parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 12.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint (T0340)V55.CB (T0340)I72.CB 3.8680 6.4467 8.3806 107.0345 Constraint (T0340)V55.CB (T0340)S71.CB 3.2583 5.4306 7.0597 107.0345 Constraint (T0340)V55.CB (T0340)V68.CB 4.3562 7.2604 9.4385 107.0345 Constraint (T0340)E54.CB (T0340)S71.CB 5.9658 9.9430 12.9259 107.0345 Constraint (T0340)E54.CB (T0340)V68.CB 6.2244 10.3740 13.4861 107.0345 Constraint (T0340)L52.CB (T0340)I72.CB 5.4300 9.0500 11.7650 107.0345 Constraint (T0340)V35.CB (T0340)Q49.CB 6.1311 10.2185 13.2840 107.0345 Constraint (T0340)V35.CB (T0340)A48.CB 3.7441 6.2402 8.1123 107.0345 Constraint (T0340)V35.CB (T0340)R47.CB 4.1948 6.9913 9.0888 107.0345 Constraint (T0340)I32.CB (T0340)L52.CB 4.0464 6.7440 8.7672 107.0345 Constraint (T0340)I32.CB (T0340)Q49.CB 4.0879 6.8131 8.8570 107.0345 Constraint (T0340)I32.CB (T0340)A48.CB 3.4278 5.7130 7.4268 107.0345 Constraint (T0340)I32.CB (T0340)R47.CB 4.2262 7.0436 9.1567 107.0345 Constraint (T0340)Y31.CB (T0340)I53.CB 6.5034 10.8389 14.0906 107.0345 Constraint (T0340)Y31.CB (T0340)L52.CB 4.3830 7.3050 9.4965 107.0345 Constraint (T0340)Y31.CB (T0340)Q49.CB 4.0238 6.7063 8.7181 107.0345 Constraint (T0340)Y31.CB (T0340)A48.CB 4.9807 8.3012 10.7915 107.0345 Constraint (T0340)V55.CB (T0340)R80.CB 4.4631 7.4385 9.6700 106.0609 Constraint (T0340)V35.CB (T0340)D50.CB 5.5940 9.3233 12.1202 106.0345 Constraint (T0340)S34.CB (T0340)Q49.CB 6.1709 10.2848 13.3702 106.0345 Constraint (T0340)S34.CB (T0340)A48.CB 3.7344 6.2240 8.0912 106.0345 Constraint (T0340)R33.CB (T0340)D50.CB 5.9375 9.8959 12.8647 106.0345 Constraint (T0340)R33.CB (T0340)Q49.CB 5.1051 8.5085 11.0610 106.0345 Constraint (T0340)R33.CB (T0340)A48.CB 3.8939 6.4898 8.4368 106.0345 Constraint (T0340)I32.CB (T0340)R51.CB 4.6835 7.8059 10.1477 106.0345 Constraint (T0340)I32.CB (T0340)D50.CB 2.8679 4.7799 6.2138 106.0345 Constraint (T0340)Y31.CB (T0340)R51.CB 3.3007 5.5011 7.1514 106.0345 Constraint (T0340)Y31.CB (T0340)D50.CB 4.1839 6.9732 9.0651 106.0345 Constraint (T0340)V55.CB (T0340)A79.CB 3.9868 6.6447 8.6381 105.0610 Constraint (T0340)E54.CB (T0340)R80.CB 4.8029 8.0048 10.4062 105.0610 Constraint (T0340)N56.CB (T0340)I72.CB 5.5733 9.2888 12.0755 105.0345 Constraint (T0340)N56.CB (T0340)S71.CB 4.6250 7.7083 10.0207 105.0345 Constraint (T0340)N56.CB (T0340)R80.CB 3.3299 5.5499 7.2149 104.1609 Constraint (T0340)N56.CB (T0340)A79.CB 3.7520 6.2534 8.1294 104.1609 Constraint (T0340)E54.CB (T0340)A79.CB 6.3840 10.6400 13.8320 104.0611 Constraint (T0340)L52.CB (T0340)V68.CB 4.2033 7.0055 9.1072 104.0348 Constraint (T0340)Q58.CB (T0340)S71.CB 3.8366 6.3943 8.3126 104.0348 Constraint (T0340)Q58.CB (T0340)V68.CB 5.6154 9.3589 12.1666 104.0348 Constraint (T0340)Q58.CB (T0340)E67.CB 5.7147 9.5245 12.3819 104.0348 Constraint (T0340)V35.CB (T0340)L46.CB 3.5887 5.9812 7.7755 104.0348 Constraint (T0340)I32.CB (T0340)L46.CB 3.6783 6.1304 7.9696 104.0348 Constraint (T0340)D36.CB (T0340)A48.CB 6.6448 11.0747 14.3971 104.0346 Constraint (T0340)V60.CB (T0340)I72.CB 5.6467 9.4112 12.2346 104.0345 Constraint (T0340)V60.CB (T0340)S71.CB 4.3833 7.3056 9.4972 104.0345 Constraint (T0340)V60.CB (T0340)V69.CB 6.2023 10.3372 13.4384 104.0345 Constraint (T0340)V55.CB (T0340)V69.CB 6.2475 10.4125 13.5362 104.0345 Constraint (T0340)R33.CB (T0340)L52.CB 6.5882 10.9803 14.2744 103.4136 Constraint (T0340)P40.CB (T0340)A79.CB 5.3586 8.9311 11.6104 103.1612 Constraint (T0340)S34.CB (T0340)R47.CB 6.1378 10.2297 13.2986 103.0359 Constraint (T0340)S34.CB (T0340)L46.CB 6.2675 10.4458 13.5796 103.0348 Constraint (T0340)L52.CB (T0340)E61.CB 5.6659 9.4432 12.2762 103.0345 Constraint (T0340)E54.CB (T0340)V84.CB 5.9731 9.9551 12.9417 102.8610 Constraint (T0340)I53.CB (T0340)V84.CB 3.4769 5.7949 7.5333 102.8610 Constraint (T0340)L52.CB (T0340)V84.CB 4.9752 8.2920 10.7797 102.8610 Constraint (T0340)Y31.CB (T0340)R47.CB 6.3459 10.5765 13.7494 102.2918 Constraint (T0340)Q58.CB (T0340)R80.CB 6.1921 10.3202 13.4163 102.0613 Constraint (T0340)I32.CB (T0340)A41.CB 4.7146 7.8577 10.2150 102.0359 Constraint (T0340)N59.CB (T0340)V68.CB 6.2828 10.4713 13.6127 102.0348 Constraint (T0340)Y31.CB (T0340)V84.CB 5.9315 9.8858 12.8516 101.8611 Constraint (T0340)R51.CB (T0340)V84.CB 2.8837 4.8062 6.2481 101.8610 Constraint (T0340)V55.CB (T0340)K73.CB 6.4165 10.6941 13.9024 101.0403 Constraint (T0340)L52.CB (T0340)S71.CB 5.8897 9.8162 12.7611 101.0362 Constraint (T0340)A41.CB (T0340)D50.CB 5.9028 9.8379 12.7893 101.0359 Constraint (T0340)R51.CB (T0340)V60.CB 5.4603 9.1005 11.8306 101.0349 Constraint (T0340)V55.CB (T0340)A70.CB 6.1293 10.2155 13.2801 101.0348 Constraint (T0340)D36.CB (T0340)L46.CB 6.2802 10.4670 13.6071 101.0348 Constraint (T0340)I53.CB (T0340)V68.CB 6.4422 10.7369 13.9580 101.0348 Constraint (T0340)Q30.CB (T0340)V69.CB 5.4572 9.0954 11.8240 101.0345 Constraint (T0340)Q30.CB (T0340)V68.CB 3.1487 5.2479 6.8223 101.0345 Constraint (T0340)Q30.CB (T0340)V55.CB 5.5397 9.2328 12.0026 101.0345 Constraint (T0340)Q30.CB (T0340)I53.CB 5.0650 8.4417 10.9742 101.0345 Constraint (T0340)Q30.CB (T0340)L52.CB 2.8466 4.7444 6.1677 101.0345 Constraint (T0340)V55.CB (T0340)V83.CB 6.0981 10.1635 13.2125 100.8612 Constraint (T0340)E54.CB (T0340)V83.CB 5.2304 8.7173 11.3324 100.8612 Constraint (T0340)I53.CB (T0340)V83.CB 4.0699 6.7831 8.8181 100.8612 Constraint (T0340)L52.CB (T0340)V83.CB 3.5291 5.8818 7.6464 100.8612 Constraint (T0340)I32.CB (T0340)V83.CB 4.6769 7.7949 10.1333 100.8612 Constraint (T0340)D50.CB (T0340)V84.CB 4.1332 6.8887 8.9553 100.8611 Constraint (T0340)L52.CB (T0340)R80.CB 6.6612 11.1019 14.4325 100.0612 Constraint (T0340)L52.CB (T0340)A79.CB 6.3705 10.6175 13.8027 100.0611 Constraint (T0340)R33.CB (T0340)R47.CB 6.5022 10.8370 14.0881 100.0346 Constraint (T0340)Q30.CB (T0340)R51.CB 4.1122 6.8536 8.9097 100.0345 Constraint (T0340)R47.CB (T0340)V83.CB 5.1516 8.5860 11.1618 99.8613 Constraint (T0340)Y31.CB (T0340)V83.CB 5.8609 9.7682 12.6987 99.8613 Constraint (T0340)R51.CB (T0340)V83.CB 3.8722 6.4536 8.3897 99.8612 Constraint (T0340)R33.CB (T0340)L46.CB 6.7780 11.2966 14.6856 99.7351 Constraint (T0340)N56.CB (T0340)E78.CB 5.0631 8.4386 10.9702 99.0611 Constraint (T0340)V55.CB (T0340)E67.CB 5.9622 9.9370 12.9181 99.0348 Constraint (T0340)Y31.CB (T0340)H65.CB 5.9831 9.9719 12.9634 98.9184 Constraint (T0340)Q30.CB (T0340)H65.CB 4.0426 6.7376 8.7589 98.9127 Constraint (T0340)I32.CB (T0340)V84.CB 6.4362 10.7270 13.9451 98.8624 Constraint (T0340)D50.CB (T0340)V83.CB 2.6627 4.4378 5.7691 98.8613 Constraint (T0340)V55.CB (T0340)R75.CB 4.2624 7.1041 9.2353 98.7064 Constraint (T0340)I72.CB (T0340)L81.CB 5.4272 9.0453 11.7589 98.1609 Constraint (T0340)N56.CB (T0340)L81.CB 4.8143 8.0238 10.4309 98.1609 Constraint (T0340)V55.CB (T0340)L81.CB 3.5004 5.8340 7.5842 98.1609 Constraint (T0340)E54.CB (T0340)L81.CB 4.2106 7.0176 9.1229 98.1609 Constraint (T0340)L52.CB (T0340)L81.CB 3.6413 6.0689 7.8895 98.1609 Constraint (T0340)V35.CB (T0340)S44.CB 5.7493 9.5822 12.4569 98.0362 Constraint (T0340)Q30.CB (T0340)S71.CB 6.0514 10.0856 13.1113 98.0348 Constraint (T0340)Q30.CB (T0340)E54.CB 6.1162 10.1936 13.2517 98.0346 Constraint (T0340)Y31.CB (T0340)V60.CB 6.4308 10.7180 13.9334 98.0345 Constraint (T0340)Q30.CB (T0340)V60.CB 3.2977 5.4962 7.1451 98.0345 Constraint (T0340)H22.CB (T0340)H65.CB 4.6612 7.7686 10.0992 97.9918 Constraint (T0340)H22.CB (T0340)L52.CB 6.1773 10.2954 13.3841 97.9918 Constraint (T0340)H22.CB (T0340)A48.CB 5.9742 9.9569 12.9440 97.9918 Constraint (T0340)H22.CB (T0340)S34.CB 5.3161 8.8602 11.5183 97.9918 Constraint (T0340)H22.CB (T0340)R33.CB 2.6417 4.4029 5.7237 97.9918 Constraint (T0340)H22.CB (T0340)I32.CB 4.7266 7.8777 10.2410 97.9918 Constraint (T0340)H22.CB (T0340)Y31.CB 3.1445 5.2408 6.8131 97.9918 Constraint (T0340)I32.CB (T0340)A42.CB 6.6089 11.0149 14.3193 97.9140 Constraint (T0340)Q49.CB (T0340)V83.CB 5.8713 9.7855 12.7212 97.8615 Constraint (T0340)L46.CB (T0340)V83.CB 4.1425 6.9041 8.9753 97.8615 Constraint (T0340)Q30.CB (T0340)I72.CB 5.7717 9.6194 12.5052 97.7348 Constraint (T0340)V55.CB (T0340)A74.CB 5.8246 9.7077 12.6200 97.4139 Constraint (T0340)I53.CB (T0340)L81.CB 5.0572 8.4287 10.9573 97.0610 Constraint (T0340)Y31.CB (T0340)V68.CB 6.1799 10.2998 13.3897 97.0406 Constraint (T0340)Q30.CB (T0340)D50.CB 5.7172 9.5287 12.3874 97.0349 Constraint (T0340)R33.CB (T0340)R51.CB 6.6793 11.1321 14.4717 97.0349 Constraint (T0340)Q30.CB (T0340)E61.CB 5.1402 8.5670 11.1371 97.0345 Constraint (T0340)L21.CB (T0340)I72.CB 4.6732 7.7886 10.1252 96.9918 Constraint (T0340)L21.CB (T0340)V69.CB 4.3294 7.2157 9.3804 96.9918 Constraint (T0340)L21.CB (T0340)V68.CB 3.9776 6.6293 8.6181 96.9918 Constraint (T0340)L21.CB (T0340)L52.CB 4.0967 6.8278 8.8761 96.9918 Constraint (T0340)L21.CB (T0340)D50.CB 5.8889 9.8148 12.7592 96.9918 Constraint (T0340)L21.CB (T0340)A48.CB 6.3562 10.5937 13.7718 96.9918 Constraint (T0340)L21.CB (T0340)V35.CB 6.4025 10.6708 13.8720 96.9918 Constraint (T0340)L21.CB (T0340)S34.CB 5.3931 8.9885 11.6851 96.9918 Constraint (T0340)L21.CB (T0340)R33.CB 3.7317 6.2195 8.0854 96.9918 Constraint (T0340)L21.CB (T0340)I32.CB 3.5891 5.9818 7.7764 96.9918 Constraint (T0340)L21.CB (T0340)Y31.CB 3.9502 6.5837 8.5588 96.9918 Constraint (T0340)A41.CB (T0340)A79.CB 5.8328 9.7214 12.6378 96.9405 Constraint (T0340)Q49.CB (T0340)V84.CB 5.9290 9.8817 12.8462 96.8626 Constraint (T0340)R51.CB (T0340)E61.CB 5.5869 9.3116 12.1051 96.7349 Constraint (T0340)N56.CB (T0340)R75.CB 3.6917 6.1528 7.9987 96.7064 Constraint (T0340)I32.CB (T0340)L81.CB 5.6115 9.3526 12.1583 96.0611 Constraint (T0340)N56.CB (T0340)L82.CB 5.6458 9.4097 12.2326 96.0611 Constraint (T0340)V55.CB (T0340)L82.CB 4.7191 7.8651 10.2247 96.0611 Constraint (T0340)E54.CB (T0340)L82.CB 2.4659 4.1099 5.3428 96.0611 Constraint (T0340)I53.CB (T0340)L82.CB 2.9916 4.9859 6.4817 96.0611 Constraint (T0340)N59.CB (T0340)S71.CB 6.1630 10.2717 13.3532 96.0406 Constraint (T0340)A41.CB (T0340)L52.CB 6.5991 10.9985 14.2980 96.0359 Constraint (T0340)Q58.CB (T0340)I72.CB 6.1015 