.9977 Constraint 173 463 9.7764 12.2205 18.3307 67.9921 Constraint 183 470 8.9050 11.1312 16.6969 66.9981 Constraint 130 642 9.8016 12.2520 18.3781 66.9980 Constraint 369 660 7.9398 9.9248 14.8872 66.9956 Constraint 255 660 8.4106 10.5132 15.7698 66.9955 Constraint 110 593 7.1296 8.9120 13.3680 66.9941 Constraint 410 545 9.6807 12.1009 18.1514 66.7422 Constraint 97 329 8.7119 10.8899 16.3348 65.9937 Constraint 130 568 9.5902 11.9877 17.9815 65.9924 Constraint 97 434 9.4265 11.7831 17.6747 65.9922 Constraint 212 391 8.0893 10.1117 15.1675 65.7409 Constraint 350 551 9.7293 12.1616 18.2424 65.4157 Constraint 212 483 8.2375 10.2969 15.4454 64.9978 Constraint 43 660 9.0762 11.3452 17.0179 64.9940 Constraint 78 383 9.8789 12.3486 18.5229 63.9981 Constraint 36 660 8.8689 11.0862 16.6292 63.9943 Constraint 463 573 9.4079 11.7598 17.6397 63.9940 Constraint 86 434 9.8782 12.3477 18.5215 63.9924 Constraint 255 502 9.3559 11.6948 17.5423 63.9189 Constraint 197 502 6.3388 7.9235 11.8853 63.7453 Constraint 223 410 8.1334 10.1667 15.2501 63.7349 Constraint 402 573 9.5449 11.9312 17.8967 62.9940 Constraint 25 649 5.9361 7.4201 11.1301 61.9982 Constraint 43 255 9.6089 12.0112 18.0167 61.9927 Constraint 455 642 10.0414 12.5517 18.8276 61.1202 Constraint 25 642 7.7215 9.6518 14.4777 60.9983 Constraint 319 427 9.8831 12.3539 18.5309 60.9198 Constraint 287 358 9.6910 12.1137 18.1705 60.0418 Constraint 36 470 9.2617 11.5771 17.3656 59.9995 Constraint 86 324 9.7616 12.2020 18.3030 59.9978 Constraint 427 584 8.7034 10.8793 16.3189 59.9935 Constraint 36 615 9.9108 12.3885 18.5828 59.9928 Constraint 526 642 9.6791 12.0989 18.1483 59.8686 Constraint 189 512 7.2692 9.0865 13.6297 59.7454 Constraint 243 483 9.4815 11.8518 17.7778 59.1202 Constraint 25 410 9.1194 11.3992 17.0989 58.9995 Constraint 545 634 9.7471 12.1838 18.2757 58.9993 Constraint 117 593 8.2986 10.3732 15.5598 57.9994 Constraint 470 642 9.3920 11.7400 17.6100 57.9983 Constraint 117 559 7.7748 9.7185 14.5778 57.9922 Constraint 427 502 9.7418 12.1773 18.2659 57.9144 Constraint 206 502 7.2966 9.1207 13.6811 57.8722 Constraint 212 463 8.6800 10.8500 16.2751 57.6188 Constraint 319 615 9.9126 12.3907 18.5860 57.0464 Constraint 165 610 9.7030 12.1288 18.1932 56.9982 Constraint 97 568 8.9935 11.2419 16.8628 56.9922 Constraint 189 533 7.8537 9.8171 14.7256 56.7457 Constraint 295 358 9.7167 12.1458 18.2187 56.7366 Constraint 306 369 9.9791 12.4739 18.7109 56.6150 Constraint 97 287 9.5606 11.9508 17.9262 55.9979 Constraint 212 491 7.8612 9.8265 14.7398 55.9978 Constraint 410 660 9.1028 11.3785 17.0678 55.8635 Constraint 402 491 9.8022 12.2528 18.3791 55.2999 Constraint 183 383 9.1236 11.4045 17.1067 54.9986 Constraint 183 374 9.2441 11.5551 17.3326 54.9986 Constraint 17 649 5.7183 7.1478 10.7218 54.9983 Constraint 25 634 8.7456 10.9320 16.3980 54.9983 Constraint 110 306 8.5526 10.6908 16.0361 54.9941 Constraint 312 584 9.4962 11.8702 17.8053 54.0689 Constraint 36 455 9.8082 12.2603 18.3904 53.9995 Constraint 25 391 9.0518 11.3148 16.9722 53.9982 Constraint 130 383 9.9270 12.4087 18.6131 53.9937 Constraint 234 369 10.1621 12.7026 19.0539 53.6204 Constraint 455 615 9.9023 12.3779 18.5669 53.1201 Constraint 206 491 6.9621 8.7026 13.0539 52.9985 Constraint 165 358 10.0068 12.5085 18.7628 52.9981 Constraint 97 427 9.5689 11.9611 17.9417 52.9926 Constraint 189 517 7.1133 8.8917 13.3375 52.7457 Constraint 206 483 8.5856 10.7320 16.0980 51.9985 Constraint 533 610 9.6369 12.0461 18.0692 51.9981 Constraint 402 660 9.1029 11.3787 17.0680 51.9944 Constraint 110 584 7.2582 9.0728 13.6092 51.9929 Constraint 223 455 8.3754 10.4692 15.7039 51.7349 Constraint 17 642 8.5885 10.7357 16.1035 50.9983 Constraint 25 383 8.7530 10.9413 16.4119 50.9982 Constraint 197 491 5.4359 6.7948 10.1922 50.9982 Constraint 117 319 8.6124 10.7655 16.1483 50.9980 Constraint 43 374 10.0309 12.5386 18.8079 50.9940 Constraint 212 410 8.9634 11.2042 16.8064 50.7408 Constraint 117 584 8.5528 10.6909 16.0364 49.9925 Constraint 223 517 9.2757 11.5946 17.3918 49.7409 Constraint 183 551 9.3702 11.7128 17.5692 48.9994 Constraint 68 584 8.9967 11.2459 16.8688 48.9984 Constraint 146 573 9.8108 12.2635 18.3952 48.9981 Constraint 197 512 7.6402 9.5503 14.3254 48.7454 Constraint 243 533 9.9099 12.3874 18.5811 48.7409 Constraint 17 391 8.1442 10.1803 15.2704 47.9985 Constraint 446 533 9.5557 11.9446 17.9170 47.9982 Constraint 110 573 8.8317 11.0396 16.5595 47.9925 Constraint 418 517 9.4026 11.7532 17.6298 47.7424 Constraint 183 410 9.3322 11.6653 17.4979 46.9982 Constraint 157 559 9.6976 12.1220 18.1830 46.9982 Constraint 391 502 9.5639 11.9549 17.9323 46.9190 Constraint 197 526 8.0982 10.1227 15.1841 46.7455 Constraint 197 517 7.7681 9.7101 14.5652 45.7455 Constraint 551 642 9.8439 12.3049 18.4573 45.1216 Constraint 463 568 9.7636 12.2045 18.3068 44.9994 Constraint 17 383 8.6377 10.7972 16.1958 44.9985 Constraint 197 483 6.8559 8.5699 12.8548 44.9982 Constraint 446 559 9.6632 12.0790 18.1185 44.9982 Constraint 383 667 8.5604 10.7005 16.0508 44.8654 Constraint 319 601 10.0120 12.5150 18.7725 44.1995 Constraint 183 369 9.8816 12.3520 18.5280 43.9999 Constraint 470 626 10.0553 12.5692 18.8537 43.9995 Constraint 446 584 9.6744 12.0930 18.1396 43.9994 Constraint 173 483 9.8795 12.3494 18.5241 43.9984 Constraint 374 667 7.5421 9.4277 14.1415 43.9964 Constraint 17 410 9.1321 11.4151 17.1226 42.9985 Constraint 86 350 9.8864 12.3580 18.5370 42.9979 Constraint 427 593 9.6118 12.0148 18.0221 42.0614 Constraint 173 551 9.9520 12.4400 18.6600 41.9995 Constraint 25 660 7.2692 9.0865 13.6298 41.9982 Constraint 350 660 9.2419 11.5523 17.3285 41.9957 Constraint 157 312 10.1096 12.6370 18.9554 41.9934 Constraint 43 319 10.0793 12.5991 18.8987 40.9998 Constraint 329 610 9.9336 12.4170 18.6255 40.9996 Constraint 117 610 8.6752 10.8440 16.2660 40.9964 Constraint 117 573 8.0076 10.0095 15.0143 40.9926 Constraint 391 667 7.9764 9.9705 14.9558 40.7436 Constraint 383 526 9.9234 12.4042 18.6063 40.7421 Constraint 17 660 6.1515 7.6894 11.5341 39.9983 Constraint 117 324 9.2823 11.6029 17.4043 39.9980 Constraint 434 517 9.7356 12.1694 18.2542 39.6202 Constraint 206 470 8.5718 10.7147 16.0721 39.6190 Constraint 340 634 9.7466 12.1833 18.2749 39.3217 Constraint 189 551 9.3137 11.6421 17.4631 38.9999 Constraint 263 551 10.1198 12.6498 18.9747 38.9995 Constraint 463 559 10.1036 12.6295 18.9443 38.9991 Constraint 130 263 10.1247 12.6559 18.9838 38.9935 Constraint 189 374 8.5570 10.6963 16.0445 38.4540 Constraint 189 545 8.8773 11.0967 16.6450 38.0000 Constraint 62 551 9.7963 12.2453 18.3680 37.9999 Constraint 189 410 9.3078 11.6347 17.4521 37.9994 Constraint 110 559 8.7940 10.9925 16.4887 37.9927 Constraint 117 551 8.3338 10.4172 15.6259 37.9926 Constraint 62 573 9.7782 12.2227 18.3341 36.9999 Constraint 183 545 9.9254 12.4067 18.6101 36.9994 Constraint 263 660 9.6700 12.0875 18.1313 36.9958 Constraint 197 470 8.1086 10.1357 15.2036 36.7455 Constraint 212 402 9.5464 11.9330 17.8995 36.6204 Constraint 263 642 10.1934 12.7418 19.1126 35.9996 Constraint 255 610 9.9443 12.4304 18.6456 35.9986 Constraint 483 568 9.9241 12.4051 18.6076 35.9981 Constraint 540 610 9.7343 12.1679 18.2518 35.1215 Constraint 206 526 9.1689 11.4612 17.1918 34.8725 Constraint 427 491 9.8907 12.3633 18.5450 34.2999 Constraint 410 551 10.1593 12.6991 19.0486 34.1204 Constraint 197 391 9.0019 11.2524 16.8786 34.0351 Constraint 17 374 8.7434 10.9292 16.3938 33.9999 Constraint 110 601 8.9697 11.2121 16.8181 33.9995 Constraint 62 306 9.7232 12.1540 18.2310 33.9984 Constraint 110 610 9.1123 11.3904 17.0856 33.9945 Constraint 212 649 8.9104 11.1380 16.7070 33.8687 Constraint 197 533 9.5399 11.9249 17.8873 33.7455 Constraint 189 540 8.9912 11.2390 16.8585 33.0000 Constraint 117 329 8.5795 10.7243 16.0865 32.9980 Constraint 206 391 8.1994 10.2493 15.3739 32.7424 Constraint 483 626 10.0470 12.5587 18.8381 32.1217 Constraint 212 455 8.9618 11.2022 16.8033 32.1217 Constraint 306 551 9.8375 12.2968 18.4453 32.0425 Constraint 189 383 8.9057 11.1321 16.6982 31.9995 Constraint 183 274 9.9590 12.4487 18.6731 31.9986 Constraint 551 634 9.8841 12.3552 18.5328 31.9985 Constraint 374 673 8.7486 10.9358 16.4037 31.8719 Constraint 36 350 10.1880 12.7351 19.1026 30.9999 Constraint 212 526 8.6096 10.7620 16.1431 30.9997 Constraint 234 660 9.2552 11.5690 17.3535 30.9960 Constraint 189 649 9.1635 11.4543 17.1815 30.7069 Constraint 427 512 10.0471 12.5589 18.8383 30.0424 Constraint 319 573 10.0636 12.5796 18.8693 29.9999 Constraint 130 234 9.9082 12.3852 18.5779 29.9995 Constraint 78 559 9.9830 12.4787 18.7181 29.9986 Constraint 25 358 9.3264 11.6580 17.4870 29.9984 Constraint 165 573 10.1458 12.6823 19.0234 29.9983 Constraint 243 667 9.3357 11.6696 17.5044 29.9963 Constraint 483 559 10.2562 12.8203 19.2304 29.1204 Constraint 212 517 8.7750 10.9688 16.4532 28.9998 Constraint 243 551 9.9252 12.4065 18.6098 28.9998 Constraint 146 502 9.7349 12.1687 18.2530 28.9994 Constraint 117 568 8.0263 10.0328 15.0493 28.9926 Constraint 206 512 7.7129 9.6412 14.4618 28.8733 Constraint 197 463 7.9572 9.9465 14.9197 28.7455 Constraint 110 287 9.1585 11.4481 17.1722 27.9985 Constraint 206 517 8.3600 10.4500 15.6749 27.8728 Constraint 533 626 10.0643 12.5804 18.8706 27.8691 Constraint 483 634 10.1778 12.7223 19.0834 27.0000 Constraint 97 324 9.2979 11.6224 17.4335 26.9998 Constraint 183 649 9.9949 12.4937 18.7405 26.9998 Constraint 117 601 9.4245 11.7806 17.6709 26.9996 Constraint 173 660 9.7110 12.1387 18.2081 26.9961 Constraint 36 463 10.0418 12.5523 18.8284 26.9943 Constraint 223 649 7.8909 9.8637 14.7955 26.8686 Constraint 17 358 9.4774 11.8467 17.7701 25.9998 Constraint 117 295 8.8880 11.1100 16.6650 25.9996 Constraint 25 667 6.9395 8.6744 13.0115 25.9983 Constraint 130 295 9.7526 12.1907 18.2861 25.9982 Constraint 9 649 7.6023 9.5028 14.2543 24.9999 Constraint 183 642 10.0202 12.5253 18.7879 24.9987 Constraint 86 551 9.9727 12.4658 18.6987 24.9983 Constraint 97 350 9.9589 12.4486 18.6729 24.9942 Constraint 110 568 9.0629 11.3287 16.9930 24.9941 Constraint 189 369 9.6590 12.0737 18.1106 24.7470 Constraint 206 463 8.9716 11.2145 16.8218 24.6199 Constraint 9 642 9.0581 11.3226 16.9839 24.0000 Constraint 25 374 9.6146 12.0183 18.0274 23.9998 Constraint 78 418 9.9931 12.4913 18.7370 23.9981 Constraint 165 470 9.9004 12.3754 18.5632 23.9980 Constraint 358 667 8.4055 10.5069 15.7603 23.9979 Constraint 183 427 9.5000 11.8749 17.8124 22.9983 Constraint 110 329 9.6317 12.0397 18.0595 22.9961 Constraint 329 626 10.0591 12.5739 18.8609 22.3203 Constraint 329 601 9.8284 12.2856 18.4283 22.3203 Constraint 434 533 9.7678 12.2098 18.3146 21.9984 Constraint 9 374 9.5696 11.9620 17.9430 20.9999 Constraint 54 455 10.0568 12.5710 18.8565 20.9998 Constraint 17 634 9.5438 11.9297 17.8945 20.9998 Constraint 36 667 9.0431 11.3039 16.9558 20.9996 Constraint 402 540 10.1633 12.7041 19.0561 20.9996 Constraint 17 667 6.4416 8.0520 12.0780 20.9986 Constraint 183 540 9.8610 12.3262 18.4894 20.9981 Constraint 117 340 10.1291 12.6614 18.9921 20.9980 Constraint 97 545 9.6733 12.0917 18.1375 20.9925 Constraint 189 427 9.3162 11.6453 17.4679 20.0000 Constraint 43 667 9.3414 11.6768 17.5152 19.9996 Constraint 117 533 8.8360 11.0450 16.5676 19.9983 Constraint 78 165 9.5972 11.9965 17.9947 19.9981 Constraint 146 463 9.9165 12.3956 18.5935 19.9979 Constraint 410 517 9.0660 11.3325 16.9987 19.7424 Constraint 312 559 10.0384 12.5480 18.8221 19.1160 Constraint 9 383 8.8088 11.0110 16.5166 18.9999 Constraint 9 358 8.7545 10.9431 16.4147 18.9999 Constraint 197 455 9.6414 12.0518 18.0776 18.9986 Constraint 223 418 8.2073 10.2591 15.3887 18.7423 Constraint 189 660 8.6048 10.7560 16.1340 18.7071 Constraint 455 551 9.7568 12.1960 18.2940 17.9982 Constraint 243 427 10.0644 12.5804 18.8707 17.9980 Constraint 110 551 9.4624 11.8280 17.7420 17.9967 Constraint 470 660 9.0907 11.3633 17.0450 17.9960 Constraint 206 374 9.2118 11.5148 17.2722 17.7426 Constraint 189 455 9.7777 12.2221 18.3332 17.0000 Constraint 9 660 8.2665 10.3332 15.4998 16.9999 Constraint 117 540 9.5644 11.9555 17.9332 16.9983 Constraint 223 660 8.9605 11.2006 16.8009 16.9960 Constraint 358 673 8.5749 10.7186 16.0779 16.8736 Constraint 383 673 8.8494 11.0618 16.5927 16.8733 Constraint 223 512 9.5444 11.9306 17.8958 16.6196 Constraint 212 660 9.7697 12.2121 18.3181 16.0000 Constraint 117 280 9.4776 11.8470 17.7704 15.9999 Constraint 183 660 9.0548 11.3185 16.9778 15.9999 Constraint 223 374 10.0882 12.6103 18.9154 15.9998 Constraint 212 374 9.6779 12.0974 18.1461 15.6206 Constraint 434 642 9.8924 12.3655 18.5483 15.1203 Constraint 243 319 10.0444 12.5556 18.8333 14.9996 Constraint 234 559 9.9024 12.3781 18.5671 14.9996 Constraint 146 545 9.6785 12.0982 18.1473 14.9994 Constraint 306 626 9.6971 12.1213 18.1820 14.9987 Constraint 78 358 9.8664 12.3330 18.4995 14.9987 Constraint 165 660 10.3041 12.8802 19.3202 14.9960 Constraint 274 502 9.8235 12.2794 18.4191 14.9190 Constraint 274 402 10.0262 12.5327 18.7991 14.4216 Constraint 427 649 9.7433 12.1792 18.2688 14.1215 Constraint 358 680 9.2761 11.5951 17.3926 14.0983 Constraint 483 573 10.2236 12.7795 19.1692 14.0000 Constraint 54 446 10.1905 12.7382 19.1072 14.0000 Constraint 189 642 9.3170 11.6463 17.4694 13.9999 Constraint 280 660 9.7246 12.1557 18.2335 13.9998 Constraint 157 512 9.7536 12.1920 18.2880 13.9985 Constraint 374 680 8.4959 10.6199 15.9299 13.9983 Constraint 165 418 9.5180 11.8975 17.8463 13.9982 Constraint 369 667 9.1029 11.3786 17.0679 13.9979 Constraint 358 634 9.7628 12.2035 18.3053 13.1985 Constraint 391 680 8.7716 10.9645 16.4468 13.0983 Constraint 206 410 8.0760 10.0950 15.1425 13.0355 Constraint 206 533 9.2852 11.6064 17.4097 13.0000 Constraint 212 512 8.5294 10.6617 15.9926 13.0000 Constraint 223 427 9.6790 12.0988 18.1482 12.9998 Constraint 68 551 10.2862 12.8577 19.2866 12.9986 Constraint 17 673 8.7413 10.9266 16.3900 12.9986 Constraint 36 358 9.3308 11.6635 17.4952 12.9985 Constraint 223 634 8.6434 10.8042 16.2063 12.7471 Constraint 287 551 10.0415 12.5519 18.8279 12.6208 Constraint 197 374 9.2022 11.5027 17.2541 12.2882 Constraint 324 626 10.0769 12.5961 18.8942 12.1997 Constraint 319 526 9.0570 11.3212 16.9818 12.0424 Constraint 9 350 9.9662 12.4577 18.6866 12.0000 Constraint 402 559 10.1982 12.7477 19.1216 11.9999 Constraint 62 369 10.0632 12.5791 18.8686 11.9999 Constraint 383 470 10.1408 12.6760 19.0140 11.9999 Constraint 54 358 9.6906 12.1132 18.1698 11.9986 Constraint 223 446 9.8503 12.3129 18.4694 11.9985 Constraint 25 673 8.3393 10.4242 15.6363 11.9985 Constraint 86 287 9.7788 12.2235 18.3353 11.9983 Constraint 410 667 9.1651 11.4564 17.1846 11.8688 Constraint 340 551 9.6677 12.0846 18.1269 11.1218 Constraint 383 680 8.3824 10.4780 15.7171 11.0983 Constraint 470 540 9.1490 11.4362 17.1544 11.0425 Constraint 206 383 9.3564 11.6955 17.5432 11.0354 Constraint 78 545 10.2664 12.8330 19.2496 10.9999 Constraint 223 642 8.5308 10.6635 15.9953 10.9998 Constraint 78 157 9.7528 12.1910 18.2864 10.9986 Constraint 197 402 9.0794 11.3493 17.0239 10.7472 Constraint 369 649 10.0447 12.5558 18.8338 10.7472 Constraint 350 526 9.7138 12.1422 18.2133 10.7427 Constraint 402 512 9.6587 12.0733 18.1100 10.7425 Constraint 391 517 9.7926 12.2408 18.3611 10.7425 Constraint 206 402 8.4617 10.5771 15.8656 10.6208 Constraint 243 491 9.7825 12.2281 18.3422 10.2996 Constraint 3 649 9.2872 11.6091 17.4136 9.9999 Constraint 62 165 10.0940 12.6175 18.9263 9.9998 Constraint 9 391 9.7013 12.1266 18.1899 9.9998 Constraint 189 667 9.2971 11.6214 17.4321 9.9997 Constraint 62 463 10.1467 12.6834 19.0251 9.9996 Constraint 197 540 9.8614 12.3267 18.4901 9.9986 Constraint 68 402 9.8011 12.2513 18.3770 