10.1692 13.2199 95.9921 Constraint (T0340)Y31.CB (T0340)L46.CB 6.7009 11.1681 14.5185 95.9921 Constraint (T0340)H22.CB (T0340)Q49.CB 6.1309 10.2181 13.2835 95.9919 Constraint (T0340)L21.CB (T0340)H65.CB 4.3713 7.2854 9.4711 95.9919 Constraint (T0340)L21.CB (T0340)R51.CB 5.9449 9.9082 12.8807 95.9919 Constraint (T0340)F19.CB (T0340)D36.CB 4.0416 6.7359 8.7567 95.9918 Constraint (T0340)F19.CB (T0340)V35.CB 3.1150 5.1917 6.7492 95.9918 Constraint (T0340)F19.CB (T0340)S34.CB 4.0809 6.8014 8.8418 95.9918 Constraint (T0340)F19.CB (T0340)I32.CB 3.2462 5.4103 7.0334 95.9918 Constraint (T0340)N56.CB (T0340)A74.CB 5.6367 9.3945 12.2128 95.2975 Constraint (T0340)V60.CB (T0340)L81.CB 5.5400 9.2333 12.0033 95.1611 Constraint (T0340)I53.CB (T0340)L63.CB 6.2690 10.4483 13.5827 95.1140 Constraint (T0340)S44.CB (T0340)A79.CB 6.1722 10.2870 13.3731 95.0626 Constraint (T0340)Q58.CB (T0340)A79.CB 6.6181 11.0301 14.3391 95.0614 Constraint (T0340)L52.CB (T0340)L82.CB 4.4626 7.4377 9.6690 95.0612 Constraint (T0340)R51.CB (T0340)L81.CB 6.2401 10.4001 13.5201 95.0611 Constraint (T0340)L52.CB (T0340)V69.CB 6.5450 10.9084 14.1809 95.0351 Constraint (T0340)F19.CB (T0340)L52.CB 5.5683 9.2805 12.0646 94.9919 Constraint (T0340)F19.CB (T0340)D50.CB 5.5010 9.1683 11.9188 94.9919 Constraint (T0340)F19.CB (T0340)A48.CB 5.2379 8.7298 11.3487 94.9919 Constraint (T0340)F19.CB (T0340)R47.CB 5.8409 9.7349 12.6553 94.9919 Constraint (T0340)F19.CB (T0340)R33.CB 4.7453 7.9088 10.2814 94.9919 Constraint (T0340)F19.CB (T0340)Y31.CB 6.1649 10.2748 13.3573 94.9919 Constraint (T0340)Y17.CB (T0340)A79.CB 3.9024 6.5040 8.4552 94.9919 Constraint (T0340)Y17.CB (T0340)I72.CB 4.2543 7.0906 9.2178 94.9919 Constraint (T0340)Y17.CB (T0340)D36.CB 5.2083 8.6805 11.2846 94.9919 Constraint (T0340)Y17.CB (T0340)V35.CB 5.6454 9.4090 12.2317 94.9919 Constraint (T0340)Y17.CB (T0340)I32.CB 6.0706 10.1176 13.1529 94.9919 Constraint (T0340)N20.CB (T0340)D36.CB 4.7408 7.9013 10.2717 94.9918 Constraint (T0340)N20.CB (T0340)V35.CB 4.7273 7.8789 10.2425 94.9918 Constraint (T0340)N20.CB (T0340)S34.CB 2.7001 4.5001 5.8502 94.9918 Constraint (T0340)N20.CB (T0340)I32.CB 4.2659 7.1098 9.2427 94.9918 Constraint (T0340)A41.CB (T0340)V83.CB 6.3032 10.5054 13.6570 94.8625 Constraint (T0340)V60.CB (T0340)V83.CB 6.2581 10.4301 13.5591 94.8614 Constraint (T0340)Q30.CB (T0340)V83.CB 6.0198 10.0330 13.0430 94.8612 Constraint (T0340)I53.CB (T0340)R80.CB 6.8623 11.4372 14.8684 94.1920 Constraint (T0340)A41.CB (T0340)L81.CB 5.4304 9.0506 11.7658 94.1623 Constraint (T0340)L46.CB (T0340)L81.CB 4.5835 7.6392 9.9310 94.0613 Constraint (T0340)V60.CB (T0340)L82.CB 5.3761 8.9602 11.6483 94.0612 Constraint (T0340)R51.CB (T0340)L82.CB 5.7511 9.5852 12.4608 94.0612 Constraint (T0340)S34.CB (T0340)D50.CB 6.7314 11.2190 14.5848 94.0359 Constraint (T0340)L21.CB (T0340)S71.CB 6.4625 10.7708 14.0020 93.9921 Constraint (T0340)L21.CB (T0340)V55.CB 6.1988 10.3313 13.4307 93.9921 Constraint (T0340)L21.CB (T0340)L46.CB 6.4774 10.7956 14.0343 93.9921 Constraint (T0340)L21.CB (T0340)V60.CB 5.6900 9.4833 12.3283 93.9919 Constraint (T0340)N20.CB (T0340)V69.CB 6.0831 10.1385 13.1800 93.9919 Constraint (T0340)N20.CB (T0340)A48.CB 5.4725 9.1208 11.8570 93.9919 Constraint (T0340)N20.CB (T0340)R33.CB 2.7926 4.6543 6.0506 93.9919 Constraint (T0340)N20.CB (T0340)Y31.CB 5.7146 9.5244 12.3817 93.9919 