9.9983 Constraint 206 660 8.1106 10.1382 15.2073 9.9955 Constraint 234 319 9.4565 11.8207 17.7310 9.9206 Constraint 391 673 8.6110 10.7638 16.1456 9.8732 Constraint 206 649 7.1445 8.9306 13.3959 9.8691 Constraint 517 626 9.3450 11.6812 17.5219 9.8688 Constraint 206 455 9.2350 11.5438 17.3156 9.7473 Constraint 319 634 9.6548 12.0685 18.1027 9.1998 Constraint 526 615 9.9763 12.4704 18.7056 9.1217 Constraint 274 660 10.2360 12.7950 19.1926 9.0000 Constraint 234 610 10.1102 12.6378 18.9567 9.0000 Constraint 165 306 9.7796 12.2245 18.3368 8.9999 Constraint 263 324 10.2357 12.7946 19.1919 8.9997 Constraint 234 434 10.2568 12.8210 19.2315 8.9997 Constraint 117 545 9.2843 11.6054 17.4081 8.9997 Constraint 117 434 9.1134 11.3918 17.0877 8.9997 Constraint 312 427 9.6302 12.0377 18.0566 8.9997 Constraint 130 540 9.5616 11.9520 17.9281 8.9996 Constraint 130 463 9.8256 12.2821 18.4231 8.9994 Constraint 117 274 10.1352 12.6690 19.0036 8.9987 Constraint 157 626 10.0588 12.5735 18.8602 8.9987 Constraint 43 369 10.1218 12.6522 18.9783 8.9986 Constraint 68 146 9.5993 11.9991 17.9986 8.9986 Constraint 223 533 9.9608 12.4510 18.6765 8.9985 Constraint 165 434 9.6904 12.1129 18.1694 8.9984 Constraint 130 358 10.1548 12.6935 19.0403 8.9984 Constraint 110 295 9.0912 11.3640 17.0460 8.9984 Constraint 410 502 9.9040 12.3799 18.5699 8.6203 Constraint 340 427 10.1254 12.6567 18.9851 8.1218 Constraint 255 418 10.1530 12.6912 19.0368 8.1202 Constraint 54 463 10.1394 12.6742 19.0113 8.0000 Constraint 9 634 9.5669 11.9586 17.9379 8.0000 Constraint 17 212 9.4675 11.8344 17.7515 7.9999 Constraint 223 667 9.8650 12.3313 18.4969 7.9998 Constraint 455 573 9.9987 12.4984 18.7476 7.9987 Constraint 110 319 9.8484 12.3105 18.4658 7.9987 Constraint 17 680 9.1246 11.4058 17.1087 7.9985 Constraint 25 680 8.0690 10.0863 15.1294 7.9985 Constraint 255 667 9.4203 11.7754 17.6630 7.9979 Constraint 369 673 8.7018 10.8773 16.3159 7.8736 Constraint 212 383 9.9482 12.4352 18.6528 7.8736 Constraint 197 410 9.4188 11.7736 17.6603 7.8736 Constraint 243 517 9.7409 12.1761 18.2641 7.7425 Constraint 243 512 9.6155 12.0194 18.0291 7.7425 Constraint 319 533 10.1365 12.6707 19.0060 7.3000 Constraint 243 634 10.1613 12.7017 19.0525 7.1986 Constraint 410 680 8.7073 10.8841 16.3262 7.0997 Constraint 3 660 6.6630 8.3287 12.4931 6.9999 Constraint 17 418 10.0479 12.5599 18.8398 6.9999 Constraint 173 358 10.1046 12.6308 18.9462 6.9999 Constraint 97 280 10.1257 12.6572 18.9857 6.9999 Constraint 223 626 9.8144 12.2680 18.4021 6.9998 Constraint 223 383 8.2556 10.3195 15.4792 6.9998 Constraint 17 402 9.4625 11.8281 17.7421 6.9998 Constraint 173 350 9.8315 12.2894 18.4341 6.9997 Constraint 68 324 8.3875 10.4844 15.7266 6.9986 Constraint 146 434 9.6619 12.0774 18.1160 6.9986 Constraint 312 642 10.0549 12.5686 18.8529 6.9986 Constraint 86 427 9.6364 12.0455 18.0682 6.9984 Constraint 183 418 9.5356 11.9195 17.8792 6.9983 Constraint 197 660 7.3557 9.1947 13.7920 6.4146 Constraint 280 551 9.6723 12.0903 18.1355 6.2999 Constraint 206 642 9.1976 11.4970 17.2455 6.2882 Constraint 206 667 8.7322 10.9153 16.3729 6.2882 Constraint 212 533 9.0207 11.2759 16.9138 6.0000 Constraint 36 427 9.8368 12.2959 18.4439 6.0000 Constraint 25 350 10.2383 12.7979 19.1968 6.0000 Constraint 25 418 9.6734 12.0918 18.1376 6.0000 Constraint 3 642 9.9678 12.4598 18.6897 6.0000 Constraint 212 418 9.4993 11.8741 17.8111 6.0000 Constraint 383 610 9.9475 12.4344 18.6515 5.9999 Constraint 383 551 9.8955 12.3694 18.5540 5.9999 Constraint 340 573 9.7884 12.2355 18.3532 5.9999 Constraint 17 470 8.6803 10.8503 16.2755 5.9999 Constraint 17 243 8.8593 11.0741 16.6112 5.9999 Constraint 43 673 8.8906 11.1132 16.6699 5.9999 Constraint 223 551 10.1745 12.7181 19.0772 5.9998 Constraint 223 545 9.8945 12.3682 18.5522 5.9998 Constraint 36 223 9.1497 11.4372 17.1558 5.9998 Constraint 36 680 7.7200 9.6500 14.4750 5.9998 Constraint 212 667 8.7296 10.9119 16.3679 5.9998 Constraint 54 391 10.0942 12.6177 18.9265 5.9997 Constraint 117 427 9.8791 12.3488 18.5232 5.9997 Constraint 517 634 9.9863 12.4829 18.7243 5.9997 Constraint 545 642 10.1365 12.6707 19.0060 5.9996 Constraint 157 610 10.1572 12.6966 19.0448 5.9987 Constraint 243 680 9.8800 12.3499 18.5249 5.9987 Constraint 455 540 10.1072 12.6340 18.9511 5.9987 Constraint 274 533 8.8077 11.0097 16.5145 5.9984 Constraint 455 533 9.8483 12.3104 18.4656 5.9984 Constraint 263 463 10.2487 12.8109 19.2164 5.9984 Constraint 243 418 10.0677 12.5847 18.8770 5.9984 Constraint 183 455 8.8613 11.0767 16.6150 5.9984 Constraint 183 446 8.7706 10.9632 16.4449 5.9984 Constraint 165 455 9.6217 12.0271 18.0406 5.9984 Constraint 165 446 7.8735 9.8419 14.7629 5.9984 Constraint 157 463 9.7932 12.2415 18.3623 5.9984 Constraint 157 427 9.4746 11.8432 17.7649 5.9984 Constraint 78 446 10.0674 12.5843 18.8765 5.9984 Constraint 410 673 9.0621 11.3276 16.9914 5.8732 Constraint 189 274 8.5094 10.6368 15.9551 5.7472 Constraint 383 502 10.2088 12.7610 19.1415 5.6206 Constraint 280 391 9.9822 12.4777 18.7166 5.4216 Constraint 306 593 10.0943 12.6179 18.9268 5.2205 Constraint 340 526 10.1244 12.6555 18.9832 5.1218 Constraint 312 402 10.1210 12.6512 18.9768 5.1216 Constraint 206 540 10.2310 12.7888 19.1831 5.0000 Constraint 189 634 9.6176 12.0220 18.0330 5.0000 Constraint 189 626 8.8226 11.0283 16.5424 5.0000 Constraint 189 418 9.0944 11.3680 17.0520 5.0000 Constraint 183 559 9.7317 12.1646 18.2469 4.9999 Constraint 43 680 8.8702 11.0877 16.6315 4.9998 Constraint 62 660 9.4197 11.7746 17.6620 4.9998 Constraint 173 287 8.8054 11.0067 16.5101 4.9996 Constraint 173 517 9.5768 11.9711 17.9566 4.9995 Constraint 306 584 10.1985 12.7481 19.1221 4.9991 Constraint 157 540 9.2827 11.6034 17.4050 4.9985 Constraint 97 533 10.2676 12.8345 19.2517 4.9985 Constraint 197 383 9.8747 12.3434 18.5152 4.8736 Constraint 418 667 9.9945 12.4932 18.7397 4.8690 Constraint 502 626 10.2241 12.7802 19.1702 4.7472 Constraint 206 634 9.8006 12.2507 18.3761 4.2882 Constraint 340 593 10.1000 12.6249 18.9374 4.0691 Constraint 3 383 9.5461 11.9327 17.8990 4.0000 Constraint 3 358 8.3861 10.4826 15.7239 4.0000 Constraint 197 667 8.1608 10.2010 15.3015 4.0000 Constraint 3 374 8.1090 10.1363 15.2045 3.9999 Constraint 319 559 10.2355 12.7943 19.1915 3.9999 Constraint 68 383 9.5154 11.8943 17.8415 3.9999 Constraint 17 206 9.7289 12.1611 18.2416 3.9999 Constraint 146 634 9.6123 12.0154 18.0231 3.9999 Constraint 197 545 9.4958 11.8698 17.8047 3.9999 Constraint 197 427 9.4966 11.8707 17.8061 3.9999 Constraint 146 615 8.8645 11.0807 16.6210 3.9999 Constraint 146 601 9.7143 12.1428 18.2143 3.9999 Constraint 130 634 9.9357 12.4196 18.6295 3.9999 Constraint 117 626 9.7846 12.2308 18.3462 3.9999 Constraint 165 649 10.2247 12.7808 19.1713 3.9998 Constraint 391 691 8.6944 10.8680 16.3021 3.9991 Constraint 36 691 9.6018 12.0023 18.0034 3.9991 Constraint 68 306 8.7121 10.8901 16.3352 3.9987 Constraint 312 434 10.1821 12.7276 19.0915 3.9987 Constraint 165 634 9.1709 11.4636 17.1954 3.9986 Constraint 402 667 9.3437 11.6796 17.5194 3.9978 Constraint 306 573 10.1281 12.6601 18.9901 3.7073 Constraint 197 649 8.3907 10.4884 15.7326 3.4146 Constraint 280 533 10.2606 12.8257 19.2386 3.2987 Constraint 410 610 10.3000 12.8751 19.3126 3.2000 Constraint 306 559 9.7773 12.2216 18.3325 3.1219 Constraint 274 340 9.5489 11.9362 17.9042 3.1219 Constraint 446 601 10.3626 12.9532 19.4298 3.0000 Constraint 446 593 10.1485 12.6856 19.0284 3.0000 Constraint 418 601 10.1617 12.7021 19.0531 3.0000 Constraint 418 568 10.3932 12.9915 19.4873 3.0000 Constraint 391 551 10.3623 12.9528 19.4292 3.0000 Constraint 350 601 10.0232 12.5290 18.7935 3.0000 Constraint 329 593 10.2159 12.7699 19.1549 3.0000 Constraint 324 642 9.7664 12.2080 18.3120 3.0000 Constraint 319 584 9.1365 11.4206 17.1310 3.0000 Constraint 234 573 10.2269 12.7837 19.1755 3.0000 Constraint 197 369 9.1611 11.4514 17.1770 3.0000 Constraint 146 660 10.2815 12.8518 19.2777 3.0000 Constraint 146 584 9.2327 11.5409 17.3114 3.0000 Constraint 146 540 10.3943 12.9929 19.4893 3.0000 Constraint 110 324 10.0534 12.5667 18.8501 3.0000 Constraint 36 234 10.1623 12.7029 19.0544 3.0000 Constraint 3 667 8.3006 10.3758 15.5637 3.0000 Constraint 470 680 8.9268 11.1585 16.7378 3.0000 Constraint 197 418 9.5070 11.8837 17.8256 3.0000 Constraint 117 526 10.2158 12.7698 19.1547 3.0000 Constraint 110 434 9.4239 11.7799 17.6699 3.0000 Constraint 189 446 10.2885 12.8606 19.2909 3.0000 Constraint 369 626 10.2797 12.8496 19.2745 3.0000 Constraint 206 418 9.2981 11.6226 17.4339 3.0000 Constraint 517 610 8.6885 10.8607 16.2910 3.0000 Constraint 319 545 10.2903 12.8629 19.2944 3.0000 Constraint 312 545 10.1745 12.7181 19.0771 3.0000 Constraint 312 526 9.9116 12.3895 18.5843 3.0000 Constraint 483 642 9.9981 12.4976 18.7464 2.9999 Constraint 402 568 10.3641 12.9552 19.4327 2.9999 Constraint 391 491 10.1662 12.7078 19.0617 2.9999 Constraint 280 610 9.9148 12.3935 18.5902 2.9999 Constraint 255 545 10.2924 12.8655 19.2983 2.9999 Constraint 97 540 10.1999 12.7499 19.1248 2.9999 Constraint 86 559 10.2094 12.7617 19.1426 2.9999 Constraint 78 568 10.3231 12.9039 19.3558 2.9999 Constraint 62 243 10.2809 12.8511 19.2767 2.9999 Constraint 36 374 9.9985 12.4982 18.7472 2.9999 Constraint 17 369 9.2028 11.5035 17.2553 2.9999 Constraint 17 255 9.8449 12.3061 18.4592 2.9999 Constraint 17 189 8.9463 11.1828 16.7742 2.9999 Constraint 206 369 9.7674 12.2093 18.3139 2.9999 Constraint 9 667 8.8389 11.0486 16.5730 2.9999 Constraint 36 673 7.2064 9.0080 13.5120 2.9999 Constraint 25 223 10.2516 12.8145 19.2218 2.9998 Constraint 86 634 9.4662 11.8328 17.7492 2.9998 Constraint 274 551 10.1953 12.7442 19.1162 2.9997 Constraint 274 526 10.0773 12.5967 18.8950 2.9997 Constraint 517 642 10.2365 12.7956 19.1934 2.9997 Constraint 502 642 10.3427 12.9284 19.3926 2.9997 Constraint 418 540 10.3321 12.9151 19.3727 2.9997 Constraint 130 517 10.0304 12.5379 18.8069 2.9997 Constraint 130 502 9.1496 11.4370 17.1555 2.9997 Constraint 418 502 10.3042 12.8802 19.3204 2.9997 Constraint 324 402 9.5818 11.9772 17.9658 2.9997 Constraint 319 434 10.2443 12.8054 19.2081 2.9997 Constraint 319 391 8.6663 10.8328 16.2492 2.9997 Constraint 287 402 10.1588 12.6985 19.0478 2.9997 Constraint 173 470 9.3516 11.6895 17.5343 2.9997 Constraint 173 427 10.3117 12.8897 19.3345 2.9997 Constraint 173 410 9.8260 12.2825 18.4237 2.9997 Constraint 130 418 10.2888 12.8610 19.2915 2.9997 Constraint 130 369 9.8976 12.3719 18.5579 2.9997 Constraint 97 295 7.6922 9.6152 14.4228 2.9997 Constraint 86 295 8.0495 10.0619 15.0928 2.9997 Constraint 78 295 8.8010 11.0012 16.5019 2.9997 Constraint 418 533 10.0442 12.5552 18.8329 2.9987 Constraint 369 680 7.7671 9.7089 14.5634 2.9987 Constraint 324 610 9.5777 11.9721 17.9581 2.9987 Constraint 324 601 7.3953 9.2441 13.8661 2.9987 Constraint 324 593 9.7292 12.1615 18.2423 2.9987 Constraint 312 383 10.1090 12.6363 18.9545 2.9987 Constraint 306 601 9.2135 11.5168 17.2752 2.9987 Constraint 306 434 9.8401 12.3001 18.4502 2.9987 Constraint 255 446 10.3946 12.9932 19.4898 2.9987 Constraint 157 446 9.7265 12.1581 18.2371 2.9987 Constraint 146 446 9.8392 12.2991 18.4486 2.9987 Constraint 130 446 8.8556 11.0696 16.6043 2.9987 Constraint 110 280 9.4160 11.7700 17.6550 2.9987 Constraint 110 274 10.3130 12.8912 19.3369 2.9987 Constraint 97 446 9.1443 11.4304 17.1456 2.9987 Constraint 54 329 9.9553 12.4441 18.6662 2.9987 Constraint 43 329 9.6927 12.1158 18.1738 2.9987 Constraint 43 312 9.9922 12.4903 18.7354 2.9987 Constraint 234 667 9.8419 12.3024 18.4536 2.9979 Constraint 463 660 9.5248 11.9059 17.8589 2.9961 Constraint 526 649 9.7470 12.1837 18.2756 2.1219 Constraint 483 649 10.0923 12.6154 18.9231 2.1219 Constraint 383 483 9.3770 11.7212 17.5819 2.1219 Constraint 340 418 10.0269 12.5336 18.8004 2.1219 Constraint 274 483 9.6374 12.0468 18.0701 2.1219 Constraint 274 391 9.9851 12.4814 18.7221 2.1219 Constraint 263 483 8.0836 10.1046 15.1568 2.1219 Constraint 255 517 10.0489 12.5611 18.8417 2.1219 Constraint 255 512 10.1334 12.6668 19.0002 2.1219 Constraint 255 483 6.4900 8.1125 12.1688 2.1219 Constraint 402 680 9.6004 12.0005 18.0007 2.1000 Constraint 350 667 8.4324 10.5404 15.8107 2.0000 Constraint 280 667 10.0123 12.5153 18.7730 2.0000 Constraint 212 551 9.9789 12.4736 18.7104 2.0000 Constraint 212 545 9.6335 12.0419 18.0629 2.0000 Constraint 212 446 9.4417 11.8021 17.7032 2.0000 Constraint 212 427 9.4722 11.8403 17.7604 2.0000 Constraint 117 350 10.3315 12.9144 19.3715 2.0000 Constraint 110 340 10.0969 12.6211 18.9317 2.0000 Constraint 25 206 9.8892 12.3615 18.5423 2.0000 Constraint 9 418 9.9221 12.4026 18.6039 2.0000 Constraint 9 410 8.3936 10.4919 15.7379 2.0000 Constraint 470 691 8.6995 10.8744 16.3116 2.0000 Constraint 410 691 8.9363 11.1704 16.7556 2.0000 Constraint 223 691 9.9695 12.4619 18.6928 2.0000 Constraint 3 350 9.8191 12.2739 18.4108 2.0000 Constraint 206 551 9.6153 12.0192 18.0288 2.0000 Constraint 206 545 9.3749 11.7187 17.5780 2.0000 Constraint 206 427 8.9514 11.1892 16.7838 2.0000 Constraint 3 391 9.4411 11.8014 17.7021 1.9999 Constraint 3 243 10.2858 12.8573 19.2859 1.9999 Constraint 3 212 10.1972 12.7465 19.1198 1.9999 Constraint 3 206 9.3364 11.6705 17.5057 1.9999 Constraint 157 340 9.4947 11.8684 17.8025 1.9999 Constraint 86 165 10.0086 12.5108 18.7662 1.9999 Constraint 86 157 9.6169 12.0211 18.0316 1.9999 Constraint 183 358 9.8921 12.3651 18.5477 1.9999 Constraint 183 350 8.1778 10.2222 15.3333 1.9999 Constraint 183 319 8.3777 10.4721 15.7081 1.9999 Constraint 183 287 9.9442 12.4303 18.6454 1.9999 Constraint 183 280 8.4054 10.5068 15.7602 1.9999 Constraint 173 559 9.8820 12.3525 18.5288 1.9999 Constraint 173 324 9.9629 12.4536 18.6804 1.9999 Constraint 173 319 7.5628 9.4535 14.1803 1.9999 Constraint 173 306 8.6850 10.8562 16.2843 1.9999 Constraint 86 642 9.1197 11.3996 17.0994 1.9999 Constraint 68 649 8.7851 10.9813 16.4720 1.9999 Constraint 157 545 10.0778 12.5973 18.8960 1.9998 Constraint 54 660 9.4871 11.8589 17.7884 1.9998 Constraint 383 691 8.3254 10.4068 15.6102 1.9991 Constraint 374 691 9.0818 11.3522 17.0283 1.9991 Constraint 369 691 9.8748 12.3434 18.5152 1.9991 Constraint 358 691 7.9443 9.9304 14.8955 1.9991 Constraint 43 691 8.1973 10.2466 15.3700 1.9991 Constraint 25 691 5.2360 6.5450 9.8175 1.9991 Constraint 17 691 6.8288 8.5360 12.8040 1.9991 Constraint 418 673 9.3724 11.7155 17.5733 1.5809 Constraint 402 673 8.3070 10.3838 15.5757 1.5809 Constraint 350 673 7.1642 8.9553 13.4329 1.5809 Constraint 340 673 7.5314 9.4143 14.1214 1.5809 Constraint 319 673 8.9148 11.1435 16.7153 1.5809 Constraint 280 673 10.3431 12.9289 19.3934 1.5809 Constraint 329 615 9.9370 12.4213 18.6319 1.0999 Constraint 312 568 8.9593 11.1991 16.7987 1.0000 Constraint 212 642 7.6818 9.6023 14.4034 1.0000 Constraint 212 634 8.7190 10.8988 16.3482 1.0000 Constraint 206 446 9.4035 11.7544 17.6316 1.0000 Constraint 146 568 10.3098 12.8873 19.3309 1.0000 Constraint 110 545 10.3693 12.9616 19.4423 1.0000 Constraint 110 540 7.8973 9.8716 14.8074 1.0000 Constraint 110 533 8.1816 10.2271 15.3406 1.0000 Constraint 86 545 10.3039 12.8799 19.3199 1.0000 Constraint 86 402 9.4437 11.8047 17.7070 1.0000 Constraint 86 383 10.0895 12.6118 18.9178 1.0000 Constraint 86 280 8.9860 11.2324 16.8487 1.0000 Constraint 86 255 9.5397 11.9246 17.8870 1.0000 Constraint 68 463 10.1144 12.6430 18.9645 1.0000 Constraint 68 410 8.7009 10.8761 16.3141 1.0000 Constraint 68 391 9.9089 12.3862 18.5793 1.0000 Constraint 68 358 9.7391 12.1738 18.2607 1.0000 Constraint 68 280 10.2230 12.7788 19.1682 1.0000 Constraint 68 255 8.8324 11.0405 16.5607 1.0000 Constraint 62 446 9.6893 12.1116 18.1674 1.0000 Constraint 3 369 10.1586 12.6983 19.0475 1.0000 