Constraint (T0340)Q30.CB (T0340)V84.CB 6.4155 10.6925 13.9002 93.8623 Constraint (T0340)Q58.CB (T0340)L82.CB 6.0351 10.0584 13.0760 93.0614 Constraint (T0340)D50.CB (T0340)L81.CB 5.2262 8.7103 11.3233 93.0613 Constraint (T0340)Q30.CB (T0340)N59.CB 6.4278 10.7130 13.9269 93.0349 Constraint (T0340)H22.CB (T0340)V68.CB 6.1230 10.2050 13.2666 92.9975 Constraint (T0340)F19.CB (T0340)A41.CB 2.6630 4.4383 5.7698 92.9931 Constraint (T0340)H22.CB (T0340)R51.CB 6.1904 10.3173 13.4125 92.9922 Constraint (T0340)R47.CB (T0340)V84.CB 6.7205 11.2008 14.5610 92.9922 Constraint (T0340)F19.CB (T0340)I72.CB 5.3532 8.9220 11.5985 92.9921 Constraint (T0340)E54.CB (T0340)L63.CB 6.0801 10.1335 13.1735 92.9921 Constraint (T0340)F19.CB (T0340)L46.CB 3.7946 6.3243 8.2215 92.9921 Constraint (T0340)F19.CB (T0340)P40.CB 5.0273 8.3788 10.8924 92.9921 Constraint (T0340)F19.CB (T0340)S39.CB 4.3376 7.2293 9.3980 92.9921 Constraint (T0340)Y17.CB (T0340)R75.CB 5.2871 8.8119 11.4554 92.9920 Constraint (T0340)L52.CB (T0340)H65.CB 6.3631 10.6052 13.7868 92.9143 Constraint (T0340)A48.CB (T0340)V83.CB 6.7459 11.2432 14.6161 92.7396 Constraint (T0340)L52.CB (T0340)L63.CB 5.6157 9.3595 12.1673 92.1143 Constraint (T0340)N59.CB (T0340)L82.CB 5.3500 8.9166 11.5916 92.0615 Constraint (T0340)D50.CB (T0340)L82.CB 5.9918 9.9863 12.9823 92.0614 Constraint (T0340)Q30.CB (T0340)E67.CB 5.4706 9.1176 11.8529 92.0406 Constraint (T0340)Q30.CB (T0340)A66.CB 6.2781 10.4635 13.6026 92.0406 Constraint (T0340)V60.CB (T0340)A70.CB 6.3763 10.6272 13.8154 92.0406 Constraint (T0340)S23.CB (T0340)V68.CB 4.9779 8.2965 10.7855 91.9978 Constraint (T0340)S23.CB (T0340)H65.CB 3.3986 5.6643 7.3635 91.9978 Constraint (T0340)S23.CB (T0340)L52.CB 5.7445 9.5741 12.4464 91.9978 Constraint (T0340)S23.CB (T0340)R33.CB 5.3245 8.8741 11.5363 91.9978 Constraint (T0340)S23.CB (T0340)I32.CB 6.1823 10.3038 13.3949 91.9978 Constraint (T0340)Y17.CB (T0340)A41.CB 3.2295 5.3824 6.9972 91.9932 Constraint (T0340)N20.CB (T0340)A41.CB 5.7508 9.5846 12.4600 91.9931 Constraint (T0340)F19.CB (T0340)A42.CB 4.9835 8.3059 10.7976 91.9931 Constraint (T0340)Y17.CB (T0340)L46.CB 5.2478 8.7463 11.3702 91.9922 Constraint (T0340)Y17.CB (T0340)P40.CB 3.1422 5.2370 6.8081 91.9922 Constraint (T0340)Y17.CB (T0340)S39.CB 4.1809 6.9682 9.0586 91.9922 Constraint (T0340)Q58.CB (T0340)R75.CB 5.7823 9.6372 12.5283 91.9921 Constraint (T0340)F19.CB (T0340)P37.CB 6.5831 10.9718 14.2634 91.9919 Constraint (T0340)L21.CB (T0340)Q30.CB 3.2039 5.3398 6.9417 91.9918 Constraint (T0340)Q58.CB (T0340)L81.CB 6.3611 10.6018 13.7823 91.9612 Constraint (T0340)V55.CB (T0340)E78.CB 6.7192 11.1986 14.5582 91.7392 Constraint (T0340)S44.CB (T0340)L81.CB 5.6730 9.4550 12.2915 91.1625 Constraint (T0340)Y17.CB (T0340)A42.CB 5.8955 9.8258 12.7735 90.9932 Constraint (T0340)Y17.CB (T0340)K73.CB 5.7806 9.6344 12.5247 90.9919 Constraint (T0340)P40.CB (T0340)E78.CB 6.1191 10.1985 13.2580 90.1670 Constraint (T0340)Q30.CB (T0340)L81.CB 6.2093 10.3488 13.4534 90.0611 Constraint (T0340)I32.CB (T0340)V68.CB 6.4632 10.7721 14.0037 90.0407 Constraint (T0340)S23.CB (T0340)R64.CB 5.4204 9.0339 11.7441 89.9978 Constraint (T0340)S23.CB (T0340)L63.CB 5.8479 9.7465 12.6704 89.9978 Constraint (T0340)L21.CB (T0340)A66.CB 6.4639 10.7732 14.0052 89.9976 Constraint (T0340)R11.CB (T0340)R80.CB 6.1265 10.2109 13.2742 89.9921 Constraint (T0340)R11.CB (T0340)A79.CB 4.5875 7.6458 9.9396 89.9921 Constraint (T0340)R11.CB (T0340)P40.CB 3.9580 6.5967 8.5757 89.9921 Constraint (T0340)L10.CB (T0340)R80.CB 4.6204 7.7007 10.0109 89.9921 Constraint (T0340)L10.CB (T0340)A79.CB 2.9534 4.9223 6.3989 89.9921 Constraint (T0340)L10.CB (T0340)L46.CB 4.7865 7.9776 10.3708 89.9921 Constraint (T0340)L10.CB (T0340)P40.CB 3.1320 5.2199 6.7859 89.9921 Constraint (T0340)F19.CB (T0340)L81.CB 5.6777 9.4629 12.3017 89.9918 Constraint (T0340)Q30.CB (T0340)L63.CB 4.3089 7.1815 9.3359 89.1140 Constraint (T0340)I32.CB (T0340)I53.CB 6.9487 11.5812 15.0555 89.0404 Constraint (T0340)F19.CB (T0340)A79.CB 6.2240 10.3733 13.4852 88.9979 Constraint (T0340)S23.CB (T0340)A66.CB 6.3031 10.5051 13.6566 88.9978 Constraint (T0340)Y17.CB (T0340)V55.CB 6.1011 10.1685 13.2190 88.9976 Constraint (T0340)L21.CB (T0340)A41.CB 6.3704 10.6173 13.8025 88.9931 Constraint (T0340)H22.CB (T0340)D50.CB 6.6631 11.1052 14.4368 88.9921 Constraint (T0340)N20.CB (T0340)L46.CB 6.5927 10.9878 14.2842 88.9921 Constraint (T0340)L10.CB (T0340)R75.CB 5.6491 9.4151 12.2396 88.9921 Constraint (T0340)L10.CB (T0340)V55.CB 6.1576 10.2626 13.3414 88.9921 Constraint (T0340)L10.CB (T0340)S39.CB 5.5416 9.2360 12.0068 88.9921 Constraint (T0340)N20.CB (T0340)Q30.CB 6.4188 10.6981 13.9075 88.9919 Constraint (T0340)Y17.CB (T0340)L81.CB 5.2540 8.7567 11.3837 88.9919 Constraint (T0340)H22.CB (T0340)V69.CB 6.3918 10.6530 13.8489 88.9918 Constraint (T0340)L46.CB (T0340)A79.CB 6.4768 10.7946 14.0330 88.1923 Constraint (T0340)F19.CB (T0340)V83.CB 6.3747 10.6245 13.8118 87.9980 Constraint (T0340)N20.CB (T0340)L52.CB 6.8424 11.4041 14.8253 87.9979 Constraint (T0340)F19.CB (T0340)S44.CB 6.0491 10.0818 13.1063 87.9934 Constraint (T0340)L10.CB (T0340)N56.CB 6.3340 10.5566 13.7236 87.9921 Constraint (T0340)L10.CB (T0340)A41.CB 3.8783 6.4638 8.4030 87.9921 Constraint (T0340)H9.CB (T0340)R80.CB 3.0357 5.0596 6.5774 87.9921 Constraint (T0340)H9.CB (T0340)A79.CB 4.3285 7.2141 9.3784 87.9921 Constraint (T0340)H9.CB (T0340)N56.CB 5.9763 9.9604 12.9486 87.9921 Constraint (T0340)C8.CB (T0340)R80.CB 4.3068 7.1780 9.3314 87.9921 Constraint (T0340)C8.CB (T0340)V55.CB 6.3147 10.5245 13.6818 87.9921 Constraint (T0340)C8.CB (T0340)E54.CB 6.3331 10.5552 13.7218 87.9921 Constraint (T0340)C8.CB (T0340)L52.CB 5.8600 9.7667 12.6967 87.9921 Constraint (T0340)C8.CB (T0340)L46.CB 3.7235 6.2058 8.0676 87.9921 Constraint (T0340)L7.CB (T0340)E54.CB 5.2466 8.7443 11.3676 87.9921 Constraint (T0340)L7.CB (T0340)I53.CB 6.0310 10.0517 13.0672 87.9921 Constraint (T0340)R6.CB (T0340)I53.CB 6.0079 10.0131 13.0171 87.9921 Constraint (T0340)S71.CB (T0340)L81.CB 6.1757 10.2929 13.3808 87.1624 Constraint (T0340)A41.CB (T0340)I72.CB 6.4924 10.8207 14.0669 87.0363 Constraint (T0340)Y17.CB (T0340)S44.CB 5.5630 9.2716 12.0531 86.9935 Constraint (T0340)C8.CB (T0340)A79.CB 5.1587 8.5979 11.1773 86.9922 Constraint (T0340)L7.CB (T0340)R80.CB 3.8807 6.4678 8.4082 86.9922 Constraint (T0340)L7.CB (T0340)A79.CB 6.6896 11.1493 14.4941 86.9922 Constraint (T0340)L10.CB (T0340)F19.CB 5.3182 8.8637 11.5227 86.9921 Constraint (T0340)C8.CB (T0340)D50.CB 5.4171 9.0284 11.7369 86.9921 Constraint (T0340)C8.CB (T0340)I32.CB 6.3968 10.6613 13.8596 86.9921 Constraint (T0340)L7.CB (T0340)V55.CB 6.7223 11.2038 14.5650 86.9921 Constraint (T0340)R11.CB (T0340)E78.CB 