Constraint 223 680 10.2711 12.8388 19.2583 1.0000 Constraint 206 626 8.9012 11.1265 16.6898 1.0000 Constraint 183 626 8.1008 10.1260 15.1890 1.0000 Constraint 183 610 10.2255 12.7819 19.1729 1.0000 Constraint 173 295 9.9335 12.4169 18.6254 1.0000 Constraint 418 491 10.2329 12.7911 19.1867 1.0000 Constraint 410 491 10.1780 12.7225 19.0837 1.0000 Constraint 533 615 10.1950 12.7437 19.1156 0.9999 Constraint 340 660 9.3915 11.7393 17.6090 0.9999 Constraint 329 634 10.1587 12.6984 19.0476 0.9999 Constraint 312 634 8.7814 10.9767 16.4651 0.9999 Constraint 306 615 10.0200 12.5250 18.7875 0.9999 Constraint 280 634 9.9722 12.4653 18.6979 0.9999 Constraint 189 280 9.8103 12.2629 18.3944 0.9999 Constraint 183 634 7.8989 9.8736 14.8104 0.9999 Constraint 183 615 9.2154 11.5193 17.2790 0.9999 Constraint 183 573 9.8410 12.3013 18.4520 0.9999 Constraint 173 545 10.3430 12.9288 19.3932 0.9999 Constraint 173 540 10.3536 12.9420 19.4130 0.9999 Constraint 173 312 10.2453 12.8067 19.2100 0.9999 Constraint 165 615 7.2732 9.0915 13.6372 0.9999 Constraint 165 340 8.0625 10.0781 15.1172 0.9999 Constraint 165 329 8.8866 11.1083 16.6624 0.9999 Constraint 165 324 7.2600 9.0750 13.6125 0.9999 Constraint 165 312 6.0709 7.5886 11.3828 0.9999 Constraint 165 295 9.6302 12.0377 18.0566 0.9999 Constraint 157 615 9.4814 11.8517 17.7776 0.9999 Constraint 157 329 7.1885 8.9857 13.4785 0.9999 Constraint 146 593 9.8251 12.2814 18.4221 0.9999 Constraint 97 634 10.2353 12.7942 19.1912 0.9999 Constraint 97 165 8.4378 10.5473 15.8209 0.9999 Constraint 78 183 9.7467 12.1834 18.2750 0.9999 Constraint 455 660 8.0713 10.0891 15.1336 0.9999 Constraint 446 649 8.4198 10.5248 15.7872 0.9999 Constraint 446 642 8.1500 10.1875 15.2812 0.9999 Constraint 434 649 8.4565 10.5706 15.8559 0.9999 Constraint 427 660 9.0245 11.2806 16.9209 0.9999 Constraint 418 660 6.0805 7.6006 11.4009 0.9999 Constraint 117 615 10.2751 12.8439 19.2659 0.9999 Constraint 110 626 10.3020 12.8775 19.3162 0.9999 Constraint 78 649 8.9965 11.2456 16.8684 0.9999 Constraint 62 667 9.6545 12.0681 18.1022 0.9999 Constraint 54 667 9.8780 12.3475 18.5212 0.9999 Constraint 17 350 8.4855 10.6068 15.9102 0.9999 Constraint 17 340 9.8707 12.3383 18.5075 0.9999 Constraint 9 673 8.5045 10.6306 15.9459 0.9999 Constraint 263 667 8.1115 10.1394 15.2091 0.9981 Constraint 173 667 8.5704 10.7130 16.0696 0.9981 Constraint 255 673 9.0481 11.3101 16.9652 0.8736 Constraint 615 680 8.5879 10.7348 16.1022 0.8073 Constraint 340 680 7.6825 9.6031 14.4046 0.8073 Constraint 626 691 9.9499 12.4373 18.6560 0.7073 Constraint 615 691 10.0164 12.5205 18.7808 0.7073 Constraint 610 691 6.3427 7.9284 11.8926 0.7073 Constraint 610 680 6.9756 8.7195 13.0793 0.7073 Constraint 610 673 4.1758 5.2197 7.8296 0.7073 Constraint 601 691 6.5187 8.1484 12.2226 0.7073 Constraint 601 680 4.6637 5.8297 8.7445 0.7073 Constraint 601 673 5.4811 6.8513 10.2770 0.7073 Constraint 593 691 3.3943 4.2428 6.3642 0.7073 Constraint 593 680 5.4826 6.8533 10.2799 0.7073 Constraint 593 673 5.3121 6.6402 9.9602 0.7073 Constraint 584 691 4.2720 5.3400 8.0099 0.7073 Constraint 584 680 5.0225 6.2782 9.4173 0.7073 Constraint 584 673 7.9807 9.9758 14.9637 0.7073 Constraint 573 691 5.1863 6.4829 9.7243 0.7073 Constraint 573 680 8.7851 10.9814 16.4720 0.7073 Constraint 573 673 7.3944 9.2430 13.8645 0.7073 Constraint 568 691 9.0680 11.3350 17.0024 0.7073 Constraint 559 691 7.9900 9.9875 14.9813 0.7073 Constraint 559 673 9.7951 12.2439 18.3659 0.7073 Constraint 551 691 7.2110 9.0137 13.5206 0.7073 Constraint 551 680 10.0691 12.5863 18.8795 0.7073 Constraint 551 673 6.5848 8.2309 12.3464 0.7073 Constraint 545 691 9.9878 12.4848 18.7272 0.7073 Constraint 545 673 9.4052 11.7565 17.6347 0.7073 Constraint 526 673 9.2100 11.5125 17.2687 0.7073 Constraint 434 673 8.2486 10.3108 15.4662 0.7073 Constraint 427 673 7.8804 9.8505 14.7758 0.7073 Constraint 340 691 9.0005 11.2506 16.8759 0.7073 Constraint 329 691 8.5389 10.6736 16.0104 0.7073 Constraint 329 680 6.3609 7.9511 11.9267 0.7073 Constraint 329 673 6.3451 7.9314 11.8971 0.7073 Constraint 324 673 9.6349 12.0436 18.0654 0.7073 Constraint 319 691 9.7935 12.2418 18.3627 0.7073 Constraint 319 680 9.6827 12.1034 18.1551 0.7073 Constraint 312 691 5.6004 7.0005 10.5007 0.7073 Constraint 312 680 5.3565 6.6956 10.0434 0.7073 Constraint 312 673 4.2474 5.3092 7.9638 0.7073 Constraint 306 691 7.3457 9.1821 13.7731 0.7073 Constraint 306 680 8.6749 10.8436 16.2654 0.7073 Constraint 306 673 7.5253 9.4066 14.1099 0.7073 Constraint 350 463 10.2614 12.8268 19.2402 0.3000 Constraint 319 502 10.2320 12.7900 19.1850 0.3000 Constraint 295 551 10.1062 12.6327 18.9491 0.3000 Constraint 295 533 10.0102 12.5128 18.7692 0.3000 Constraint 287 383 9.5717 11.9647 17.9470 0.3000 Constraint 287 374 7.5101 9.3876 14.0814 0.3000 Constraint 280 526 9.4673 11.8341 17.7512 0.3000 Constraint 280 502 8.2220 10.2775 15.4163 0.3000 Constraint 280 463 10.1281 12.6601 18.9901 0.3000 Constraint 263 491 10.3812 12.9765 19.4648 0.3000 Constraint 255 491 10.1935 12.7419 19.1129 0.3000 Constraint 418 680 10.2685 12.8356 19.2534 0.1000 Constraint 350 680 8.2130 10.2663 15.3994 0.1000 Constraint 680 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 691 0.8000 1.0000 1.5000 0.0000 Constraint 667 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 691 0.8000 1.0000 1.5000 0.0000 Constraint 660 680 0.8000 1.0000 1.5000 0.0000 Constraint 660 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 691 0.8000 1.0000 1.5000 0.0000 Constraint 649 680 0.8000 1.0000 1.5000 0.0000 Constraint 649 673 0.8000 1.0000 1.5000 0.0000 Constraint 649 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 691 0.8000 1.0000 1.5000 0.0000 Constraint 642 680 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 667 0.8000 1.0000 1.5000 0.0000 Constraint 642 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 691 0.8000 1.0000 1.5000 0.0000 Constraint 634 680 0.8000 1.0000 1.5000 0.0000 Constraint 634 673 0.8000 1.0000 1.5000 0.0000 Constraint 634 667 0.8000 1.0000 1.5000 0.0000 Constraint 634 660 0.8000 1.0000 1.5000 0.0000 Constraint 634 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 680 0.8000 1.0000 1.5000 0.0000 Constraint 626 673 0.8000 1.0000 1.5000 0.0000 Constraint 626 667 0.8000 1.0000 1.5000 0.0000 Constraint 626 660 0.8000 1.0000 1.5000 0.0000 Constraint 626 649 0.8000 1.0000 1.5000 0.0000 Constraint 626 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 673 0.8000 1.0000 1.5000 0.0000 Constraint 615 667 0.8000 1.0000 1.5000 0.0000 Constraint 615 660 0.8000 1.0000 1.5000 0.0000 Constraint 615 649 0.8000 1.0000 1.5000 0.0000 Constraint 615 642 0.8000 1.0000 1.5000 0.0000 Constraint 615 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 667 0.8000 1.0000 1.5000 0.0000 Constraint 610 660 0.8000 1.0000 1.5000 0.0000 Constraint 610 649 0.8000 1.0000 1.5000 0.0000 Constraint 610 642 0.8000 1.0000 1.5000 0.0000 Constraint 610 634 0.8000 1.0000 1.5000 0.0000 Constraint 610 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 667 0.8000 1.0000 1.5000 0.0000 Constraint 601 660 0.8000 1.0000 1.5000 0.0000 Constraint 601 649 0.8000 1.0000 1.5000 0.0000 Constraint 601 642 0.8000 1.0000 1.5000 0.0000 Constraint 601 634 0.8000 1.0000 1.5000 0.0000 Constraint 601 626 0.8000 1.0000 1.5000 0.0000 Constraint 601 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 667 0.8000 1.0000 1.5000 0.0000 Constraint 593 660 0.8000 1.0000 1.5000 0.0000 Constraint 593 649 0.8000 1.0000 1.5000 0.0000 Constraint 593 642 0.8000 1.0000 1.5000 0.0000 Constraint 593 634 0.8000 1.0000 1.5000 0.0000 Constraint 593 626 0.8000 1.0000 1.5000 0.0000 Constraint 593 615 0.8000 1.0000 1.5000 0.0000 Constraint 593 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 667 0.8000 1.0000 1.5000 0.0000 Constraint 584 660 0.8000 1.0000 1.5000 0.0000 Constraint 584 649 0.8000 1.0000 1.5000 0.0000 Constraint 584 642 0.8000 1.0000 1.5000 0.0000 Constraint 584 634 0.8000 1.0000 1.5000 0.0000 Constraint 584 626 0.8000 1.0000 1.5000 0.0000 Constraint 584 615 0.8000 1.0000 1.5000 0.0000 Constraint 584 610 0.8000 1.0000 1.5000 0.0000 Constraint 584 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 667 0.8000 1.0000 1.5000 0.0000 Constraint 573 660 0.8000 1.0000 1.5000 0.0000 Constraint 573 649 0.8000 1.0000 1.5000 0.0000 Constraint 573 642 0.8000 1.0000 1.5000 0.0000 Constraint 573 634 0.8000 1.0000 1.5000 0.0000 Constraint 573 626 0.8000 1.0000 1.5000 0.0000 Constraint 573 615 0.8000 1.0000 1.5000 0.0000 Constraint 573 610 0.8000 1.0000 1.5000 0.0000 Constraint 573 601 0.8000 1.0000 1.5000 0.0000 Constraint 573 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 680 0.8000 1.0000 1.5000 0.0000 Constraint 568 673 0.8000 1.0000 1.5000 0.0000 Constraint 568 667 0.8000 1.0000 1.5000 0.0000 Constraint 568 660 0.8000 1.0000 1.5000 0.0000 Constraint 568 649 0.8000 1.0000 1.5000 0.0000 Constraint 568 642 0.8000 1.0000 1.5000 0.0000 Constraint 568 634 0.8000 1.0000 1.5000 0.0000 Constraint 568 626 0.8000 1.0000 1.5000 0.0000 Constraint 568 615 0.8000 1.0000 1.5000 0.0000 Constraint 568 610 0.8000 1.0000 1.5000 0.0000 Constraint 568 601 0.8000 1.0000 1.5000 0.0000 Constraint 568 593 0.8000 1.0000 1.5000 0.0000 Constraint 568 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 680 0.8000 1.0000 1.5000 0.0000 Constraint 559 667 0.8000 1.0000 1.5000 0.0000 Constraint 559 660 0.8000 1.0000 1.5000 0.0000 Constraint 559 649 0.8000 1.0000 1.5000 0.0000 Constraint 559 642 0.8000 1.0000 1.5000 0.0000 Constraint 559 634 0.8000 1.0000 1.5000 0.0000 Constraint 559 626 0.8000 1.0000 1.5000 0.0000 Constraint 559 615 0.8000 1.0000 1.5000 0.0000 Constraint 559 610 0.8000 1.0000 1.5000 0.0000 Constraint 559 601 0.8000 1.0000 1.5000 0.0000 Constraint 559 593 0.8000 1.0000 1.5000 0.0000 Constraint 559 584 0.8000 1.0000 1.5000 0.0000 Constraint 559 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 667 0.8000 1.0000 1.5000 0.0000 Constraint 551 660 0.8000 1.0000 1.5000 0.0000 Constraint 551 649 0.8000 1.0000 1.5000 0.0000 Constraint 551 615 0.8000 1.0000 1.5000 0.0000 Constraint 551 610 0.8000 1.0000 1.5000 0.0000 Constraint 551 601 0.8000 1.0000 1.5000 0.0000 Constraint 551 593 0.8000 1.0000 1.5000 0.0000 Constraint 551 584 0.8000 1.0000 1.5000 0.0000 Constraint 551 573 0.8000 1.0000 1.5000 0.0000 Constraint 551 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 680 0.8000 1.0000 1.5000 0.0000 Constraint 545 667 0.8000 1.0000 1.5000 0.0000 Constraint 545 660 0.8000 1.0000 1.5000 0.0000 Constraint 545 649 0.8000 1.0000 1.5000 0.0000 Constraint 545 610 0.8000 1.0000 1.5000 0.0000 Constraint 545 601 0.8000 1.0000 1.5000 0.0000 Constraint 545 593 0.8000 1.0000 1.5000 0.0000 Constraint 545 584 0.8000 1.0000 1.5000 0.0000 Constraint 545 573 0.8000 1.0000 1.5000 0.0000 Constraint 545 568 0.8000 1.0000 1.5000 0.0000 Constraint 545 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 691 0.8000 1.0000 1.5000 0.0000 Constraint 540 680 0.8000 1.0000 1.5000 0.0000 Constraint 540 673 0.8000 1.0000 1.5000 0.0000 Constraint 540 667 0.8000 1.0000 1.5000 0.0000 Constraint 540 660 0.8000 1.0000 1.5000 0.0000 Constraint 540 649 0.8000 1.0000 1.5000 0.0000 Constraint 540 642 0.8000 1.0000 1.5000 0.0000 Constraint 540 634 0.8000 1.0000 1.5000 0.0000 Constraint 540 626 0.8000 1.0000 1.5000 0.0000 Constraint 540 615 0.8000 1.0000 1.5000 0.0000 Constraint 540 601 0.8000 1.0000 1.5000 0.0000 Constraint 540 593 0.8000 1.0000 1.5000 0.0000 Constraint 540 584 0.8000 1.0000 1.5000 0.0000 Constraint 540 573 0.8000 1.0000 1.5000 0.0000 Constraint 540 568 0.8000 1.0000 1.5000 0.0000 Constraint 540 559 0.8000 1.0000 1.5000 0.0000 Constraint 540 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 691 0.8000 1.0000 1.5000 0.0000 Constraint 533 680 0.8000 1.0000 1.5000 0.0000 Constraint 533 673 0.8000 1.0000 1.5000 0.0000 Constraint 533 667 0.8000 1.0000 1.5000 0.0000 Constraint 533 660 0.8000 1.0000 1.5000 0.0000 Constraint 533 649 0.8000 1.0000 1.5000 0.0000 Constraint 533 642 0.8000 1.0000 1.5000 0.0000 Constraint 533 634 0.8000 1.0000 1.5000 0.0000 Constraint 533 601 0.8000 1.0000 1.5000 0.0000 Constraint 533 593 0.8000 1.0000 1.5000 0.0000 Constraint 533 584 0.8000 1.0000 1.5000 0.0000 Constraint 533 573 0.8000 1.0000 1.5000 0.0000 Constraint 533 568 0.8000 1.0000 1.5000 0.0000 Constraint 533 559 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 691 0.8000 1.0000 1.5000 0.0000 Constraint 526 680 0.8000 1.0000 1.5000 0.0000 Constraint 526 667 0.8000 1.0000 1.5000 0.0000 Constraint 526 660 0.8000 1.0000 1.5000 0.0000 Constraint 526 601 0.8000 1.0000 1.5000 0.0000 Constraint 526 593 0.8000 1.0000 1.5000 0.0000 Constraint 526 584 0.8000 1.0000 1.5000 0.0000 Constraint 526 573 0.8000 1.0000 1.5000 0.0000 Constraint 526 568 0.8000 1.0000 1.5000 0.0000 Constraint 526 559 0.8000 1.0000 1.5000 0.0000 Constraint 526 551 0.8000 1.0000 1.5000 0.0000 Constraint 526 545 0.8000 1.0000 1.5000 0.0000 Constraint 526 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 691 0.8000 1.0000 1.5000 0.0000 Constraint 517 680 0.8000 1.0000 1.5000 0.0000 Constraint 517 673 0.8000 1.0000 1.5000 0.0000 Constraint 517 667 0.8000 1.0000 1.5000 0.0000 Constraint 517 660 0.8000 1.0000 1.5000 0.0000 Constraint 517 649 0.8000 1.0000 1.5000 0.0000 Constraint 517 615 0.8000 1.0000 1.5000 0.0000 Constraint 517 601 0.8000 1.0000 1.5000 0.0000 Constraint 517 593 0.8000 1.0000 1.5000 0.0000 Constraint 517 584 0.8000 1.0000 1.5000 0.0000 Constraint 517 573 0.8000 1.0000 1.5000 0.0000 Constraint 517 568 0.8000 1.0000 1.5000 0.0000 Constraint 517 559 0.8000 1.0000 1.5000 0.0000 Constraint 517 551 0.8000 1.0000 1.5000 0.0000 Constraint 517 545 0.8000 1.0000 1.5000 0.0000 Constraint 517 540 0.8000 1.0000 1.5000 0.0000 Constraint 517 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 691 0.8000 1.0000 1.5000 0.0000 Constraint 512 680 0.8000 1.0000 1.5000 0.0000 Constraint 512 673 0.8000 1.0000 1.5000 0.0000 Constraint 512 667 0.8000 1.0000 1.5000 0.0000 Constraint 512 660 0.8000 1.0000 1.5000 0.0000 Constraint 512 649 0.8000 1.0000 1.5000 0.0000 Constraint 512 642 0.8000 1.0000 1.5000 0.0000 Constraint 512 634 0.8000 1.0000 1.5000 0.0000 Constraint 512 626 0.8000 1.0000 1.5000 0.0000 Constraint 512 615 0.8000 1.0000 1.5000 0.0000 Constraint 512 610 0.8000 1.0000 1.5000 0.0000 Constraint 512 601 0.8000 1.0000 1.5000 0.0000 Constraint 512 593 0.8000 1.0000 1.5000 0.0000 Constraint 512 584 0.8000 1.0000 1.5000 0.0000 Constraint 512 573 0.8000 1.0000 1.5000 0.0000 Constraint 512 568 0.8000 1.0000 1.5000 0.0000 Constraint 512 559 0.8000 1.0000 1.5000 0.0000 Constraint 512 551 0.8000 1.0000 1.5000 0.0000 Constraint 512 545 0.8000 1.0000 1.5000 0.0000 Constraint 512 540 0.8000 1.0000 1.5000 0.0000 Constraint 512 533 0.8000 1.0000 1.5000 0.0000 Constraint 512 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 691 0.8000 1.0000 1.5000 0.0000 Constraint 502 680 0.8000 1.0000 1.5000 0.0000 Constraint 502 673 0.8000 1.0000 1.5000 0.0000 Constraint 502 667 0.8000 1.0000 1.5000 0.0000 Constraint 502 660 0.8000 1.0000 1.5000 0.0000 Constraint 502 649 0.8000 1.0000 1.5000 0.0000 Constraint 502 634 0.8000 1.0000 1.5000 0.0000 Constraint 502 615 0.8000 1.0000 1.5000 0.0000 Constraint 502 610 0.8000 1.0000 1.5000 0.0000 Constraint 502 601 0.8000 1.0000 1.5000 0.0000 Constraint 502 593 0.8000 1.0000 1.5000 0.0000 Constraint 502 584 0.8000 1.0000 1.5000 0.0000 Constraint 502 573 0.8000 1.0000 1.5000 0.0000 Constraint 502 568 0.8000 1.0000 1.5000 0.0000 Constraint 502 559 0.8000 1.0000 1.5000 0.0000 Constraint 502 551 0.8000 1.0000 1.5000 0.0000 Constraint 502 545 0.8000 1.0000 1.5000 0.0000 Constraint 502 540 0.8000 1.0000 1.5000 0.0000 Constraint 502 533 0.8000 1.0000 1.5000 0.0000 Constraint 502 526 0.8000 1.0000 1.5000 0.0000 Constraint 502 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 691 0.8000 1.0000 1.5000 0.0000 Constraint 491 680 0.8000 1.0000 1.5000 0.0000 Constraint 491 673 0.8000 1.0000 1.5000 0.0000 Constraint 491 667 0.8000 1.0000 1.5000 0.0000 Constraint 491 660 0.8000 1.0000 1.5000 0.0000 Constraint 491 649 0.8000 1.0000 1.5000 0.0000 Constraint 491 642 0.8000 1.0000 1.5000 0.0000 Constraint 491 634 0.8000 1.0000 1.5000 0.0000 Constraint 491 626 0.8000 1.0000 1.5000 0.0000 Constraint 491 615 0.8000 1.0000 1.5000 0.0000 Constraint 491 610 0.8000 1.0000 1.5000 0.0000 Constraint 491 601 0.8000 1.0000 1.5000 0.0000 Constraint 491 593 0.8000 1.0000 1.5000 0.0000 Constraint 491 584 0.8000 1.0000 1.5000 0.0000 Constraint 491 573 0.8000 1.0000 1.5000 0.0000 Constraint 491 568 0.8000 1.0000 1.5000 0.0000 Constraint 491 559 0.8000 1.0000 1.5000 0.0000 Constraint 491 551 0.8000 1.0000 1.5000 0.0000 Constraint 491 545 0.8000 1.0000 1.5000 0.0000 Constraint 491 540 0.8000 1.0000 1.5000 0.0000 Constraint 491 533 0.8000 1.0000 1.5000 0.0000 Constraint 491 526 0.8000 1.0000 1.5000 0.0000 Constraint 491 517 0.8000 1.0000 1.5000 0.0000 Constraint 491 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 691 0.8000 1.0000 1.5000 0.0000 Constraint 483 680 0.8000 1.0000 1.5000 0.0000 Constraint 483 673 0.8000 1.0000 1.5000 0.0000 Constraint 483 667 0.8000 1.0000 1.5000 0.0000 Constraint 483 660 0.8000 1.0000 1.5000 0.0000 Constraint 483 615 0.8000 1.0000 1.5000 0.0000 Constraint 483 610 0.8000 1.0000 1.5000 0.0000 Constraint 483 601 0.8000 1.0000 1.5000 0.0000 Constraint 483 593 0.8000 1.0000 1.5000 0.0000 Constraint 483 584 0.8000 1.0000 1.5000 0.0000 Constraint 483 545 0.8000 1.0000 1.5000 0.0000 Constraint 483 540 0.8000 1.0000 1.5000 0.0000 Constraint 483 533 0.8000 1.0000 1.5000 0.0000 Constraint 483 526 0.8000 1.0000 1.5000 0.0000 Constraint 483 517 0.8000 1.0000 1.5000 0.0000 Constraint 483 512 0.8000 1.0000 1.5000 0.0000 Constraint 483 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 673 0.8000 1.0000 1.5000 0.0000 Constraint 470 667 0.8000 1.0000 1.5000 0.0000 Constraint 470 615 0.8000 1.0000 1.5000 0.0000 Constraint 470 610 0.8000 1.0000 1.5000 0.0000 Constraint 470 601 0.8000 1.0000 1.5000 0.0000 Constraint 470 593 0.8000 1.0000 1.5000 0.0000 Constraint 470 584 0.8000 1.0000 1.5000 0.0000 Constraint 470 573 0.8000 1.0000 1.5000 0.0000 Constraint 470 568 0.8000 1.0000 1.5000 0.0000 Constraint 470 559 0.8000 1.0000 1.5000 0.0000 Constraint 470 551 0.8000 1.0000 1.5000 0.0000 Constraint 470 533 0.8000 1.0000 1.5000 0.0000 Constraint 470 526 0.8000 1.0000 1.5000 0.0000 Constraint 470 517 0.8000 1.0000 1.5000 0.0000 Constraint 470 512 0.8000 1.0000 1.5000 0.0000 Constraint 470 502 0.8000 1.0000 1.5000 0.0000 Constraint 470 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 691 0.8000 1.0000 1.5000 0.0000 Constraint 463 680 0.8000 1.0000 1.5000 0.0000 Constraint 463 673 0.8000 1.0000 1.5000 0.0000 Constraint 463 667 0.8000 1.0000 1.5000 0.0000 Constraint 463 601 0.8000 1.0000 1.5000 0.0000 Constraint 463 593 0.8000 1.0000 1.5000 0.0000 Constraint 463 584 0.8000 1.0000 1.5000 0.0000 Constraint 463 526 0.8000 1.0000 1.5000 0.0000 Constraint 463 517 0.8000 1.0000 1.5000 0.0000 Constraint 463 512 0.8000 1.0000 1.5000 0.0000 Constraint 463 502 0.8000 1.0000 1.5000 0.0000 Constraint 463 491 0.8000 1.0000 1.5000 0.0000 Constraint 463 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 691 0.8000 1.0000 1.5000 0.0000 Constraint 455 680 0.8000 1.0000 1.5000 0.0000 Constraint 455 673 0.8000 1.0000 1.5000 0.0000 Constraint 455 667 0.8000 1.0000 1.5000 0.0000 Constraint 455 610 0.8000 1.0000 1.5000 0.0000 Constraint 455 601 0.8000 1.0000 1.5000 0.0000 Constraint 455 593 0.8000 1.0000 1.5000 0.0000 Constraint 455 584 0.8000 1.0000 1.5000 0.0000 Constraint 455 568 0.8000 1.0000 1.5000 0.0000 Constraint 455 559 0.8000 1.0000 1.5000 0.0000 Constraint 455 517 0.8000 1.0000 1.5000 0.0000 Constraint 455 512 0.8000 1.0000 1.5000 0.0000 Constraint 455 502 0.8000 1.0000 1.5000 0.0000 Constraint 455 491 0.8000 1.0000 1.5000 0.0000 Constraint 455 483 0.8000 1.0000 1.5000 0.0000 Constraint 455 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 691 0.8000 1.0000 1.5000 0.0000 Constraint 446 680 0.8000 1.0000 1.5000 0.0000 Constraint 446 673 0.8000 1.0000 1.5000 0.0000 Constraint 446 667 0.8000 1.0000 1.5000 0.0000 Constraint 446 660 0.8000 1.0000 1.5000 0.0000 Constraint 446 512 0.8000 1.0000 1.5000 0.0000 Constraint 446 502 0.8000 1.0000 1.5000 0.0000 Constraint 446 491 0.8000 1.0000 1.5000 0.0000 Constraint 446 483 0.8000 1.0000 1.5000 0.0000 Constraint 446 470 0.8000 1.0000 1.5000 0.0000 Constraint 446 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 691 0.8000 1.0000 1.5000 0.0000 Constraint 434 680 0.8000 1.0000 1.5000 0.0000 Constraint 434 667 0.8000 1.0000 1.5000 0.0000 Constraint 434 660 0.8000 1.0000 1.5000 0.0000 Constraint 434 512 0.8000 1.0000 1.5000 0.0000 Constraint 434 502 0.8000 1.0000 1.5000 0.0000 Constraint 434 491 0.8000 1.0000 1.5000 0.0000 Constraint 434 483 0.8000 1.0000 1.5000 0.0000 Constraint 434 470 0.8000 1.0000 1.5000 0.0000 Constraint 434 463 0.8000 1.0000 1.5000 0.0000 Constraint 434 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 691 0.8000 1.0000 1.5000 0.0000 Constraint 427 680 0.8000 1.0000 1.5000 0.0000 Constraint 427 667 0.8000 1.0000 1.5000 0.0000 Constraint 427 483 0.8000 1.0000 1.5000 0.0000 Constraint 427 470 0.8000 1.0000 1.5000 0.0000 Constraint 427 463 0.8000 1.0000 1.5000 0.0000 Constraint 427 455 0.8000 1.0000 1.5000 0.0000 Constraint 427 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 691 0.8000 1.0000 1.5000 0.0000 Constraint 418 593 0.8000 1.0000 1.5000 0.0000 Constraint 418 584 0.8000 1.0000 1.5000 0.0000 Constraint 418 559 0.8000 1.0000 1.5000 0.0000 Constraint 418 512 0.8000 1.0000 1.5000 0.0000 Constraint 418 470 0.8000 1.0000 1.5000 0.0000 Constraint 418 463 0.8000 1.0000 1.5000 0.0000 Constraint 418 455 0.8000 1.0000 1.5000 0.0000 Constraint 418 446 0.8000 1.0000 1.5000 0.0000 Constraint 418 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 601 0.8000 1.0000 1.5000 0.0000 Constraint 410 593 0.8000 1.0000 1.5000 0.0000 Constraint 410 584 0.8000 1.0000 1.5000 0.0000 Constraint 410 573 0.8000 1.0000 1.5000 0.0000 Constraint 410 568 0.8000 1.0000 1.5000 0.0000 Constraint 410 559 0.8000 1.0000 1.5000 0.0000 Constraint 410 540 0.8000 1.0000 1.5000 0.0000 Constraint 410 533 0.8000 1.0000 1.5000 0.0000 Constraint 410 512 0.8000 1.0000 1.5000 0.0000 Constraint 410 470 0.8000 1.0000 1.5000 0.0000 Constraint 410 463 0.8000 1.0000 1.5000 0.0000 Constraint 410 455 0.8000 1.0000 1.5000 0.0000 Constraint 410 446 0.8000 1.0000 1.5000 0.0000 Constraint 410 434 0.8000 1.0000 1.5000 0.0000 Constraint 410 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 691 0.8000 1.0000 1.5000 0.0000 Constraint 402 601 0.8000 1.0000 1.5000 0.0000 Constraint 402 593 0.8000 1.0000 1.5000 0.0000 Constraint 402 584 0.8000 1.0000 1.5000 0.0000 Constraint 402 463 0.8000 1.0000 1.5000 0.0000 Constraint 402 455 0.8000 1.0000 1.5000 0.0000 Constraint 402 446 0.8000 1.0000 1.5000 0.0000 Constraint 402 434 0.8000 1.0000 1.5000 0.0000 Constraint 402 427 0.8000 1.0000 1.5000 0.0000 Constraint 402 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 615 0.8000 1.0000 1.5000 0.0000 Constraint 391 610 0.8000 1.0000 1.5000 0.0000 Constraint 391 601 0.8000 1.0000 1.5000 0.0000 Constraint 391 593 0.8000 1.0000 1.5000 0.0000 Constraint 391 584 0.8000 1.0000 1.5000 0.0000 Constraint 391 573 0.8000 1.0000 1.5000 0.0000 Constraint 391 568 0.8000 1.0000 1.5000 0.0000 Constraint 391 559 0.8000 1.0000 1.5000 0.0000 Constraint 391 545 0.8000 1.0000 1.5000 0.0000 Constraint 391 540 0.8000 1.0000 1.5000 0.0000 Constraint 391 533 0.8000 1.0000 1.5000 0.0000 Constraint 391 512 0.8000 1.0000 1.5000 0.0000 Constraint 391 455 0.8000 1.0000 1.5000 0.0000 Constraint 391 446 0.8000 1.0000 1.5000 0.0000 Constraint 391 434 0.8000 1.0000 1.5000 0.0000 Constraint 391 427 0.8000 1.0000 1.5000 0.0000 Constraint 391 418 0.8000 1.0000 1.5000 0.0000 Constraint 391 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 615 0.8000 1.0000 1.5000 0.0000 Constraint 383 601 0.8000 1.0000 1.5000 0.0000 Constraint 383 593 0.8000 1.0000 1.5000 0.0000 Constraint 383 584 0.8000 1.0000 1.5000 0.0000 Constraint 383 573 0.8000 1.0000 1.5000 0.0000 Constraint 383 568 0.8000 1.0000 1.5000 0.0000 Constraint 383 559 0.8000 1.0000 1.5000 0.0000 Constraint 383 545 0.8000 1.0000 1.5000 0.0000 Constraint 383 540 0.8000 1.0000 1.5000 0.0000 Constraint 383 533 0.8000 1.0000 1.5000 0.0000 Constraint 383 517 0.8000 1.0000 1.5000 0.0000 Constraint 383 512 0.8000 1.0000 1.5000 0.0000 Constraint 383 491 0.8000 1.0000 1.5000 0.0000 Constraint 383 455 0.8000 1.0000 1.5000 0.0000 Constraint 383 446 0.8000 1.0000 1.5000 0.0000 Constraint 383 434 0.8000 1.0000 1.5000 0.0000 Constraint 383 427 0.8000 1.0000 1.5000 0.0000 Constraint 383 418 0.8000 1.0000 1.5000 0.0000 Constraint 383 410 0.8000 1.0000 1.5000 0.0000 Constraint 383 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 634 0.8000 1.0000 1.5000 0.0000 Constraint 374 626 0.8000 1.0000 1.5000 0.0000 Constraint 374 615 0.8000 1.0000 1.5000 0.0000 Constraint 374 610 0.8000 1.0000 1.5000 0.0000 Constraint 374 601 0.8000 1.0000 1.5000 0.0000 Constraint 374 593 0.8000 1.0000 1.5000 0.0000 Constraint 374 584 0.8000 1.0000 1.5000 0.0000 Constraint 374 573 0.8000 1.0000 1.5000 0.0000 Constraint 374 568 0.8000 1.0000 1.5000 0.0000 Constraint 374 559 0.8000 1.0000 1.5000 0.0000 Constraint 374 551 0.8000 1.0000 1.5000 0.0000 Constraint 374 545 0.8000 1.0000 1.5000 0.0000 Constraint 374 540 0.8000 1.0000 1.5000 0.0000 Constraint 374 533 0.8000 1.0000 1.5000 0.0000 Constraint 374 526 0.8000 1.0000 1.5000 0.0000 Constraint 374 517 0.8000 1.0000 1.5000 0.0000 Constraint 374 512 0.8000 1.0000 1.5000 0.0000 Constraint 374 502 0.8000 1.0000 1.5000 0.0000 Constraint 374 491 0.8000 1.0000 1.5000 0.0000 Constraint 374 483 0.8000 1.0000 1.5000 0.0000 Constraint 374 470 0.8000 1.0000 1.5000 0.0000 Constraint 374 463 0.8000 1.0000 1.5000 0.0000 Constraint 374 455 0.8000 1.0000 1.5000 0.0000 Constraint 374 446 0.8000 1.0000 1.5000 0.0000 Constraint 374 434 0.8000 1.0000 1.5000 0.0000 Constraint 374 427 0.8000 1.0000 1.5000 0.0000 Constraint 374 418 0.8000 1.0000 1.5000 0.0000 Constraint 374 410 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 634 0.8000 1.0000 1.5000 0.0000 Constraint 369 615 0.8000 1.0000 1.5000 0.0000 Constraint 369 610 0.8000 1.0000 1.5000 0.0000 Constraint 369 601 0.8000 1.0000 1.5000 0.0000 Constraint 369 593 0.8000 1.0000 1.5000 0.0000 Constraint 369 584 0.8000 1.0000 1.5000 0.0000 Constraint 369 573 0.8000 1.0000 1.5000 0.0000 Constraint 369 568 0.8000 1.0000 1.5000 0.0000 Constraint 369 559 0.8000 1.0000 1.5000 0.0000 Constraint 369 551 0.8000 1.0000 1.5000 0.0000 Constraint 369 545 0.8000 1.0000 1.5000 0.0000 Constraint 369 540 0.8000 1.0000 1.5000 0.0000 Constraint 369 533 0.8000 1.0000 1.5000 0.0000 Constraint 369 526 0.8000 1.0000 1.5000 0.0000 Constraint 369 517 0.8000 1.0000 1.5000 0.0000 Constraint 369 512 0.8000 1.0000 1.5000 0.0000 Constraint 369 502 0.8000 1.0000 1.5000 0.0000 Constraint 369 491 0.8000 1.0000 1.5000 0.0000 Constraint 369 483 0.8000 1.0000 1.5000 0.0000 Constraint 369 470 0.8000 1.0000 1.5000 0.0000 Constraint 369 463 0.8000 1.0000 1.5000 0.0000 Constraint 369 455 0.8000 1.0000 1.5000 0.0000 Constraint 369 446 0.8000 1.0000 1.5000 0.0000 Constraint 369 434 0.8000 1.0000 1.5000 0.0000 Constraint 369 427 0.8000 1.0000 1.5000 0.0000 Constraint 369 418 0.8000 1.0000 1.5000 0.0000 Constraint 369 410 0.8000 1.0000 1.5000 0.0000 Constraint 369 402 0.8000 1.0000 1.5000 0.0000 Constraint 369 391 0.8000 1.0000 1.5000 0.0000 Constraint 369 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 615 0.8000 1.0000 1.5000 0.0000 Constraint 358 610 0.8000 1.0000 1.5000 0.0000 Constraint 358 601 0.8000 1.0000 1.5000 0.0000 Constraint 358 593 0.8000 1.0000 1.5000 0.0000 Constraint 358 584 0.8000 1.0000 1.5000 0.0000 Constraint 358 573 0.8000 1.0000 1.5000 0.0000 Constraint 358 568 0.8000 1.0000 1.5000 0.0000 Constraint 358 559 0.8000 1.0000 1.5000 0.0000 Constraint 358 551 0.8000 1.0000 1.5000 0.0000 Constraint 358 545 0.8000 1.0000 1.5000 0.0000 Constraint 358 540 0.8000 1.0000 1.5000 0.0000 Constraint 358 533 0.8000 1.0000 1.5000 0.0000 Constraint 358 526 0.8000 1.0000 1.5000 0.0000 Constraint 358 517 0.8000 1.0000 1.5000 0.0000 Constraint 358 512 0.8000 1.0000 1.5000 0.0000 Constraint 358 502 0.8000 1.0000 1.5000 0.0000 Constraint 358 491 0.8000 1.0000 1.5000 0.0000 Constraint 358 483 0.8000 1.0000 1.5000 0.0000 Constraint 358 470 0.8000 1.0000 1.5000 0.0000 Constraint 358 463 0.8000 1.0000 1.5000 0.0000 Constraint 358 455 0.8000 1.0000 1.5000 0.0000 Constraint 358 446 0.8000 1.0000 1.5000 0.0000 Constraint 358 434 0.8000 1.0000 1.5000 0.0000 Constraint 358 427 0.8000 1.0000 1.5000 0.0000 Constraint 358 418 0.8000 1.0000 1.5000 0.0000 Constraint 358 410 0.8000 1.0000 1.5000 0.0000 Constraint 358 402 0.8000 1.0000 1.5000 0.0000 Constraint 358 391 0.8000 1.0000 1.5000 0.0000 Constraint 358 383 0.8000 1.0000 1.5000 0.0000 Constraint 358 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 691 0.8000 1.0000 1.5000 0.0000 Constraint 350 593 0.8000 1.0000 1.5000 0.0000 Constraint 350 584 0.8000 1.0000 1.5000 0.0000 Constraint 350 573 0.8000 1.0000 1.5000 0.0000 Constraint 350 568 0.8000 1.0000 1.5000 0.0000 Constraint 350 559 0.8000 1.0000 1.5000 0.0000 Constraint 350 545 0.8000 1.0000 1.5000 0.0000 Constraint 350 540 0.8000 1.0000 1.5000 0.0000 Constraint 350 533 0.8000 1.0000 1.5000 0.0000 Constraint 350 517 0.8000 1.0000 1.5000 0.0000 Constraint 350 512 0.8000 1.0000 1.5000 0.0000 Constraint 350 502 0.8000 1.0000 1.5000 0.0000 Constraint 350 491 0.8000 1.0000 1.5000 0.0000 Constraint 350 483 0.8000 1.0000 1.5000 0.0000 Constraint 350 470 0.8000 1.0000 1.5000 0.0000 Constraint 350 455 0.8000 1.0000 1.5000 0.0000 Constraint 350 446 0.8000 1.0000 1.5000 0.0000 Constraint 350 434 0.8000 1.0000 1.5000 0.0000 Constraint 350 418 0.8000 1.0000 1.5000 0.0000 Constraint 350 410 0.8000 1.0000 1.5000 0.0000 Constraint 350 402 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 383 0.8000 1.0000 1.5000 0.0000 Constraint 350 374 0.8000 1.0000 1.5000 0.0000 Constraint 350 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 667 0.8000 1.0000 1.5000 0.0000 Constraint 340 649 0.8000 1.0000 1.5000 0.0000 Constraint 340 584 0.8000 1.0000 1.5000 0.0000 Constraint 340 568 0.8000 1.0000 1.5000 0.0000 Constraint 340 559 0.8000 1.0000 1.5000 0.0000 Constraint 340 545 0.8000 1.0000 1.5000 0.0000 Constraint 340 540 0.8000 1.0000 1.5000 0.0000 Constraint 340 533 0.8000 1.0000 1.5000 0.0000 Constraint 340 517 0.8000 1.0000 1.5000 0.0000 Constraint 340 512 0.8000 1.0000 1.5000 0.0000 Constraint 340 502 0.8000 1.0000 1.5000 0.0000 Constraint 340 491 0.8000 1.0000 1.5000 0.0000 Constraint 340 483 0.8000 1.0000 1.5000 0.0000 Constraint 340 470 0.8000 1.0000 1.5000 0.0000 Constraint 340 463 0.8000 1.0000 1.5000 0.0000 Constraint 340 455 0.8000 1.0000 1.5000 0.0000 Constraint 340 446 0.8000 1.0000 1.5000 0.0000 Constraint 340 434 0.8000 1.0000 1.5000 0.0000 Constraint 340 410 0.8000 1.0000 1.5000 0.0000 Constraint 340 402 0.8000 1.0000 1.5000 0.0000 Constraint 340 391 0.8000 1.0000 1.5000 0.0000 Constraint 340 383 0.8000 1.0000 1.5000 0.0000 Constraint 340 374 0.8000 1.0000 1.5000 0.0000 Constraint 340 369 0.8000 1.0000 1.5000 0.0000 Constraint 