3.3902 5.6503 7.3454 86.9921 Constraint (T0340)L10.CB (T0340)R43.CB 5.2945 8.8241 11.4714 86.9921 Constraint (T0340)L21.CB (T0340)L81.CB 6.3687 10.6145 13.7988 86.9920 Constraint (T0340)L63.CB (T0340)I72.CB 6.3353 10.5589 13.7265 86.1197 Constraint (T0340)S23.CB (T0340)R51.CB 5.6498 9.4163 12.2411 85.9981 Constraint (T0340)Y17.CB (T0340)R43.CB 6.2036 10.3393 13.4411 85.9935 Constraint (T0340)N20.CB (T0340)I72.CB 6.3393 10.5654 13.7351 85.9924 Constraint (T0340)F19.CB (T0340)Q30.CB 6.4996 10.8326 14.0824 85.9922 Constraint (T0340)L10.CB (T0340)E78.CB 4.2746 7.1243 9.2616 85.9922 Constraint (T0340)R11.CB (T0340)R75.CB 6.3769 10.6282 13.8167 85.9921 Constraint (T0340)L10.CB (T0340)A42.CB 6.1385 10.2308 13.3000 85.9921 Constraint (T0340)H9.CB (T0340)L46.CB 6.4763 10.7938 14.0320 85.9921 Constraint (T0340)C8.CB (T0340)S44.CB 3.7510 6.2517 8.1272 85.9921 Constraint (T0340)Q30.CB (T0340)R64.CB 5.5005 9.1675 11.9177 85.2924 Constraint (T0340)R51.CB (T0340)V68.CB 6.5679 10.9465 14.2304 85.0409 Constraint (T0340)C8.CB (T0340)I53.CB 6.7109 11.1849 14.5404 84.9934 Constraint (T0340)R6.CB (T0340)E54.CB 6.7001 11.1669 14.5169 84.9934 Constraint (T0340)L10.CB (T0340)S44.CB 3.5170 5.8617 7.6202 84.9934 Constraint (T0340)R6.CB (T0340)D50.CB 5.0894 8.4824 11.0271 84.9924 Constraint (T0340)R6.CB (T0340)L46.CB 5.5261 9.2102 11.9732 84.9924 Constraint (T0340)L10.CB (T0340)V83.CB 6.6503 11.0839 14.4090 84.9924 Constraint (T0340)C8.CB (T0340)V83.CB 3.7324 6.2207 8.0869 84.9924 Constraint (T0340)L7.CB (T0340)V84.CB 6.5158 10.8597 14.1176 84.9922 Constraint (T0340)R6.CB (T0340)V84.CB 4.6854 7.8090 10.1517 84.9922 Constraint (T0340)H9.CB (T0340)S44.CB 4.6953 7.8254 10.1731 84.9921 Constraint (T0340)K12.CB (T0340)P40.CB 3.8318 6.3863 8.3022 84.9921 Constraint (T0340)D24.CB (T0340)H65.CB 3.7986 6.3309 8.2302 84.7451 Constraint (T0340)F19.CB (T0340)Q49.CB 6.9198 11.5331 14.9930 83.9978 Constraint (T0340)C8.CB (T0340)A41.CB 5.0487 8.4145 10.9389 83.9934 Constraint (T0340)R11.CB (T0340)S44.CB 5.3216 8.8693 11.5302 83.9934 Constraint (T0340)Q58.CB (T0340)A70.CB 6.3090 10.5150 13.6695 83.9923 Constraint (T0340)H9.CB (T0340)E78.CB 3.7818 6.3030 8.1940 83.9922 Constraint (T0340)R11.CB (T0340)E76.CB 5.7517 9.5862 12.4620 83.9922 Constraint (T0340)N20.CB (T0340)S39.CB 6.1713 10.2855 13.3711 82.9937 Constraint (T0340)N56.CB (T0340)E76.CB 5.3893 8.9822 11.6769 82.9924 Constraint (T0340)R6.CB (T0340)R80.CB 6.5825 10.9708 14.2620 82.9924 Constraint (T0340)L7.CB (T0340)V83.CB 4.7270 7.8783 10.2418 82.9924 Constraint (T0340)R6.CB (T0340)V83.CB 3.3261 5.5435 7.2065 82.9924 Constraint (T0340)C8.CB (T0340)E78.CB 6.5299 10.8832 14.1482 82.9923 Constraint (T0340)K12.CB (T0340)A79.CB 4.0866 6.8110 8.8543 82.9921 Constraint (T0340)K12.CB (T0340)R75.CB 4.7757 7.9595 10.3474 82.9921 Constraint (T0340)R6.CB (T0340)L52.CB 6.6717 11.1195 14.4553 82.9921 Constraint (T0340)R6.CB (T0340)R51.CB 6.5071 10.8452 14.0988 82.9921 Constraint (T0340)I32.CB (T0340)I72.CB 6.6113 11.0189 14.3245 82.1143 Constraint (T0340)L7.CB (T0340)N56.CB 6.6118 11.0197 14.3256 81.9924 Constraint (T0340)C8.CB (T0340)R47.CB 6.1225 10.2042 13.2655 81.9924 Constraint (T0340)P5.CB (T0340)R51.CB 5.7556 9.5927 12.4705 81.9924 Constraint (T0340)L10.CB (T0340)D77.CB 5.7330 9.5549 12.4214 81.9922 Constraint (T0340)R11.CB (T0340)D77.CB 3.9867 6.6445 8.6379 81.9921 Constraint (T0340)L10.CB (T0340)L81.CB 4.1659 6.9432 9.0261 81.9921 Constraint (T0340)H9.CB (T0340)L81.CB 4.6344 7.7240 10.0412 81.9921 Constraint (T0340)C8.CB (T0340)L81.CB 3.0123 5.0205 6.5266 81.9921 Constraint (T0340)C8.CB (T0340)N56.CB 6.9219 11.5364 14.9973 81.9921 Constraint (T0340)L21.CB (T0340)Q49.CB 6.8550 11.4249 14.8524 81.9919 Constraint (T0340)R51.CB (T0340)P86.CB 4.5828 7.6380 9.9294 81.8631 Constraint (T0340)C8.CB (T0340)P40.CB 6.0736 10.1227 13.1595 80.9978 Constraint (T0340)C8.CB (T0340)F19.CB 6.3606 10.6009 13.7812 80.9978 Constraint (T0340)F19.CB (T0340)R43.CB 6.7903 11.3172 14.7123 80.9934 Constraint (T0340)P5.CB (T0340)E54.CB 5.6572 9.4287 12.2572 80.9925 Constraint (T0340)P5.CB (T0340)I53.CB 4.2501 7.0836 9.2086 80.9925 Constraint (T0340)L21.CB (T0340)V83.CB 6.6610 11.1017 14.4323 80.9924 Constraint (T0340)L10.CB (T0340)I72.CB 6.0451 10.0751 13.0977 80.9922 Constraint (T0340)K12.CB (T0340)E76.CB 4.7081 7.8468 10.2008 80.9921 Constraint (T0340)H9.CB (T0340)V55.CB 6.7741 11.2902 14.6772 80.9921 Constraint (T0340)K12.CB (T0340)E78.CB 4.6248 7.7079 10.0203 80.9921 Constraint (T0340)R33.CB (T0340)H65.CB 6.3078 10.5130 13.6669 80.9189 Constraint (T0340)V60.CB (T0340)V84.CB 6.6025 11.0042 14.3055 80.8611 Constraint (T0340)C8.CB (T0340)Y17.CB 6.0877 10.1462 13.1901 79.9979 Constraint (T0340)Y17.CB (T0340)R80.CB 6.7204 11.2007 14.5609 79.9979 Constraint (T0340)P5.CB (T0340)V83.CB 4.3159 7.1931 9.3510 79.9924 Constraint (T0340)H9.CB (T0340)L82.CB 6.1707 10.2845 13.3699 79.9923 Constraint (T0340)C8.CB (T0340)L82.CB 4.6067 7.6778 9.9811 79.9923 Constraint (T0340)L7.CB (T0340)L81.CB 4.3928 7.3214 9.5178 79.9921 Constraint (T0340)Q49.CB (T0340)P86.CB 3.9082 6.5136 8.4677 79.8634 Constraint (T0340)D50.CB (T0340)P86.CB 4.6231 7.7051 10.0167 79.8633 Constraint (T0340)P28.CB (T0340)V60.CB 5.8613 9.7688 12.6994 79.7348 Constraint (T0340)P40.CB (T0340)L81.CB 6.4781 10.7969 14.0360 79.1671 Constraint (T0340)N56.CB (T0340)D77.CB 6.1688 10.2813 13.3657 79.0613 Constraint (T0340)K12.CB (T0340)S39.CB 5.8096 9.6826 12.5874 78.9980 Constraint (T0340)Y17.CB (T0340)E78.CB 6.0983 10.1639 13.2130 78.9980 Constraint (T0340)R11.CB (T0340)A41.CB 6.2332 10.3886 13.5052 78.9978 Constraint (T0340)H9.CB (T0340)P40.CB 5.9549 9.9248 12.9023 78.9978 Constraint (T0340)Q58.CB (T0340)A74.CB 6.0068 10.0113 13.0147 78.9978 Constraint (T0340)Y17.CB (T0340)D77.CB 6.2943 10.4905 13.6377 78.9977 Constraint (T0340)P5.CB (T0340)V84.CB 3.1994 5.3324 6.9321 78.9925 Constraint (T0340)H9.CB (T0340)D77.CB 6.4197 10.6995 13.9094 78.9922 Constraint (T0340)R6.CB (T0340)L81.CB 5.2869 8.8115 11.4550 78.9922 Constraint (T0340)K12.CB (T0340)D77.CB 3.6275 6.0458 7.8595 78.9921 Constraint (T0340)L46.CB (T0340)L82.CB 6.7670 11.2783 14.6618 78.9413 Constraint (T0340)P28.CB (T0340)R51.CB 5.6358 9.3930 12.2109 78.7352 Constraint (T0340)K12.CB (T0340)A41.CB 5.9456 9.9094 12.8822 77.9934 Constraint (T0340)P5.CB (T0340)L52.CB 6.6181 11.0301 14.3392 77.9925 Constraint (T0340)L7.CB (T0340)L52.CB 6.9133 11.5222 14.9788 77.9924 Constraint (T0340)L7.CB (T0340)L82.CB 3.2658 5.4429 7.0758 77.9923 Constraint (T0340)R6.CB (T0340)L82.CB 4.4275 7.3792 9.5930 77.9923 Constraint (T0340)P14.CB (T0340)P40.CB 6.0822 10.1369 13.1780 77.9922 Constraint (T0340)R11.CB (T0340)R43.CB 5.5785 9.2975 12.0867 77.9921 Constraint (T0340)R6.CB (T0340)R47.CB 5.9355