340 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 667 0.8000 1.0000 1.5000 0.0000 Constraint 329 660 0.8000 1.0000 1.5000 0.0000 Constraint 329 649 0.8000 1.0000 1.5000 0.0000 Constraint 329 642 0.8000 1.0000 1.5000 0.0000 Constraint 329 584 0.8000 1.0000 1.5000 0.0000 Constraint 329 573 0.8000 1.0000 1.5000 0.0000 Constraint 329 568 0.8000 1.0000 1.5000 0.0000 Constraint 329 559 0.8000 1.0000 1.5000 0.0000 Constraint 329 551 0.8000 1.0000 1.5000 0.0000 Constraint 329 545 0.8000 1.0000 1.5000 0.0000 Constraint 329 540 0.8000 1.0000 1.5000 0.0000 Constraint 329 533 0.8000 1.0000 1.5000 0.0000 Constraint 329 526 0.8000 1.0000 1.5000 0.0000 Constraint 329 517 0.8000 1.0000 1.5000 0.0000 Constraint 329 512 0.8000 1.0000 1.5000 0.0000 Constraint 329 502 0.8000 1.0000 1.5000 0.0000 Constraint 329 491 0.8000 1.0000 1.5000 0.0000 Constraint 329 483 0.8000 1.0000 1.5000 0.0000 Constraint 329 470 0.8000 1.0000 1.5000 0.0000 Constraint 329 463 0.8000 1.0000 1.5000 0.0000 Constraint 329 455 0.8000 1.0000 1.5000 0.0000 Constraint 329 446 0.8000 1.0000 1.5000 0.0000 Constraint 329 434 0.8000 1.0000 1.5000 0.0000 Constraint 329 427 0.8000 1.0000 1.5000 0.0000 Constraint 329 418 0.8000 1.0000 1.5000 0.0000 Constraint 329 410 0.8000 1.0000 1.5000 0.0000 Constraint 329 402 0.8000 1.0000 1.5000 0.0000 Constraint 329 391 0.8000 1.0000 1.5000 0.0000 Constraint 329 383 0.8000 1.0000 1.5000 0.0000 Constraint 329 374 0.8000 1.0000 1.5000 0.0000 Constraint 329 369 0.8000 1.0000 1.5000 0.0000 Constraint 329 358 0.8000 1.0000 1.5000 0.0000 Constraint 329 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 691 0.8000 1.0000 1.5000 0.0000 Constraint 324 680 0.8000 1.0000 1.5000 0.0000 Constraint 324 667 0.8000 1.0000 1.5000 0.0000 Constraint 324 660 0.8000 1.0000 1.5000 0.0000 Constraint 324 649 0.8000 1.0000 1.5000 0.0000 Constraint 324 634 0.8000 1.0000 1.5000 0.0000 Constraint 324 615 0.8000 1.0000 1.5000 0.0000 Constraint 324 584 0.8000 1.0000 1.5000 0.0000 Constraint 324 573 0.8000 1.0000 1.5000 0.0000 Constraint 324 568 0.8000 1.0000 1.5000 0.0000 Constraint 324 559 0.8000 1.0000 1.5000 0.0000 Constraint 324 551 0.8000 1.0000 1.5000 0.0000 Constraint 324 545 0.8000 1.0000 1.5000 0.0000 Constraint 324 540 0.8000 1.0000 1.5000 0.0000 Constraint 324 533 0.8000 1.0000 1.5000 0.0000 Constraint 324 526 0.8000 1.0000 1.5000 0.0000 Constraint 324 517 0.8000 1.0000 1.5000 0.0000 Constraint 324 512 0.8000 1.0000 1.5000 0.0000 Constraint 324 502 0.8000 1.0000 1.5000 0.0000 Constraint 324 491 0.8000 1.0000 1.5000 0.0000 Constraint 324 483 0.8000 1.0000 1.5000 0.0000 Constraint 324 470 0.8000 1.0000 1.5000 0.0000 Constraint 324 463 0.8000 1.0000 1.5000 0.0000 Constraint 324 455 0.8000 1.0000 1.5000 0.0000 Constraint 324 446 0.8000 1.0000 1.5000 0.0000 Constraint 324 434 0.8000 1.0000 1.5000 0.0000 Constraint 324 427 0.8000 1.0000 1.5000 0.0000 Constraint 324 418 0.8000 1.0000 1.5000 0.0000 Constraint 324 410 0.8000 1.0000 1.5000 0.0000 Constraint 324 391 0.8000 1.0000 1.5000 0.0000 Constraint 324 383 0.8000 1.0000 1.5000 0.0000 Constraint 324 374 0.8000 1.0000 1.5000 0.0000 Constraint 324 369 0.8000 1.0000 1.5000 0.0000 Constraint 324 358 0.8000 1.0000 1.5000 0.0000 Constraint 324 350 0.8000 1.0000 1.5000 0.0000 Constraint 324 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 667 0.8000 1.0000 1.5000 0.0000 Constraint 319 660 0.8000 1.0000 1.5000 0.0000 Constraint 319 649 0.8000 1.0000 1.5000 0.0000 Constraint 319 593 0.8000 1.0000 1.5000 0.0000 Constraint 319 568 0.8000 1.0000 1.5000 0.0000 Constraint 319 540 0.8000 1.0000 1.5000 0.0000 Constraint 319 517 0.8000 1.0000 1.5000 0.0000 Constraint 319 512 0.8000 1.0000 1.5000 0.0000 Constraint 319 491 0.8000 1.0000 1.5000 0.0000 Constraint 319 483 0.8000 1.0000 1.5000 0.0000 Constraint 319 470 0.8000 1.0000 1.5000 0.0000 Constraint 319 463 0.8000 1.0000 1.5000 0.0000 Constraint 319 455 0.8000 1.0000 1.5000 0.0000 Constraint 319 446 0.8000 1.0000 1.5000 0.0000 Constraint 319 418 0.8000 1.0000 1.5000 0.0000 Constraint 319 410 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 369 0.8000 1.0000 1.5000 0.0000 Constraint 319 358 0.8000 1.0000 1.5000 0.0000 Constraint 319 350 0.8000 1.0000 1.5000 0.0000 Constraint 319 340 0.8000 1.0000 1.5000 0.0000 Constraint 319 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 667 0.8000 1.0000 1.5000 0.0000 Constraint 312 660 0.8000 1.0000 1.5000 0.0000 Constraint 312 649 0.8000 1.0000 1.5000 0.0000 Constraint 312 540 0.8000 1.0000 1.5000 0.0000 Constraint 312 533 0.8000 1.0000 1.5000 0.0000 Constraint 312 517 0.8000 1.0000 1.5000 0.0000 Constraint 312 512 0.8000 1.0000 1.5000 0.0000 Constraint 312 502 0.8000 1.0000 1.5000 0.0000 Constraint 312 491 0.8000 1.0000 1.5000 0.0000 Constraint 312 483 0.8000 1.0000 1.5000 0.0000 Constraint 312 470 0.8000 1.0000 1.5000 0.0000 Constraint 312 463 0.8000 1.0000 1.5000 0.0000 Constraint 312 455 0.8000 1.0000 1.5000 0.0000 Constraint 312 446 0.8000 1.0000 1.5000 0.0000 Constraint 312 418 0.8000 1.0000 1.5000 0.0000 Constraint 312 410 0.8000 1.0000 1.5000 0.0000 Constraint 312 391 0.8000 1.0000 1.5000 0.0000 Constraint 312 374 0.8000 1.0000 1.5000 0.0000 Constraint 312 369 0.8000 1.0000 1.5000 0.0000 Constraint 312 358 0.8000 1.0000 1.5000 0.0000 Constraint 312 350 0.8000 1.0000 1.5000 0.0000 Constraint 312 340 0.8000 1.0000 1.5000 0.0000 Constraint 312 329 0.8000 1.0000 1.5000 0.0000 Constraint 312 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 667 0.8000 1.0000 1.5000 0.0000 Constraint 306 660 0.8000 1.0000 1.5000 0.0000 Constraint 306 649 0.8000 1.0000 1.5000 0.0000 Constraint 306 642 0.8000 1.0000 1.5000 0.0000 Constraint 306 634 0.8000 1.0000 1.5000 0.0000 Constraint 306 568 0.8000 1.0000 1.5000 0.0000 Constraint 306 545 0.8000 1.0000 1.5000 0.0000 Constraint 306 540 0.8000 1.0000 1.5000 0.0000 Constraint 306 533 0.8000 1.0000 1.5000 0.0000 Constraint 306 526 0.8000 1.0000 1.5000 0.0000 Constraint 306 517 0.8000 1.0000 1.5000 0.0000 Constraint 306 512 0.8000 1.0000 1.5000 0.0000 Constraint 306 502 0.8000 1.0000 1.5000 0.0000 Constraint 306 491 0.8000 1.0000 1.5000 0.0000 Constraint 306 483 0.8000 1.0000 1.5000 0.0000 Constraint 306 470 0.8000 1.0000 1.5000 0.0000 Constraint 306 463 0.8000 1.0000 1.5000 0.0000 Constraint 306 455 0.8000 1.0000 1.5000 0.0000 Constraint 306 446 0.8000 1.0000 1.5000 0.0000 Constraint 306 427 0.8000 1.0000 1.5000 0.0000 Constraint 306 418 0.8000 1.0000 1.5000 0.0000 Constraint 306 410 0.8000 1.0000 1.5000 0.0000 Constraint 306 402 0.8000 1.0000 1.5000 0.0000 Constraint 306 391 0.8000 1.0000 1.5000 0.0000 Constraint 306 383 0.8000 1.0000 1.5000 0.0000 Constraint 306 374 0.8000 1.0000 1.5000 0.0000 Constraint 306 358 0.8000 1.0000 1.5000 0.0000 Constraint 306 350 0.8000 1.0000 1.5000 0.0000 Constraint 306 340 0.8000 1.0000 1.5000 0.0000 Constraint 306 329 0.8000 1.0000 1.5000 0.0000 Constraint 306 324 0.8000 1.0000 1.5000 0.0000 Constraint 306 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 691 0.8000 1.0000 1.5000 0.0000 Constraint 295 680 0.8000 1.0000 1.5000 0.0000 Constraint 295 673 0.8000 1.0000 1.5000 0.0000 Constraint 295 667 0.8000 1.0000 1.5000 0.0000 Constraint 295 660 0.8000 1.0000 1.5000 0.0000 Constraint 295 649 0.8000 1.0000 1.5000 0.0000 Constraint 295 642 0.8000 1.0000 1.5000 0.0000 Constraint 295 634 0.8000 1.0000 1.5000 0.0000 Constraint 295 626 0.8000 1.0000 1.5000 0.0000 Constraint 295 615 0.8000 1.0000 1.5000 0.0000 Constraint 295 610 0.8000 1.0000 1.5000 0.0000 Constraint 295 601 0.8000 1.0000 1.5000 0.0000 Constraint 295 593 0.8000 1.0000 1.5000 0.0000 Constraint 295 584 0.8000 1.0000 1.5000 0.0000 Constraint 295 573 0.8000 1.0000 1.5000 0.0000 Constraint 295 568 0.8000 1.0000 1.5000 0.0000 Constraint 295 559 0.8000 1.0000 1.5000 0.0000 Constraint 295 545 0.8000 1.0000 1.5000 0.0000 Constraint 295 540 0.8000 1.0000 1.5000 0.0000 Constraint 295 526 0.8000 1.0000 1.5000 0.0000 Constraint 295 517 0.8000 1.0000 1.5000 0.0000 Constraint 295 512 0.8000 1.0000 1.5000 0.0000 Constraint 295 502 0.8000 1.0000 1.5000 0.0000 Constraint 295 491 0.8000 1.0000 1.5000 0.0000 Constraint 295 483 0.8000 1.0000 1.5000 0.0000 Constraint 295 470 0.8000 1.0000 1.5000 0.0000 Constraint 295 463 0.8000 1.0000 1.5000 0.0000 Constraint 295 455 0.8000 1.0000 1.5000 0.0000 Constraint 295 446 0.8000 1.0000 1.5000 0.0000 Constraint 295 434 0.8000 1.0000 1.5000 0.0000 Constraint 295 427 0.8000 1.0000 1.5000 0.0000 Constraint 295 418 0.8000 1.0000 1.5000 0.0000 Constraint 295 410 0.8000 1.0000 1.5000 0.0000 Constraint 295 402 0.8000 1.0000 1.5000 0.0000 Constraint 295 391 0.8000 1.0000 1.5000 0.0000 Constraint 295 383 0.8000 1.0000 1.5000 0.0000 Constraint 295 374 0.8000 1.0000 1.5000 0.0000 Constraint 295 340 0.8000 1.0000 1.5000 0.0000 Constraint 295 329 0.8000 1.0000 1.5000 0.0000 Constraint 295 324 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 691 0.8000 1.0000 1.5000 0.0000 Constraint 287 680 0.8000 1.0000 1.5000 0.0000 Constraint 287 673 0.8000 1.0000 1.5000 0.0000 Constraint 287 667 0.8000 1.0000 1.5000 0.0000 Constraint 287 660 0.8000 1.0000 1.5000 0.0000 Constraint 287 649 0.8000 1.0000 1.5000 0.0000 Constraint 287 642 0.8000 1.0000 1.5000 0.0000 Constraint 287 634 0.8000 1.0000 1.5000 0.0000 Constraint 287 626 0.8000 1.0000 1.5000 0.0000 Constraint 287 615 0.8000 1.0000 1.5000 0.0000 Constraint 287 610 0.8000 1.0000 1.5000 0.0000 Constraint 287 601 0.8000 1.0000 1.5000 0.0000 Constraint 287 593 0.8000 1.0000 1.5000 0.0000 Constraint 287 584 0.8000 1.0000 1.5000 0.0000 Constraint 287 573 0.8000 1.0000 1.5000 0.0000 Constraint 287 568 0.8000 1.0000 1.5000 0.0000 Constraint 287 559 0.8000 1.0000 1.5000 0.0000 Constraint 287 545 0.8000 1.0000 1.5000 0.0000 Constraint 287 540 0.8000 1.0000 1.5000 0.0000 Constraint 287 533 0.8000 1.0000 1.5000 0.0000 Constraint 287 526 0.8000 1.0000 1.5000 0.0000 Constraint 287 517 0.8000 1.0000 1.5000 0.0000 Constraint 287 512 0.8000 1.0000 1.5000 0.0000 Constraint 287 502 0.8000 1.0000 1.5000 0.0000 Constraint 287 491 0.8000 1.0000 1.5000 0.0000 Constraint 287 483 0.8000 1.0000 1.5000 0.0000 Constraint 287 470 0.8000 1.0000 1.5000 0.0000 Constraint 287 463 0.8000 1.0000 1.5000 0.0000 Constraint 287 455 0.8000 1.0000 1.5000 0.0000 Constraint 287 446 0.8000 1.0000 1.5000 0.0000 Constraint 287 434 0.8000 1.0000 1.5000 0.0000 Constraint 287 427 0.8000 1.0000 1.5000 0.0000 Constraint 287 418 0.8000 1.0000 1.5000 0.0000 Constraint 287 410 0.8000 1.0000 1.5000 0.0000 Constraint 287 391 0.8000 1.0000 1.5000 0.0000 Constraint 287 340 0.8000 1.0000 1.5000 0.0000 Constraint 287 329 0.8000 1.0000 1.5000 0.0000 Constraint 287 324 0.8000 1.0000 1.5000 0.0000 Constraint 287 319 0.8000 1.0000 1.5000 0.0000 Constraint 287 312 0.8000 1.0000 1.5000 0.0000 Constraint 287 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 691 0.8000 1.0000 1.5000 0.0000 Constraint 280 680 0.8000 1.0000 1.5000 0.0000 Constraint 280 649 0.8000 1.0000 1.5000 0.0000 Constraint 280 615 0.8000 1.0000 1.5000 0.0000 Constraint 280 601 0.8000 1.0000 1.5000 0.0000 Constraint 280 593 0.8000 1.0000 1.5000 0.0000 Constraint 280 584 0.8000 1.0000 1.5000 0.0000 Constraint 280 573 0.8000 1.0000 1.5000 0.0000 Constraint 280 568 0.8000 1.0000 1.5000 0.0000 Constraint 280 559 0.8000 1.0000 1.5000 0.0000 Constraint 280 545 0.8000 1.0000 1.5000 0.0000 Constraint 280 540 0.8000 1.0000 1.5000 0.0000 Constraint 280 517 0.8000 1.0000 1.5000 0.0000 Constraint 280 512 0.8000 1.0000 1.5000 0.0000 Constraint 280 491 0.8000 1.0000 1.5000 0.0000 Constraint 280 483 0.8000 1.0000 1.5000 0.0000 Constraint 280 470 0.8000 1.0000 1.5000 0.0000 Constraint 280 455 0.8000 1.0000 1.5000 0.0000 Constraint 280 446 0.8000 1.0000 1.5000 0.0000 Constraint 280 434 0.8000 1.0000 1.5000 0.0000 Constraint 280 427 0.8000 1.0000 1.5000 0.0000 Constraint 280 418 0.8000 1.0000 1.5000 0.0000 Constraint 280 410 0.8000 1.0000 1.5000 0.0000 Constraint 280 329 0.8000 1.0000 1.5000 0.0000 Constraint 280 324 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 312 0.8000 1.0000 1.5000 0.0000 Constraint 280 306 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 691 0.8000 1.0000 1.5000 0.0000 Constraint 274 680 0.8000 1.0000 1.5000 0.0000 Constraint 274 673 0.8000 1.0000 1.5000 0.0000 Constraint 274 667 0.8000 1.0000 1.5000 0.0000 Constraint 274 649 0.8000 1.0000 1.5000 0.0000 Constraint 274 642 0.8000 1.0000 1.5000 0.0000 Constraint 274 634 0.8000 1.0000 1.5000 0.0000 Constraint 274 626 0.8000 1.0000 1.5000 0.0000 Constraint 274 615 0.8000 1.0000 1.5000 0.0000 Constraint 274 610 0.8000 1.0000 1.5000 0.0000 Constraint 274 601 0.8000 1.0000 1.5000 0.0000 Constraint 274 593 0.8000 1.0000 1.5000 0.0000 Constraint 274 584 0.8000 1.0000 1.5000 0.0000 Constraint 274 573 0.8000 1.0000 1.5000 0.0000 Constraint 274 568 0.8000 1.0000 1.5000 0.0000 Constraint 274 559 0.8000 1.0000 1.5000 0.0000 Constraint 274 545 0.8000 1.0000 1.5000 0.0000 Constraint 274 540 0.8000 1.0000 1.5000 0.0000 Constraint 274 517 0.8000 1.0000 1.5000 0.0000 Constraint 274 512 0.8000 1.0000 1.5000 0.0000 Constraint 274 491 0.8000 1.0000 1.5000 0.0000 Constraint 274 470 0.8000 1.0000 1.5000 0.0000 Constraint 274 463 0.8000 1.0000 1.5000 0.0000 Constraint 274 455 0.8000 1.0000 1.5000 0.0000 Constraint 274 446 0.8000 1.0000 1.5000 0.0000 Constraint 274 434 0.8000 1.0000 1.5000 0.0000 Constraint 274 427 0.8000 1.0000 1.5000 0.0000 Constraint 274 418 0.8000 1.0000 1.5000 0.0000 Constraint 274 410 0.8000 1.0000 1.5000 0.0000 Constraint 274 329 0.8000 1.0000 1.5000 0.0000 Constraint 274 324 0.8000 1.0000 1.5000 0.0000 Constraint 274 319 0.8000 1.0000 1.5000 0.0000 Constraint 274 312 0.8000 1.0000 1.5000 0.0000 Constraint 274 306 0.8000 1.0000 1.5000 0.0000 Constraint 274 295 0.8000 1.0000 1.5000 0.0000 Constraint 274 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 691 0.8000 1.0000 1.5000 0.0000 Constraint 263 680 0.8000 1.0000 1.5000 0.0000 Constraint 263 673 0.8000 1.0000 1.5000 0.0000 Constraint 263 649 0.8000 1.0000 1.5000 0.0000 Constraint 263 634 0.8000 1.0000 1.5000 0.0000 Constraint 263 626 0.8000 1.0000 1.5000 0.0000 Constraint 263 615 0.8000 1.0000 1.5000 0.0000 Constraint 263 610 0.8000 1.0000 1.5000 0.0000 Constraint 263 601 0.8000 1.0000 1.5000 0.0000 Constraint 263 593 0.8000 1.0000 1.5000 0.0000 Constraint 263 584 0.8000 1.0000 1.5000 0.0000 Constraint 263 573 0.8000 1.0000 1.5000 0.0000 Constraint 263 568 0.8000 1.0000 1.5000 0.0000 Constraint 263 559 0.8000 1.0000 1.5000 0.0000 Constraint 263 545 0.8000 1.0000 1.5000 0.0000 Constraint 263 540 0.8000 1.0000 1.5000 0.0000 Constraint 263 517 0.8000 1.0000 1.5000 0.0000 Constraint 263 512 0.8000 1.0000 1.5000 0.0000 Constraint 263 470 0.8000 1.0000 1.5000 0.0000 Constraint 263 455 0.8000 1.0000 1.5000 0.0000 Constraint 263 446 0.8000 1.0000 1.5000 0.0000 Constraint 263 434 0.8000 1.0000 1.5000 0.0000 Constraint 263 427 0.8000 1.0000 1.5000 0.0000 Constraint 263 418 0.8000 1.0000 1.5000 0.0000 Constraint 263 410 0.8000 1.0000 1.5000 0.0000 Constraint 263 340 0.8000 1.0000 1.5000 0.0000 Constraint 263 329 0.8000 1.0000 1.5000 0.0000 Constraint 263 319 0.8000 1.0000 1.5000 0.0000 Constraint 263 312 0.8000 1.0000 1.5000 0.0000 Constraint 263 306 0.8000 1.0000 1.5000 0.0000 Constraint 263 295 0.8000 1.0000 1.5000 0.0000 Constraint 263 287 0.8000 1.0000 1.5000 0.0000 Constraint 263 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 691 0.8000 1.0000 1.5000 0.0000 Constraint 255 680 0.8000 1.0000 1.5000 0.0000 Constraint 255 615 0.8000 1.0000 1.5000 0.0000 Constraint 255 601 0.8000 1.0000 1.5000 0.0000 Constraint 255 593 0.8000 1.0000 1.5000 0.0000 Constraint 255 584 0.8000 1.0000 1.5000 0.0000 Constraint 255 573 0.8000 1.0000 1.5000 0.0000 Constraint 255 568 0.8000 1.0000 1.5000 0.0000 Constraint 255 559 0.8000 1.0000 1.5000 0.0000 Constraint 255 540 0.8000 1.0000 1.5000 0.0000 Constraint 255 470 0.8000 1.0000 1.5000 0.0000 Constraint 255 455 0.8000 1.0000 1.5000 0.0000 Constraint 255 434 0.8000 1.0000 1.5000 0.0000 Constraint 255 329 0.8000 1.0000 1.5000 0.0000 Constraint 255 312 0.8000 1.0000 1.5000 0.0000 Constraint 255 306 0.8000 1.0000 1.5000 0.0000 Constraint 255 295 0.8000 1.0000 1.5000 0.0000 Constraint 255 287 0.8000 1.0000 1.5000 0.0000 Constraint 255 280 0.8000 1.0000 1.5000 0.0000 Constraint 255 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 691 0.8000 1.0000 1.5000 0.0000 Constraint 243 673 0.8000 1.0000 1.5000 0.0000 Constraint 243 615 0.8000 1.0000 1.5000 0.0000 Constraint 243 610 0.8000 1.0000 1.5000 0.0000 Constraint 243 601 0.8000 1.0000 1.5000 0.0000 Constraint 243 593 0.8000 1.0000 1.5000 0.0000 Constraint 243 584 0.8000 1.0000 1.5000 0.0000 Constraint 243 573 0.8000 1.0000 1.5000 0.0000 Constraint 243 568 0.8000 1.0000 1.5000 0.0000 Constraint 243 559 0.8000 1.0000 1.5000 0.0000 Constraint 243 545 0.8000 1.0000 1.5000 0.0000 Constraint 243 540 0.8000 1.0000 1.5000 0.0000 Constraint 243 455 0.8000 1.0000 1.5000 0.0000 Constraint 243 446 0.8000 1.0000 1.5000 0.0000 Constraint 243 434 0.8000 1.0000 1.5000 0.0000 Constraint 243 340 0.8000 1.0000 1.5000 0.0000 Constraint 243 329 0.8000 1.0000 1.5000 0.0000 Constraint 243 324 0.8000 1.0000 1.5000 0.0000 Constraint 243 312 0.8000 1.0000 1.5000 0.0000 Constraint 243 306 0.8000 1.0000 1.5000 0.0000 Constraint 243 295 0.8000 1.0000 1.5000 0.0000 Constraint 243 287 0.8000 1.0000 1.5000 0.0000 Constraint 243 280 0.8000 1.0000 1.5000 0.0000 Constraint 243 274 0.8000 1.0000 1.5000 0.0000 Constraint 243 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 691 0.8000 1.0000 1.5000 0.0000 Constraint 234 680 0.8000 1.0000 1.5000 0.0000 Constraint 234 673 0.8000 1.0000 1.5000 0.0000 Constraint 234 615 0.8000 1.0000 1.5000 0.0000 Constraint 234 601 0.8000 1.0000 1.5000 0.0000 Constraint 234 593 0.8000 1.0000 1.5000 0.0000 Constraint 234 584 0.8000 1.0000 1.5000 0.0000 Constraint 234 568 0.8000 1.0000 1.5000 0.0000 Constraint 234 358 0.8000 1.0000 1.5000 0.0000 Constraint 234 340 0.8000 1.0000 1.5000 0.0000 Constraint 234 329 0.8000 1.0000 1.5000 0.0000 Constraint 234 324 0.8000 1.0000 1.5000 0.0000 Constraint 234 312 0.8000 1.0000 1.5000 0.0000 Constraint 234 306 0.8000 1.0000 1.5000 0.0000 Constraint 234 295 0.8000 1.0000 1.5000 0.0000 Constraint 234 287 0.8000 1.0000 1.5000 0.0000 Constraint 234 280 0.8000 1.0000 1.5000 0.0000 Constraint 234 274 0.8000 1.0000 1.5000 0.0000 Constraint 234 263 0.8000 1.0000 1.5000 0.0000 Constraint 234 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 673 0.8000 1.0000 1.5000 0.0000 Constraint 223 615 0.8000 1.0000 1.5000 0.0000 Constraint 223 610 0.8000 1.0000 1.5000 0.0000 Constraint 223 601 0.8000 1.0000 1.5000 0.0000 Constraint 223 593 0.8000 1.0000 1.5000 0.0000 Constraint 223 584 0.8000 1.0000 1.5000 0.0000 Constraint 223 573 0.8000 1.0000 1.5000 0.0000 Constraint 223 568 0.8000 1.0000 1.5000 0.0000 Constraint 223 559 0.8000 1.0000 1.5000 0.0000 Constraint 223 540 0.8000 1.0000 1.5000 0.0000 Constraint 223 434 0.8000 1.0000 1.5000 0.0000 Constraint 223 369 0.8000 1.0000 1.5000 0.0000 Constraint 223 358 0.8000 1.0000 1.5000 0.0000 Constraint 223 350 0.8000 1.0000 1.5000 0.0000 Constraint 223 340 0.8000 1.0000 1.5000 0.0000 Constraint 223 329 0.8000 1.0000 1.5000 0.0000 Constraint 223 324 0.8000 1.0000 1.5000 0.0000 Constraint 223 319 0.8000 1.0000 1.5000 0.0000 Constraint 223 312 0.8000 1.0000 1.5000 0.0000 Constraint 223 306 0.8000 1.0000 1.5000 0.0000 Constraint 223 295 0.8000 1.0000 1.5000 0.0000 Constraint 223 287 0.8000 1.0000 1.5000 0.0000 Constraint 223 280 0.8000 1.0000 1.5000 0.0000 Constraint 223 274 0.8000 1.0000 1.5000 0.0000 Constraint 223 263 0.8000 1.0000 1.5000 0.0000 Constraint 223 255 0.8000 1.0000 1.5000 0.0000 Constraint 223 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 691 0.8000 1.0000 1.5000 0.0000 Constraint 212 680 0.8000 1.0000 1.5000 0.0000 Constraint 212 673 0.8000 1.0000 1.5000 0.0000 Constraint 212 626 0.8000 1.0000 1.5000 0.0000 Constraint 212 615 0.8000 1.0000 1.5000 0.0000 Constraint 212 610 0.8000 1.0000 1.5000 0.0000 Constraint 212 601 0.8000 1.0000 1.5000 0.0000 Constraint 212 593 0.8000 1.0000 1.5000 0.0000 Constraint 212 584 0.8000 1.0000 1.5000 0.0000 Constraint 212 573 0.8000 1.0000 1.5000 0.0000 Constraint 212 568 0.8000 1.0000 1.5000 0.0000 Constraint 212 559 0.8000 1.0000 1.5000 0.0000 Constraint 212 540 0.8000 1.0000 1.5000 0.0000 Constraint 212 434 0.8000 1.0000 1.5000 0.0000 Constraint 212 369 0.8000 1.0000 1.5000 0.0000 Constraint 212 358 0.8000 1.0000 1.5000 0.0000 Constraint 212 350 0.8000 1.0000 1.5000 0.0000 Constraint 212 340 0.8000 1.0000 1.5000 0.0000 Constraint 212 329 0.8000 1.0000 1.5000 0.0000 Constraint 212 324 0.8000 1.0000 1.5000 0.0000 Constraint 212 319 0.8000 1.0000 1.5000 0.0000 Constraint 212 312 0.8000 1.0000 1.5000 0.0000 Constraint 212 306 0.8000 1.0000 1.5000 0.0000 Constraint 212 295 0.8000 1.0000 1.5000 0.0000 Constraint 212 287 0.8000 1.0000 1.5000 0.0000 Constraint 212 280 0.8000 1.0000 1.5000 0.0000 Constraint 212 274 0.8000 1.0000 1.5000 0.0000 Constraint 212 263 0.8000 1.0000 1.5000 0.0000 Constraint 212 255 0.8000 1.0000 1.5000 0.0000 Constraint 212 243 0.8000 1.0000 1.5000 0.0000 Constraint 212 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 691 0.8000 1.0000 1.5000 0.0000 Constraint 206 680 0.8000 1.0000 1.5000 0.0000 Constraint 206 673 0.8000 1.0000 1.5000 0.0000 Constraint 206 615 0.8000 1.0000 1.5000 0.0000 Constraint 206 610 0.8000 1.0000 1.5000 0.0000 Constraint 206 601 0.8000 1.0000 1.5000 0.0000 Constraint 206 593 0.8000 1.0000 1.5000 0.0000 Constraint 206 584 0.8000 1.0000 1.5000 0.0000 Constraint 206 573 0.8000 1.0000 1.5000 0.0000 Constraint 206 568 0.8000 1.0000 1.5000 0.0000 Constraint 206 559 0.8000 1.0000 1.5000 0.0000 Constraint 206 434 0.8000 1.0000 1.5000 0.0000 Constraint 206 358 0.8000 1.0000 1.5000 0.0000 Constraint 206 350 0.8000 1.0000 1.5000 0.0000 Constraint 206 340 0.8000 1.0000 1.5000 0.0000 Constraint 206 329 0.8000 1.0000 1.5000 0.0000 Constraint 206 324 0.8000 1.0000 1.5000 0.0000 Constraint 206 319 0.8000 1.0000 1.5000 0.0000 Constraint 206 312 0.8000 1.0000 1.5000 0.0000 Constraint 206 306 0.8000 1.0000 1.5000 0.0000 Constraint 206 295 0.8000 1.0000 1.5000 0.0000 Constraint 206 287 0.8000 1.0000 1.5000 0.0000 Constraint 206 280 0.8000 1.0000 1.5000 0.0000 Constraint 206 274 0.8000 1.0000 1.5000 0.0000 Constraint 206 263 0.8000 1.0000 1.5000 0.0000 Constraint 206 255 0.8000 1.0000 1.5000 0.0000 Constraint 206 243 0.8000 1.0000 1.5000 0.0000 Constraint 206 234 0.8000 1.0000 1.5000 0.0000 Constraint 206 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 691 0.8000 1.0000 1.5000 0.0000 Constraint 197 680 0.8000 1.0000 1.5000 0.0000 Constraint 197 673 0.8000 1.0000 1.5000 0.0000 Constraint 197 642 0.8000 1.0000 1.5000 0.0000 Constraint 197 634 0.8000 1.0000 1.5000 0.0000 Constraint 197 626 0.8000 1.0000 1.5000 0.0000 Constraint 197 615 0.8000 1.0000 1.5000 0.0000 Constraint 197 610 0.8000 1.0000 1.5000 0.0000 Constraint 197 601 0.8000 1.0000 1.5000 0.0000 Constraint 197 593 0.8000 1.0000 1.5000 0.0000 Constraint 197 584 0.8000 1.0000 1.5000 0.0000 Constraint 197 573 0.8000 1.0000 1.5000 0.0000 Constraint 197 568 0.8000 1.0000 1.5000 0.0000 Constraint 197 559 0.8000 1.0000 1.5000 0.0000 Constraint 197 551 0.8000 1.0000 1.5000 0.0000 Constraint 197 446 0.8000 1.0000 1.5000 0.0000 Constraint 197 434 0.8000 1.0000 1.5000 0.0000 Constraint 197 358 0.8000 1.0000 1.5000 0.0000 Constraint 197 350 0.8000 1.0000 1.5000 0.0000 Constraint 197 340 0.8000 1.0000 1.5000 0.0000 Constraint 197 329 0.8000 1.0000 1.5000 0.0000 Constraint 197 324 0.8000 1.0000 1.5000 0.0000 Constraint 197 319 0.8000 1.0000 1.5000 0.0000 Constraint 197 312 0.8000 1.0000 1.5000 0.0000 Constraint 197 306 0.8000 1.0000 1.5000 0.0000 Constraint 197 295 0.8000 1.0000 1.5000 0.0000 Constraint 197 287 0.8000 1.0000 1.5000 0.0000 Constraint 197 280 0.8000 1.0000 1.5000 0.0000 Constraint 197 274 0.8000 1.0000 1.5000 0.0000 Constraint 197 263 0.8000 1.0000 1.5000 0.0000 Constraint 197 255 0.8000 1.0000 1.5000 0.0000 Constraint 197 243 0.8000 1.0000 1.5000 0.0000 Constraint 197 234 0.8000 1.0000 1.5000 0.0000 Constraint 197 223 0.8000 1.0000 1.5000 0.0000 Constraint 197 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 691 0.8000 1.0000 1.5000 0.0000 Constraint 189 680 0.8000 1.0000 1.5000 0.0000 Constraint 189 673 0.8000 1.0000 1.5000 0.0000 Constraint 189 615 0.8000 1.0000 1.5000 0.0000 Constraint 189 610 0.8000 1.0000 1.5000 0.0000 Constraint 189 601 0.8000 1.0000 1.5000 0.0000 Constraint 189 593 0.8000 1.0000 1.5000 0.0000 Constraint 189 584 0.8000 1.0000 1.5000 0.0000 Constraint 189 573 0.8000 1.0000 1.5000 0.0000 Constraint 189 568 0.8000 1.0000 1.5000 0.0000 Constraint 189 559 0.8000 1.0000 1.5000 0.0000 Constraint 189 434 0.8000 1.0000 1.5000 0.0000 Constraint 189 358 0.8000 1.0000 1.5000 0.0000 Constraint 189 350 0.8000 1.0000 1.5000 0.0000 Constraint 189 340 0.8000 1.0000 1.5000 0.0000 Constraint 189 329 0.8000 1.0000 1.5000 0.0000 Constraint 189 324 0.8000 1.0000 1.5000 0.0000 Constraint 189 319 0.8000 1.0000 1.5000 0.0000 Constraint 189 312 0.8000 1.0000 1.5000 0.0000 Constraint 189 306 0.8000 1.0000 1.5000 0.0000 Constraint 189 295 0.8000 1.0000 1.5000 0.0000 Constraint 189 287 0.8000 1.0000 1.5000 0.0000 Constraint 189 255 0.8000 1.0000 1.5000 0.0000 Constraint 189 243 0.8000 1.0000 1.5000 0.0000 Constraint 189 234 0.8000 1.0000 1.5000 0.0000 Constraint 189 223 0.8000 1.0000 1.5000 0.0000 Constraint 189 212 0.8000 1.0000 1.5000 0.0000 Constraint 189 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 691 0.8000 1.0000 1.5000 0.0000 Constraint 183 680 0.8000 1.0000 1.5000 0.0000 Constraint 183 673 0.8000 1.0000 1.5000 0.0000 Constraint 183 667 0.8000 1.0000 1.5000 0.0000 Constraint 183 601 0.8000 1.0000 1.5000 0.0000 Constraint 183 593 0.8000 1.0000 1.5000 0.0000 Constraint 183 584 0.8000 1.0000 1.5000 0.0000 Constraint 183 568 0.8000 1.0000 1.5000 0.0000 Constraint 183 434 0.8000 1.0000 1.5000 0.0000 Constraint 183 340 0.8000 1.0000 1.5000 0.0000 Constraint 183 329 0.8000 1.0000 1.5000 0.0000 Constraint 183 324 0.8000 1.0000 1.5000 0.0000 Constraint 183 312 0.8000 1.0000 1.5000 0.0000 Constraint 183 306 0.8000 1.0000 1.5000 0.0000 Constraint 183 295 0.8000 1.0000 1.5000 0.0000 Constraint 183 243 0.8000 1.0000 1.5000 0.0000 Constraint 183 234 0.8000 1.0000 1.5000 0.0000 Constraint 183 223 0.8000 1.0000 1.5000 0.0000 Constraint 183 212 0.8000 1.0000 1.5000 0.0000 Constraint 183 206 0.8000 1.0000 1.5000 0.0000 Constraint 183 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 691 0.8000 1.0000 1.5000 0.0000 Constraint 173 680 0.8000 1.0000 1.5000 0.0000 Constraint 173 673 0.8000 1.0000 1.5000 0.0000 Constraint 173 649 0.8000 1.0000 1.5000 0.0000 Constraint 173 642 0.8000 1.0000 1.5000 0.0000 Constraint 173 634 0.8000 1.0000 1.5000 0.0000 Constraint 173 626 0.8000 1.0000 1.5000 0.0000 Constraint 173 615 0.8000 1.0000 1.5000 0.0000 Constraint 173 610 0.8000 1.0000 1.5000 0.0000 Constraint 173 601 0.8000 1.0000 1.5000 0.0000 Constraint 173 593 0.8000 1.0000 1.5000 0.0000 Constraint 173 584 0.8000 1.0000 1.5000 0.0000 Constraint 173 573 0.8000 1.0000 1.5000 0.0000 Constraint 173 568 0.8000 1.0000 1.5000 0.0000 Constraint 173 455 0.8000 1.0000 1.5000 0.0000 Constraint 173 446 0.8000 1.0000 1.5000 0.0000 Constraint 173 434 0.8000 1.0000 1.5000 0.0000 Constraint 173 418 0.8000 1.0000 1.5000 0.0000 Constraint 173 340 0.8000 1.0000 1.5000 0.0000 Constraint 173 329 0.8000 1.0000 1.5000 0.0000 Constraint 173 234 0.8000 1.0000 1.5000 0.0000 Constraint 173 223 0.8000 1.0000 1.5000 0.0000 Constraint 173 212 0.8000 1.0000 1.5000 0.0000 Constraint 173 206 0.8000 1.0000 1.5000 0.0000 Constraint 173 197 0.8000 1.0000 1.5000 0.0000 Constraint 173 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 691 0.8000 1.0000 1.5000 0.0000 Constraint 165 680 0.8000 1.0000 1.5000 0.0000 Constraint 165 673 0.8000 1.0000 1.5000 0.0000 Constraint 165 667 0.8000 1.0000 1.5000 0.0000 Constraint 165 601 0.8000 1.0000 1.5000 0.0000 Constraint 165 593 0.8000 1.0000 1.5000 0.0000 Constraint 165 584 0.8000 1.0000 1.5000 0.0000 Constraint 165 568 0.8000 1.0000 1.5000 0.0000 Constraint 165 223 0.8000 1.0000 1.5000 0.0000 Constraint 165 212 0.8000 1.0000 1.5000 0.0000 Constraint 165 206 0.8000 1.0000 1.5000 0.0000 Constraint 165 197 0.8000 1.0000 1.5000 0.0000 Constraint 165 189 0.8000 1.0000 1.5000 0.0000 Constraint 165 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 691 0.8000 1.0000 1.5000 0.0000 Constraint 157 680 0.8000 1.0000 1.5000 0.0000 Constraint 157 673 0.8000 1.0000 1.5000 0.0000 Constraint 157 667 0.8000 1.0000 1.5000 0.0000 Constraint 157 660 0.8000 1.0000 1.5000 0.0000 Constraint 157 649 0.8000 1.0000 1.5000 0.0000 Constraint 157 642 0.8000 1.0000 1.5000 0.0000 Constraint 157 634 0.8000 1.0000 1.5000 0.0000 Constraint 157 601 0.8000 1.0000 1.5000 0.0000 Constraint 157 593 0.8000 1.0000 1.5000 0.0000 Constraint 157 584 0.8000 1.0000 1.5000 0.0000 Constraint 157 573 0.8000 1.0000 1.5000 0.0000 Constraint 157 568 0.8000 1.0000 1.5000 0.0000 Constraint 157 517 0.8000 1.0000 1.5000 0.0000 Constraint 157 491 0.8000 1.0000 1.5000 0.0000 Constraint 157 483 0.8000 1.0000 1.5000 0.0000 Constraint 157 470 0.8000 1.0000 1.5000 0.0000 Constraint 157 455 0.8000 1.0000 1.5000 0.0000 Constraint 157 434 0.8000 1.0000 1.5000 0.0000 Constraint 157 418 0.8000 1.0000 1.5000 0.0000 Constraint 157 410 0.8000 1.0000 1.5000 0.0000 Constraint 157 391 0.8000 1.0000 1.5000 0.0000 Constraint 157 223 0.8000 1.0000 1.5000 0.0000 Constraint 157 212 0.8000 1.0000 1.5000 0.0000 Constraint 157 206 0.8000 1.0000 1.5000 0.0000 Constraint 157 197 0.8000 1.0000 1.5000 0.0000 Constraint 157 189 0.8000 1.0000 1.5000 0.0000 Constraint 157 183 0.8000 1.0000 1.5000 0.0000 Constraint 157 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 691 0.8000 1.0000 1.5000 0.0000 Constraint 146 680 0.8000 1.0000 1.5000 0.0000 Constraint 146 673 0.8000 1.0000 1.5000 0.0000 Constraint 146 667 0.8000 1.0000 1.5000 0.0000 Constraint 146 649 0.8000 1.0000 1.5000 0.0000 Constraint 146 517 0.8000 1.0000 1.5000 0.0000 Constraint 146 512 0.8000 1.0000 1.5000 0.0000 Constraint 146 491 0.8000 1.0000 1.5000 0.0000 Constraint 146 483 0.8000 1.0000 1.5000 0.0000 Constraint 146 470 0.8000 1.0000 1.5000 0.0000 Constraint 146 455 0.8000 1.0000 1.5000 0.0000 Constraint 146 418 0.8000 1.0000 1.5000 0.0000 Constraint 146 410 0.8000 1.0000 1.5000 0.0000 Constraint 146 223 0.8000 1.0000 1.5000 0.0000 Constraint 146 212 0.8000 1.0000 1.5000 0.0000 Constraint 146 206 0.8000 1.0000 1.5000 0.0000 Constraint 146 197 0.8000 1.0000 1.5000 0.0000 Constraint 146 189 0.8000 1.0000 1.5000 0.0000 Constraint 146 183 0.8000 1.0000 1.5000 0.0000 Constraint 146 173 0.8000 1.0000 1.5000 0.0000 Constraint 146 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 691 0.8000 1.0000 1.5000 0.0000 Constraint 130 680 0.8000 1.0000 1.5000 0.0000 Constraint 130 673 0.8000 1.0000 1.5000 0.0000 Constraint 130 667 0.8000 1.0000 1.5000 0.0000 Constraint 130 660 0.8000 1.0000 1.5000 0.0000 Constraint 130 649 0.8000 1.0000 1.5000 0.0000 Constraint 130 512 0.8000 1.0000 1.5000 0.0000 Constraint 130 491 0.8000 1.0000 1.5000 0.0000 Constraint 130 483 0.8000 1.0000 1.5000 0.0000 Constraint 130 470 0.8000 1.0000 1.5000 0.0000 Constraint 130 455 0.8000 1.0000 1.5000 0.0000 Constraint 130 410 0.8000 1.0000 1.5000 0.0000 Constraint 130 391 0.8000 1.0000 1.5000 0.0000 Constraint 130 374 0.8000 1.0000 1.5000 0.0000 Constraint 130 243 0.8000 1.0000 1.5000 0.0000 Constraint 130 223 0.8000 1.0000 1.5000 0.0000 Constraint 130 212 0.8000 1.0000 1.5000 0.0000 Constraint 130 206 0.8000 1.0000 1.5000 0.0000 Constraint 130 197 0.8000 1.0000 1.5000 0.0000 Constraint 130 189 0.8000 1.0000 1.5000 0.0000 Constraint 130 183 0.8000 1.0000 1.5000 0.0000 Constraint 130 173 0.8000 1.0000 1.5000 0.0000 Constraint 130 165 0.8000 1.0000 1.5000 0.0000 Constraint 130 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 691 0.8000 1.0000 1.5000 0.0000 Constraint 117 680 0.8000 1.0000 1.5000 0.0000 Constraint 117 673 0.8000 1.0000 1.5000 0.0000 Constraint 117 667 0.8000 1.0000 1.5000 0.0000 Constraint 117 660 0.8000 1.0000 1.5000 0.0000 Constraint 117 649 0.8000 1.0000 1.5000 0.0000 Constraint 117 642 0.8000 1.0000 1.5000 0.0000 Constraint 117 634 0.8000 1.0000 1.5000 0.0000 Constraint 117 517 0.8000 1.0000 1.5000 0.0000 Constraint 117 512 0.8000 1.0000 1.5000 0.0000 Constraint 117 502 0.8000 1.0000 1.5000 0.0000 Constraint 117 491 0.8000 1.0000 1.5000 0.0000 Constraint 117 483 0.8000 1.0000 1.5000 0.0000 Constraint 117 470 0.8000 1.0000 1.5000 0.0000 Constraint 117 463 0.8000 1.0000 1.5000 0.0000 Constraint 117 455 0.8000 1.0000 1.5000 0.0000 Constraint 117 446 0.8000 1.0000 1.5000 0.0000 Constraint 117 418 0.8000 1.0000 1.5000 0.0000 Constraint 117 410 0.8000 1.0000 1.5000 0.0000 Constraint 117 402 0.8000 1.0000 1.5000 0.0000 Constraint 117 391 0.8000 1.0000 1.5000 0.0000 Constraint 117 383 0.8000 1.0000 1.5000 0.0000 Constraint 117 374 0.8000 1.0000 1.5000 0.0000 Constraint 117 369 0.8000 1.0000 1.5000 0.0000 Constraint 117 358 0.8000 1.0000 1.5000 0.0000 Constraint 117 263 0.8000 1.0000 1.5000 0.0000 Constraint 117 255 0.8000 1.0000 1.5000 0.0000 Constraint 117 243 0.8000 1.0000 1.5000 0.0000 Constraint 117 234 0.8000 1.0000 1.5000 0.0000 Constraint 117 223 0.8000 1.0000 1.5000 0.0000 Constraint 117 212 0.8000 1.0000 1.5000 0.0000 Constraint 117 206 0.8000 1.0000 1.5000 0.0000 Constraint 117 197 0.8000 1.0000 1.5000 0.0000 Constraint 117 189 0.8000 1.0000 1.5000 0.0000 Constraint 117 183 0.8000 1.0000 1.5000 0.0000 Constraint 117 173 0.8000 1.0000 1.5000 0.0000 Constraint 117 165 0.8000 1.0000 1.5000 0.0000 Constraint 117 157 0.8000 1.0000 1.5000 0.0000 Constraint 117 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 691 0.8000 1.0000 1.5000 0.0000 Constraint 110 680 0.8000 1.0000 1.5000 0.0000 Constraint 110 673 0.8000 1.0000 1.5000 0.0000 Constraint 110 667 0.8000 1.0000 1.5000 0.0000 Constraint 110 660 0.8000 1.0000 1.5000 0.0000 Constraint 110 649 0.8000 1.0000 1.5000 0.0000 Constraint 110 642 0.8000 1.0000 1.5000 0.0000 Constraint 110 634 0.8000 1.0000 1.5000 0.0000 Constraint 110 615 0.8000 1.0000 1.5000 0.0000 Constraint 110 526 0.8000 1.0000 1.5000 0.0000 Constraint 110 517 0.8000 1.0000 1.5000 0.0000 Constraint 110 512 0.8000 1.0000 1.5000 0.0000 Constraint 110 502 0.8000 1.0000 1.5000 0.0000 Constraint 110 491 0.8000 1.0000 1.5000 0.0000 Constraint 110 483 0.8000 1.0000 1.5000 0.0000 Constraint 110 470 0.8000 1.0000 1.5000 0.0000 Constraint 110 463 0.8000 1.0000 1.5000 0.0000 Constraint 110 455 0.8000 1.0000 1.5000 0.0000 Constraint 110 446 0.8000 1.0000 1.5000 0.0000 Constraint 110 427 0.8000 1.0000 1.5000 0.0000 Constraint 110 418 0.8000 1.0000 1.5000 0.0000 Constraint 110 410 0.8000 1.0000 1.5000 0.0000 Constraint 110 402 0.8000 1.0000 1.5000 0.0000 Constraint 110 391 0.8000 1.0000 1.5000 0.0000 Constraint 110 383 0.8000 1.0000 1.5000 0.0000 Constraint 110 374 0.8000 1.0000 1.5000 0.0000 Constraint 110 369 0.8000 1.0000 1.5000 0.0000 Constraint 110 358 0.8000 1.0000 1.5000 0.0000 Constraint 110 350 0.8000 1.0000 1.5000 0.0000 Constraint 110 263 0.8000 1.0000 1.5000 0.0000 Constraint 110 255 0.8000 1.0000 1.5000 0.0000 Constraint 110 243 0.8000 1.0000 1.5000 0.0000 Constraint 110 234 0.8000 1.0000 1.5000 0.0000 Constraint 110 223 0.8000 1.0000 1.5000 0.0000 Constraint 110 212 0.8000 1.0000 1.5000 0.0000 Constraint 110 206 0.8000 1.0000 1.5000 0.0000 Constraint 110 197 0.8000 1.0000 1.5000 0.0000 Constraint 110 189 0.8000 1.0000 1.5000 0.0000 Constraint 110 183 0.8000 1.0000 1.5000 0.0000 Constraint 110 173 0.8000 1.0000 1.5000 0.0000 Constraint 110 165 0.8000 1.0000 1.5000 0.0000 Constraint 110 157 0.8000 1.0000 1.5000 0.0000 Constraint 110 146 0.8000 1.0000 1.5000 0.0000 Constraint 110 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 691 0.8000 1.0000 1.5000 0.0000 Constraint 97 680 0.8000 1.0000 1.5000 0.0000 Constraint 97 673 0.8000 1.0000 1.5000 0.0000 Constraint 97 667 0.8000 1.0000 1.5000 0.0000 Constraint 97 660 0.8000 1.0000 1.5000 0.0000 Constraint 97 649 0.8000 1.0000 1.5000 0.0000 Constraint 97 642 0.8000 1.0000 1.5000 0.0000 Constraint 97 526 0.8000 1.0000 1.5000 0.0000 Constraint 97 517 0.8000 1.0000 1.5000 0.0000 Constraint 97 512 0.8000 1.0000 1.5000 0.0000 Constraint 97 502 0.8000 1.0000 1.5000 0.0000 Constraint 97 491 0.8000 1.0000 1.5000 0.0000 Constraint 97 483 0.8000 1.0000 1.5000 0.0000 Constraint 97 470 0.8000 1.0000 1.5000 0.0000 Constraint 97 463 0.8000 1.0000 1.5000 0.0000 Constraint 97 455 0.8000 1.0000 1.5000 0.0000 Constraint 97 418 0.8000 1.0000 1.5000 0.0000 Constraint 97 410 0.8000 1.0000 1.5000 0.0000 Constraint 97 402 0.8000 1.0000 1.5000 0.0000 Constraint 97 391 0.8000 1.0000 1.5000 0.0000 Constraint 97 383 0.8000 1.0000 1.5000 0.0000 Constraint 97 374 0.8000 1.0000 1.5000 0.0000 Constraint 97 369 0.8000 1.0000 1.5000 0.0000 Constraint 97 358 0.8000 1.0000 1.5000 0.0000 Constraint 97 274 0.8000 1.0000 1.5000 0.0000 Constraint 97 263 0.8000 1.0000 1.5000 0.0000 Constraint 97 255 0.8000 1.0000 1.5000 0.0000 Constraint 97 243 0.8000 1.0000 1.5000 0.0000 Constraint 97 234 0.8000 1.0000 1.5000 0.0000 Constraint 97 223 0.8000 1.0000 1.5000 0.0000 Constraint 97 212 0.8000 1.0000 1.5000 0.0000 Constraint 97 206 0.8000 1.0000 1.5000 0.0000 Constraint 97 197 0.8000 1.0000 1.5000 0.0000 Constraint 97 189 0.8000 1.0000 1.5000 0.0000 Constraint 97 183 0.8000 1.0000 1.5000 0.0000 Constraint 97 173 0.8000 1.0000 1.5000 0.0000 Constraint 97 157 0.8000 1.0000 1.5000 0.0000 Constraint 97 146 0.8000 1.0000 1.5000 0.0000 Constraint 97 130 0.8000 1.0000 1.5000 0.0000 Constraint 97 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 691 0.8000 1.0000 1.5000 0.0000 Constraint 86 680 0.8000 1.0000 1.5000 0.0000 Constraint 86 673 0.8000 1.0000 1.5000 0.0000 Constraint 86 667 0.8000 1.0000 1.5000 0.0000 Constraint 86 660 0.8000 1.0000 1.5000 0.0000 Constraint 86 649 0.8000 1.0000 1.5000 0.0000 Constraint 86 568 0.8000 1.0000 1.5000 0.0000 Constraint 86 540 0.8000 1.0000 1.5000 0.0000 Constraint 86 533 0.8000 1.0000 1.5000 0.0000 Constraint 86 526 0.8000 1.0000 1.5000 0.0000 Constraint 86 517 0.8000 1.0000 1.5000 0.0000 Constraint 86 512 0.8000 1.0000 1.5000 0.0000 Constraint 86 502 0.8000 1.0000 1.5000 0.0000 Constraint 86 491 0.8000 1.0000 1.5000 0.0000 Constraint 86 483 0.8000 1.0000 1.5000 0.0000 Constraint 86 470 0.8000 1.0000 1.5000 0.0000 Constraint 86 463 0.8000 1.0000 1.5000 0.0000 Constraint 86 455 0.8000 1.0000 1.5000 0.0000 Constraint 86 446 0.8000 1.0000 1.5000 0.0000 Constraint 86 418 0.8000 1.0000 1.5000 0.0000 Constraint 86 410 0.8000 1.0000 1.5000 0.0000 Constraint 86 391 0.8000 1.0000 1.5000 0.0000 Constraint 86 374 0.8000 1.0000 1.5000 0.0000 Constraint 86 369 0.8000 1.0000 1.5000 0.0000 Constraint 86 358 0.8000 1.0000 1.5000 0.0000 Constraint 86 274 0.8000 1.0000 1.5000 0.0000 Constraint 86 263 0.8000 1.0000 1.5000 0.0000 Constraint 86 243 0.8000 1.0000 1.5000 0.0000 Constraint 86 234 0.8000 1.0000 1.5000 0.0000 Constraint 86 223 0.8000 1.0000 1.5000 0.0000 Constraint 86 212 0.8000 1.0000 1.5000 0.0000 Constraint 86 206 0.8000 1.0000 1.5000 0.0000 Constraint 86 197 0.8000 1.0000 1.5000 0.0000 Constraint 86 189 0.8000 1.0000 1.5000 0.0000 Constraint 86 183 0.8000 1.0000 1.5000 0.0000 Constraint 86 173 0.8000 1.0000 1.5000 0.0000 Constraint 86 146 0.8000 1.0000 1.5000 0.0000 Constraint 86 130 0.8000 1.0000 1.5000 0.0000 Constraint 86 117 0.8000 1.0000 1.5000 0.0000 Constraint 86 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 691 0.8000 1.0000 1.5000 0.0000 Constraint 78 680 0.8000 1.0000 1.5000 0.0000 Constraint 78 673 0.8000 1.0000 1.5000 0.0000 Constraint 78 667 0.8000 1.0000 1.5000 0.0000 Constraint 78 660 0.8000 1.0000 1.5000 0.0000 Constraint 78 540 0.8000 1.0000 1.5000 0.0000 Constraint 78 533 0.8000 1.0000 1.5000 0.0000 Constraint 78 526 0.8000 1.0000 1.5000 0.0000 Constraint 78 517 0.8000 1.0000 1.5000 0.0000 Constraint 78 512 0.8000 1.0000 1.5000 0.0000 Constraint 78 502 0.8000 1.0000 1.5000 0.0000 Constraint 78 491 0.8000 1.0000 1.5000 0.0000 Constraint 78 483 0.8000 1.0000 1.5000 0.0000 Constraint 78 470 0.8000 1.0000 1.5000 0.0000 Constraint 78 463 0.8000 1.0000 1.5000 0.0000 Constraint 78 455 0.8000 1.0000 1.5000 0.0000 Constraint 78 410 0.8000 1.0000 1.5000 0.0000 Constraint 78 391 0.8000 1.0000 1.5000 0.0000 Constraint 78 374 0.8000 1.0000 1.5000 0.0000 Constraint 78 369 0.8000 1.0000 1.5000 0.0000 Constraint 78 274 0.8000 1.0000 1.5000 0.0000 Constraint 78 263 0.8000 1.0000 1.5000 0.0000 Constraint 78 243 0.8000 1.0000 1.5000 0.0000 Constraint 78 234 0.8000 1.0000 1.5000 0.0000 Constraint 78 223 0.8000 1.0000 1.5000 0.0000 Constraint 78 212 0.8000 1.0000 1.5000 0.0000 Constraint 78 206 0.8000 1.0000 1.5000 0.0000 Constraint 78 197 0.8000 1.0000 1.5000 0.0000 Constraint 78 189 0.8000 1.0000 1.5000 0.0000 Constraint 78 173 0.8000 1.0000 1.5000 0.0000 Constraint 78 130 0.8000 1.0000 1.5000 0.0000 Constraint 78 117 0.8000 1.0000 1.5000 0.0000 Constraint 78 110 0.8000 1.0000 1.5000 0.0000 Constraint 78 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 691 0.8000 1.0000 1.5000 0.0000 Constraint 68 680 0.8000 1.0000 1.5000 0.0000 Constraint 68 673 0.8000 1.0000 1.5000 0.0000 Constraint 68 667 0.8000 1.0000 1.5000 0.0000 Constraint 68 660 0.8000 1.0000 1.5000 0.0000 Constraint 68 568 0.8000 1.0000 1.5000 0.0000 Constraint 68 559 0.8000 1.0000 1.5000 0.0000 Constraint 68 545 0.8000 1.0000 1.5000 0.0000 Constraint 68 540 0.8000 1.0000 1.5000 0.0000 Constraint 68 533 0.8000 1.0000 1.5000 0.0000 Constraint 68 526 0.8000 1.0000 1.5000 0.0000 Constraint 68 517 0.8000 1.0000 1.5000 0.0000 Constraint 68 512 0.8000 1.0000 1.5000 0.0000 Constraint 68 502 0.8000 1.0000 1.5000 0.0000 Constraint 68 491 0.8000 1.0000 1.5000 0.0000 Constraint 68 483 0.8000 1.0000 1.5000 0.0000 Constraint 68 470 0.8000 1.0000 1.5000 0.0000 Constraint 68 455 0.8000 1.0000 1.5000 0.0000 Constraint 68 446 0.8000 1.0000 1.5000 0.0000 Constraint 68 374 0.8000 1.0000 1.5000 0.0000 Constraint 68 369 0.8000 1.0000 1.5000 0.0000 Constraint 68 295 0.8000 1.0000 1.5000 0.0000 Constraint 68 287 0.8000 1.0000 1.5000 0.0000 Constraint 68 274 0.8000 1.0000 1.5000 0.0000 Constraint 68 263 0.8000 1.0000 1.5000 0.0000 Constraint 68 243 0.8000 1.0000 1.5000 0.0000 Constraint 68 234 0.8000 1.0000 1.5000 0.0000 Constraint 68 223 0.8000 1.0000 1.5000 0.0000 Constraint 68 212 0.8000 1.0000 1.5000 0.0000 Constraint 68 206 0.8000 1.0000 1.5000 0.0000 Constraint 68 197 0.8000 1.0000 1.5000 0.0000 Constraint 68 189 0.8000 1.0000 1.5000 0.0000 Constraint 68 183 0.8000 1.0000 1.5000 0.0000 Constraint 68 173 0.8000 1.0000 1.5000 0.0000 Constraint 68 165 0.8000 1.0000 1.5000 0.0000 Constraint 68 157 0.8000 1.0000 1.5000 0.0000 Constraint 68 130 0.8000 1.0000 1.5000 0.0000 Constraint 68 117 0.8000 1.0000 1.5000 0.0000 Constraint 68 110 0.8000 1.0000 1.5000 0.0000 Constraint 68 97 0.8000 1.0000 1.5000 0.0000 Constraint 68 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 691 0.8000 1.0000 1.5000 0.0000 Constraint 62 680 0.8000 1.0000 1.5000 0.0000 Constraint 62 673 0.8000 1.0000 1.5000 0.0000 Constraint 62 593 0.8000 1.0000 1.5000 0.0000 Constraint 62 584 0.8000 1.0000 1.5000 0.0000 Constraint 62 568 0.8000 1.0000 1.5000 0.0000 Constraint 62 559 0.8000 1.0000 1.5000 0.0000 Constraint 62 545 0.8000 1.0000 1.5000 0.0000 Constraint 62 540 0.8000 1.0000 1.5000 0.0000 Constraint 62 533 0.8000 1.0000 1.5000 0.0000 Constraint 62 526 0.8000 1.0000 1.5000 0.0000 Constraint 62 517 0.8000 1.0000 1.5000 0.0000 Constraint 62 512 0.8000 1.0000 1.5000 0.0000 Constraint 62 502 0.8000 1.0000 1.5000 0.0000 Constraint 62 491 0.8000 1.0000 1.5000 0.0000 Constraint 62 483 0.8000 1.0000 1.5000 0.0000 Constraint 62 470 0.8000 1.0000 1.5000 0.0000 Constraint 62 455 0.8000 1.0000 1.5000 0.0000 Constraint 62 374 0.8000 1.0000 1.5000 0.0000 Constraint 62 295 0.8000 1.0000 1.5000 0.0000 Constraint 62 287 0.8000 1.0000 1.5000 0.0000 Constraint 62 274 0.8000 1.0000 1.5000 0.0000 Constraint 62 263 0.8000 1.0000 1.5000 0.0000 Constraint 62 234 0.8000 1.0000 1.5000 0.0000 Constraint 62 223 0.8000 1.0000 1.5000 0.0000 Constraint 62 212 0.8000 1.0000 1.5000 0.0000 Constraint 62 206 0.8000 1.0000 1.5000 0.0000 Constraint 62 197 0.8000 1.0000 1.5000 0.0000 Constraint 62 189 0.8000 1.0000 1.5000 0.0000 Constraint 62 183 0.8000 1.0000 1.5000 0.0000 Constraint 62 173 0.8000 1.0000 1.5000 0.0000 Constraint 62 157 0.8000 1.0000 1.5000 0.0000 Constraint 62 117 0.8000 1.0000 1.5000 0.0000 Constraint 62 110 0.8000 1.0000 1.5000 0.0000 Constraint 62 97 0.8000 1.0000 1.5000 0.0000 Constraint 62 86 0.8000 1.0000 1.5000 0.0000 Constraint 62 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 691 0.8000 1.0000 1.5000 0.0000 Constraint 54 680 0.8000 1.0000 1.5000 0.0000 Constraint 54 673 0.8000 1.0000 1.5000 0.0000 Constraint 54 593 0.8000 1.0000 1.5000 0.0000 Constraint 54 584 0.8000 1.0000 1.5000 0.0000 Constraint 54 573 0.8000 1.0000 1.5000 0.0000 Constraint 54 568 0.8000 1.0000 1.5000 0.0000 Constraint 54 559 0.8000 1.0000 1.5000 0.0000 Constraint 54 551 0.8000 1.0000 1.5000 0.0000 Constraint 54 545 0.8000 1.0000 1.5000 0.0000 Constraint 54 540 0.8000 1.0000 1.5000 0.0000 Constraint 54 533 0.8000 1.0000 1.5000 0.0000 Constraint 54 526 0.8000 1.0000 1.5000 0.0000 Constraint 54 517 0.8000 1.0000 1.5000 0.0000 Constraint 54 512 0.8000 1.0000 1.5000 0.0000 Constraint 54 502 0.8000 1.0000 1.5000 0.0000 Constraint 54 491 0.8000 1.0000 1.5000 0.0000 Constraint 54 483 0.8000 1.0000 1.5000 0.0000 Constraint 54 470 0.8000 1.0000 1.5000 0.0000 Constraint 54 374 0.8000 1.0000 1.5000 0.0000 Constraint 54 369 0.8000 1.0000 1.5000 0.0000 Constraint 54 324 0.8000 1.0000 1.5000 0.0000 Constraint 54 319 0.8000 1.0000 1.5000 0.0000 Constraint 54 312 0.8000 1.0000 1.5000 0.0000 Constraint 54 306 0.8000 1.0000 1.5000 0.0000 Constraint 54 295 0.8000 1.0000 1.5000 0.0000 Constraint 54 287 0.8000 1.0000 1.5000 0.0000 Constraint 54 280 0.8000 1.0000 1.5000 0.0000 Constraint 54 274 0.8000 1.0000 1.5000 0.0000 Constraint 54 263 0.8000 1.0000 1.5000 0.0000 Constraint 54 255 0.8000 1.0000 1.5000 0.0000 Constraint 54 243 0.8000 1.0000 1.5000 0.0000 Constraint 54 234 0.8000 1.0000 1.5000 0.0000 Constraint 54 223 0.8000 1.0000 1.5000 0.0000 Constraint 54 212 0.8000 1.0000 1.5000 0.0000 Constraint 54 206 0.8000 1.0000 1.5000 0.0000 Constraint 54 197 0.8000 1.0000 1.5000 0.0000 Constraint 54 189 0.8000 1.0000 1.5000 0.0000 Constraint 54 183 0.8000 1.0000 1.5000 0.0000 Constraint 54 173 0.8000 1.0000 1.5000 0.0000 Constraint 54 165 0.8000 1.0000 1.5000 0.0000 Constraint 54 157 0.8000 1.0000 1.5000 0.0000 Constraint 54 146 0.8000 1.0000 1.5000 0.0000 Constraint 54 130 0.8000 1.0000 1.5000 0.0000 Constraint 54 117 0.8000 1.0000 1.5000 0.0000 Constraint 54 110 0.8000 1.0000 1.5000 0.0000 Constraint 54 97 0.8000 1.0000 1.5000 0.0000 Constraint 54 86 0.8000 1.0000 1.5000 0.0000 Constraint 54 78 0.8000 1.0000 1.5000 0.0000 Constraint 54 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 610 0.8000 1.0000 1.5000 0.0000 Constraint 43 601 0.8000 1.0000 1.5000 0.0000 Constraint 43 593 0.8000 1.0000 1.5000 0.0000 Constraint 43 584 0.8000 1.0000 1.5000 0.0000 Constraint 43 573 0.8000 1.0000 1.5000 0.0000 Constraint 43 568 0.8000 1.0000 1.5000 0.0000 Constraint 43 559 0.8000 1.0000 1.5000 0.0000 Constraint 43 551 0.8000 1.0000 1.5000 0.0000 Constraint 43 545 0.8000 1.0000 1.5000 0.0000 Constraint 43 540 0.8000 1.0000 1.5000 0.0000 Constraint 43 533 0.8000 1.0000 1.5000 0.0000 Constraint 43 526 0.8000 1.0000 1.5000 0.0000 Constraint 43 517 0.8000 1.0000 1.5000 0.0000 Constraint 43 512 0.8000 1.0000 1.5000 0.0000 Constraint 43 502 0.8000 1.0000 1.5000 0.0000 Constraint 43 491 0.8000 1.0000 1.5000 0.0000 Constraint 43 483 0.8000 1.0000 1.5000 0.0000 Constraint 43 470 0.8000 1.0000 1.5000 0.0000 Constraint 43 463 0.8000 1.0000 1.5000 0.0000 Constraint 43 455 0.8000 1.0000 1.5000 0.0000 Constraint 43 446 0.8000 1.0000 1.5000 0.0000 Constraint 43 434 0.8000 1.0000 1.5000 0.0000 Constraint 43 427 0.8000 1.0000 1.5000 0.0000 Constraint 43 324 0.8000 1.0000 1.5000 0.0000 Constraint 43 306 0.8000 1.0000 1.5000 0.0000 Constraint 43 295 0.8000 1.0000 1.5000 0.0000 Constraint 43 287 0.8000 1.0000 1.5000 0.0000 Constraint 43 280 0.8000 1.0000 1.5000 0.0000 Constraint 43 274 0.8000 1.0000 1.5000 0.0000 Constraint 43 263 0.8000 1.0000 1.5000 0.0000 Constraint 43 243 0.8000 1.0000 1.5000 0.0000 Constraint 43 234 0.8000 1.0000 1.5000 0.0000 Constraint 43 223 0.8000 1.0000 1.5000 0.0000 Constraint 43 212 0.8000 1.0000 1.5000 0.0000 Constraint 43 206 0.8000 1.0000 1.5000 0.0000 Constraint 43 197 0.8000 1.0000 1.5000 0.0000 Constraint 43 189 0.8000 1.0000 1.5000 0.0000 Constraint 43 183 0.8000 1.0000 1.5000 0.0000 Constraint 43 173 0.8000 1.0000 1.5000 0.0000 Constraint 43 165 0.8000 1.0000 1.5000 0.0000 Constraint 43 157 0.8000 1.0000 1.5000 0.0000 Constraint 43 146 0.8000 1.0000 1.5000 0.0000 Constraint 43 130 0.8000 1.0000 1.5000 0.0000 Constraint 43 117 0.8000 1.0000 1.5000 0.0000 Constraint 43 110 0.8000 1.0000 1.5000 0.0000 Constraint 43 97 0.8000 1.0000 1.5000 0.0000 Constraint 43 86 0.8000 1.0000 1.5000 0.0000 Constraint 43 78 0.8000 1.0000 1.5000 0.0000 Constraint 43 68 0.8000 1.0000 1.5000 0.0000 Constraint 43 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 610 0.8000 1.0000 1.5000 0.0000 Constraint 36 601 0.8000 1.0000 1.5000 0.0000 Constraint 36 593 0.8000 1.0000 1.5000 0.0000 Constraint 36 584 0.8000 1.0000 1.5000 0.0000 Constraint 36 573 0.8000 1.0000 1.5000 0.0000 Constraint 36 568 0.8000 1.0000 1.5000 0.0000 Constraint 36 559 0.8000 1.0000 1.5000 0.0000 Constraint 36 551 0.8000 1.0000 1.5000 0.0000 Constraint 36 545 0.8000 1.0000 1.5000 0.0000 Constraint 36 540 0.8000 1.0000 1.5000 0.0000 Constraint 36 533 0.8000 1.0000 1.5000 0.0000 Constraint 36 526 0.8000 1.0000 1.5000 0.0000 Constraint 36 517 0.8000 1.0000 1.5000 0.0000 Constraint 36 512 0.8000 1.0000 1.5000 0.0000 Constraint 36 502 0.8000 1.0000 1.5000 0.0000 Constraint 36 491 0.8000 1.0000 1.5000 0.0000 Constraint 36 483 0.8000 1.0000 1.5000 0.0000 Constraint 36 446 0.8000 1.0000 1.5000 0.0000 Constraint 36 434 0.8000 1.0000 1.5000 0.0000 Constraint 36 369 0.8000 1.0000 1.5000 0.0000 Constraint 36 340 0.8000 1.0000 1.5000 0.0000 Constraint 36 329 0.8000 1.0000 1.5000 0.0000 Constraint 36 324 0.8000 1.0000 1.5000 0.0000 Constraint 36 319 0.8000 1.0000 1.5000 0.0000 Constraint 36 312 0.8000 1.0000 1.5000 0.0000 Constraint 36 306 0.8000 1.0000 1.5000 0.0000 Constraint 36 295 0.8000 1.0000 1.5000 0.0000 Constraint 36 287 0.8000 1.0000 1.5000 0.0000 Constraint 36 280 0.8000 1.0000 1.5000 0.0000 Constraint 36 274 0.8000 1.0000 1.5000 0.0000 Constraint 36 263 0.8000 1.0000 1.5000 0.0000 Constraint 36 255 0.8000 1.0000 1.5000 0.0000 Constraint 36 243 0.8000 1.0000 1.5000 0.0000 Constraint 36 212 0.8000 1.0000 1.5000 0.0000 Constraint 36 206 0.8000 1.0000 1.5000 0.0000 Constraint 36 197 0.8000 1.0000 1.5000 0.0000 Constraint 36 189 0.8000 1.0000 1.5000 0.0000 Constraint 36 183 0.8000 1.0000 1.5000 0.0000 Constraint 36 173 0.8000 1.0000 1.5000 0.0000 Constraint 36 165 0.8000 1.0000 1.5000 0.0000 Constraint 36 157 0.8000 1.0000 1.5000 0.0000 Constraint 36 146 0.8000 1.0000 1.5000 0.0000 Constraint 36 130 0.8000 1.0000 1.5000 0.0000 Constraint 36 117 0.8000 1.0000 1.5000 0.0000 Constraint 36 110 0.8000 1.0000 1.5000 0.0000 Constraint 36 97 0.8000 1.0000 1.5000 0.0000 Constraint 36 86 0.8000 1.0000 1.5000 0.0000 Constraint 36 78 0.8000 1.0000 1.5000 0.0000 Constraint 36 68 0.8000 1.0000 1.5000 0.0000 Constraint 36 62 0.8000 1.0000 1.5000 0.0000 Constraint 36 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 626 0.8000 1.0000 1.5000 0.0000 Constraint 25 615 0.8000 1.0000 1.5000 0.0000 Constraint 25 610 0.8000 1.0000 1.5000 0.0000 Constraint 25 601 0.8000 1.0000 1.5000 0.0000 Constraint 25 593 0.8000 1.0000 1.5000 0.0000 Constraint 25 584 0.8000 1.0000 1.5000 0.0000 Constraint 25 573 0.8000 1.0000 1.5000 0.0000 Constraint 25 568 0.8000 1.0000 1.5000 0.0000 Constraint 25 559 0.8000 1.0000 1.5000 0.0000 Constraint 25 551 0.8000 1.0000 1.5000 0.0000 Constraint 25 545 0.8000 1.0000 1.5000 0.0000 Constraint 25 540 0.8000 1.0000 1.5000 0.0000 Constraint 25 533 0.8000 1.0000 1.5000 0.0000 Constraint 25 526 0.8000 1.0000 1.5000 0.0000 Constraint 25 517 0.8000 1.0000 1.5000 0.0000 Constraint 25 512 0.8000 1.0000 1.5000 0.0000 Constraint 25 502 0.8000 1.0000 1.5000 0.0000 Constraint 25 491 0.8000 1.0000 1.5000 0.0000 Constraint 25 483 0.8000 1.0000 1.5000 0.0000 Constraint 25 470 0.8000 1.0000 1.5000 0.0000 Constraint 25 463 0.8000 1.0000 1.5000 0.0000 Constraint 25 455 0.8000 1.0000 1.5000 0.0000 Constraint 25 446 0.8000 1.0000 1.5000 0.0000 Constraint 25 434 0.8000 1.0000 1.5000 0.0000 Constraint 25 427 0.8000 1.0000 1.5000 0.0000 Constraint 25 402 0.8000 1.0000 1.5000 0.0000 Constraint 25 369 0.8000 1.0000 1.5000 0.0000 Constraint 25 340 0.8000 1.0000 1.5000 0.0000 Constraint 25 329 0.8000 1.0000 1.5000 0.0000 Constraint 25 324 0.8000 1.0000 1.5000 0.0000 Constraint 25 319 0.8000 1.0000 1.5000 0.0000 Constraint 25 312 0.8000 1.0000 1.5000 0.0000 Constraint 25 306 0.8000 1.0000 1.5000 0.0000 Constraint 25 295 0.8000 1.0000 1.5000 0.0000 Constraint 25 287 0.8000 1.0000 1.5000 0.0000 Constraint 25 280 0.8000 1.0000 1.5000 0.0000 Constraint 25 274 0.8000 1.0000 1.5000 0.0000 Constraint 25 263 0.8000 1.0000 1.5000 0.0000 Constraint 25 255 0.8000 1.0000 1.5000 0.0000 Constraint 25 243 0.8000 1.0000 1.5000 0.0000 Constraint 25 234 0.8000 1.0000 1.5000 0.0000 Constraint 25 212 0.8000 1.0000 1.5000 0.0000 Constraint 25 197 0.8000 1.0000 1.5000 0.0000 Constraint 25 189 0.8000 1.0000 1.5000 0.0000 Constraint 25 183 0.8000 1.0000 1.5000 0.0000 Constraint 25 173 0.8000 1.0000 1.5000 0.0000 Constraint 25 165 0.8000 1.0000 1.5000 0.0000 Constraint 25 157 0.8000 1.0000 1.5000 0.0000 Constraint 25 146 0.8000 1.0000 1.5000 0.0000 Constraint 25 130 0.8000 1.0000 1.5000 0.0000 Constraint 25 117 0.8000 1.0000 1.5000 0.0000 Constraint 25 110 0.8000 1.0000 1.5000 0.0000 Constraint 25 97 0.8000 1.0000 1.5000 0.0000 Constraint 25 86 0.8000 1.0000 1.5000 0.0000 Constraint 25 78 0.8000 1.0000 1.5000 0.0000 Constraint 25 68 0.8000 1.0000 1.5000 0.0000 Constraint 25 62 0.8000 1.0000 1.5000 0.0000 Constraint 25 54 0.8000 1.0000 1.5000 0.0000 Constraint 25 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 626 0.8000 1.0000 1.5000 0.0000 Constraint 17 615 0.8000 1.0000 1.5000 0.0000 Constraint 17 610 0.8000 1.0000 1.5000 0.0000 Constraint 17 601 0.8000 1.0000 1.5000 0.0000 Constraint 17 593 0.8000 1.0000 1.5000 0.0000 Constraint 17 584 0.8000 1.0000 1.5000 0.0000 Constraint 17 573 0.8000 1.0000 1.5000 0.0000 Constraint 17 568 0.8000 1.0000 1.5000 0.0000 Constraint 17 559 0.8000 1.0000 1.5000 0.0000 Constraint 17 551 0.8000 1.0000 1.5000 0.0000 Constraint 17 545 0.8000 1.0000 1.5000 0.0000 Constraint 17 540 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 526 0.8000 1.0000 1.5000 0.0000 Constraint 17 517 0.8000 1.0000 1.5000 0.0000 Constraint 17 512 0.8000 1.0000 1.5000 0.0000 Constraint 17 502 0.8000 1.0000 1.5000 0.0000 Constraint 17 491 0.8000 1.0000 1.5000 0.0000 Constraint 17 483 0.8000 1.0000 1.5000 0.0000 Constraint 17 463 0.8000 1.0000 1.5000 0.0000 Constraint 17 455 0.8000 1.0000 1.5000 0.0000 Constraint 17 446 0.8000 1.0000 1.5000 0.0000 Constraint 17 434 0.8000 1.0000 1.5000 0.0000 Constraint 17 427 0.8000 1.0000 1.5000 0.0000 Constraint 17 329 0.8000 1.0000 1.5000 0.0000 Constraint 17 324 0.8000 1.0000 1.5000 0.0000 Constraint 17 319 0.8000 1.0000 1.5000 0.0000 Constraint 17 312 0.8000 1.0000 1.5000 0.0000 Constraint 17 306 0.8000 1.0000 1.5000 0.0000 Constraint 17 295 0.8000 1.0000 1.5000 0.0000 Constraint 17 287 0.8000 1.0000 1.5000 0.0000 Constraint 17 280 0.8000 1.0000 1.5000 0.0000 Constraint 17 274 0.8000 1.0000 1.5000 0.0000 Constraint 17 263 0.8000 1.0000 1.5000 0.0000 Constraint 17 234 0.8000 1.0000 1.5000 0.0000 Constraint 17 223 0.8000 1.0000 1.5000 0.0000 Constraint 17 197 0.8000 1.0000 1.5000 0.0000 Constraint 17 183 0.8000 1.0000 1.5000 0.0000 Constraint 17 173 0.8000 1.0000 1.5000 0.0000 Constraint 17 165 0.8000 1.0000 1.5000 0.0000 Constraint 17 157 0.8000 1.0000 1.5000 0.0000 Constraint 17 146 0.8000 1.0000 1.5000 0.0000 Constraint 17 130 0.8000 1.0000 1.5000 0.0000 Constraint 17 117 0.8000 1.0000 1.5000 0.0000 Constraint 17 110 0.8000 1.0000 1.5000 0.0000 Constraint 17 97 0.8000 1.0000 1.5000 0.0000 Constraint 17 86 0.8000 1.0000 1.5000 0.0000 Constraint 17 78 0.8000 1.0000 1.5000 0.0000 Constraint 17 68 0.8000 1.0000 1.5000 0.0000 Constraint 17 62 0.8000 1.0000 1.5000 0.0000 Constraint 17 54 0.8000 1.0000 1.5000 0.0000 Constraint 17 43 0.8000 1.0000 1.5000 0.0000 Constraint 17 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 691 0.8000 1.0000 1.5000 0.0000 Constraint 9 680 0.8000 1.0000 1.5000 0.0000 Constraint 9 626 0.8000 1.0000 1.5000 0.0000 Constraint 9 615 0.8000 1.0000 1.5000 0.0000 Constraint 9 610 0.8000 1.0000 1.5000 0.0000 Constraint 9 601 0.8000 1.0000 1.5000 0.0000 Constraint 9 593 0.8000 1.0000 1.5000 0.0000 Constraint 9 584 0.8000 1.0000 1.5000 0.0000 Constraint 9 573 0.8000 1.0000 1.5000 0.0000 Constraint 9 568 0.8000 1.0000 1.5000 0.0000 Constraint 9 559 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 545 0.8000 1.0000 1.5000 0.0000 Constraint 9 540 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 526 0.8000 1.0000 1.5000 0.0000 Constraint 9 517 0.8000 1.0000 1.5000 0.0000 Constraint 9 512 0.8000 1.0000 1.5000 0.0000 Constraint 9 502 0.8000 1.0000 1.5000 0.0000 Constraint 9 491 0.8000 1.0000 1.5000 0.0000 Constraint 9 483 0.8000 1.0000 1.5000 0.0000 Constraint 9 470 0.8000 1.0000 1.5000 0.0000 Constraint 9 463 0.8000 1.0000 1.5000 0.0000 Constraint 9 455 0.8000 1.0000 1.5000 0.0000 Constraint 9 446 0.8000 1.0000 1.5000 0.0000 Constraint 9 434 0.8000 1.0000 1.5000 0.0000 Constraint 9 427 0.8000 1.0000 1.5000 0.0000 Constraint 9 402 0.8000 1.0000 1.5000 0.0000 Constraint 9 369 0.8000 1.0000 1.5000 0.0000 Constraint 9 340 0.8000 1.0000 1.5000 0.0000 Constraint 9 329 0.8000 1.0000 1.5000 0.0000 Constraint 9 324 0.8000 1.0000 1.5000 0.0000 Constraint 9 319 0.8000 1.0000 1.5000 0.0000 Constraint 9 312 0.8000 1.0000 1.5000 0.0000 Constraint 9 306 0.8000 1.0000 1.5000 0.0000 Constraint 9 295 0.8000 1.0000 1.5000 0.0000 Constraint 9 287 0.8000 1.0000 1.5000 0.0000 Constraint 9 280 0.8000 1.0000 1.5000 0.0000 Constraint 9 274 0.8000 1.0000 1.5000 0.0000 Constraint 9 263 0.8000 1.0000 1.5000 0.0000 Constraint 9 255 0.8000 1.0000 1.5000 0.0000 Constraint 9 243 0.8000 1.0000 1.5000 0.0000 Constraint 9 234 0.8000 1.0000 1.5000 0.0000 Constraint 9 223 0.8000 1.0000 1.5000 0.0000 Constraint 9 212 0.8000 1.0000 1.5000 0.0000 Constraint 9 206 0.8000 1.0000 1.5000 0.0000 Constraint 9 197 0.8000 1.0000 1.5000 0.0000 Constraint 9 189 0.8000 1.0000 1.5000 0.0000 Constraint 9 183 0.8000 1.0000 1.5000 0.0000 Constraint 9 173 0.8000 1.0000 1.5000 0.0000 Constraint 9 165 0.8000 1.0000 1.5000 0.0000 Constraint 9 157 0.8000 1.0000 1.5000 0.0000 Constraint 9 146 0.8000 1.0000 1.5000 0.0000 Constraint 9 130 0.8000 1.0000 1.5000 0.0000 Constraint 9 117 0.8000 1.0000 1.5000 0.0000 Constraint 9 110 0.8000 1.0000 1.5000 0.0000 Constraint 9 97 0.8000 1.0000 1.5000 0.0000 Constraint 9 86 0.8000 1.0000 1.5000 0.0000 Constraint 9 78 0.8000 1.0000 1.5000 0.0000 Constraint 9 68 0.8000 1.0000 1.5000 0.0000 Constraint 9 62 0.8000 1.0000 1.5000 0.0000 Constraint 9 54 0.8000 1.0000 1.5000 0.0000 Constraint 9 43 0.8000 1.0000 1.5000 0.0000 Constraint 9 36 0.8000 1.0000 1.5000 0.0000 Constraint 9 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 691 0.8000 1.0000 1.5000 0.0000 Constraint 3 680 0.8000 1.0000 1.5000 0.0000 Constraint 3 673 0.8000 1.0000 1.5000 0.0000 Constraint 3 634 0.8000 1.0000 1.5000 0.0000 Constraint 3 626 0.8000 1.0000 1.5000 0.0000 Constraint 3 615 0.8000 1.0000 1.5000 0.0000 Constraint 3 610 0.8000 1.0000 1.5000 0.0000 Constraint 3 601 0.8000 1.0000 1.5000 0.0000 Constraint 3 593 0.8000 1.0000 1.5000 0.0000 Constraint 3 584 0.8000 1.0000 1.5000 0.0000 Constraint 3 573 0.8000 1.0000 1.5000 0.0000 Constraint 3 568 0.8000 1.0000 1.5000 0.0000 Constraint 3 559 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 545 0.8000 1.0000 1.5000 0.0000 Constraint 3 540 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 526 0.8000 1.0000 1.5000 0.0000 Constraint 3 517 0.8000 1.0000 1.5000 0.0000 Constraint 3 512 0.8000 1.0000 1.5000 0.0000 Constraint 3 502 0.8000 1.0000 1.5000 0.0000 Constraint 3 491 0.8000 1.0000 1.5000 0.0000 Constraint 3 483 0.8000 1.0000 1.5000 0.0000 Constraint 3 470 0.8000 1.0000 1.5000 0.0000 Constraint 3 463 0.8000 1.0000 1.5000 0.0000 Constraint 3 455 0.8000 1.0000 1.5000 0.0000 Constraint 3 446 0.8000 1.0000 1.5000 0.0000 Constraint 3 434 0.8000 1.0000 1.5000 0.0000 Constraint 3 427 0.8000 1.0000 1.5000 0.0000 Constraint 3 418 0.8000 1.0000 1.5000 0.0000 Constraint 3 410 0.8000 1.0000 1.5000 0.0000 Constraint 3 402 0.8000 1.0000 1.5000 0.0000 Constraint 3 340 0.8000 1.0000 1.5000 0.0000 Constraint 3 329 0.8000 1.0000 1.5000 0.0000 Constraint 3 324 0.8000 1.0000 1.5000 0.0000 Constraint 3 319 0.8000 1.0000 1.5000 0.0000 Constraint 3 312 0.8000 1.0000 1.5000 0.0000 Constraint 3 306 0.8000 1.0000 1.5000 0.0000 Constraint 3 295 0.8000 1.0000 1.5000 0.0000 Constraint 3 287 0.8000 1.0000 1.5000 0.0000 Constraint 3 280 0.8000 1.0000 1.5000 0.0000 Constraint 3 274 0.8000 1.0000 1.5000 0.0000 Constraint 3 263 0.8000 1.0000 1.5000 0.0000 Constraint 3 255 0.8000 1.0000 1.5000 0.0000 Constraint 3 234 0.8000 1.0000 1.5000 0.0000 Constraint 3 223 0.8000 1.0000 1.5000 0.0000 Constraint 3 197 0.8000 1.0000 1.5000 0.0000 Constraint 3 189 0.8000 1.0000 1.5000 0.0000 Constraint 3 183 0.8000 1.0000 1.5000 0.0000 Constraint 3 173 0.8000 1.0000 1.5000 0.0000 Constraint 3 165 0.8000 1.0000 1.5000 0.0000 Constraint 3 157 0.8000 1.0000 1.5000 0.0000 Constraint 3 146 0.8000 1.0000 1.5000 0.0000 Constraint 3 130 0.8000 1.0000 1.5000 0.0000 Constraint 3 117 0.8000 1.0000 1.5000 0.0000 Constraint 3 110 0.8000 1.0000 1.5000 0.0000 Constraint 3 97 0.8000 1.0000 1.5000 0.0000 Constraint 3 86 0.8000 1.0000 1.5000 0.0000 Constraint 3 78 0.8000 1.0000 1.5000 0.0000 Constraint 3 68 0.8000 1.0000 1.5000 0.0000 Constraint 3 62 0.8000 1.0000 1.5000 0.0000 Constraint 3 54 0.8000 1.0000 1.5000 0.0000 Constraint 3 43 0.8000 1.0000 1.5000 0.0000 Constraint 3 36 0.8000 1.0000 1.5000 0.0000 Constraint 3 25 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: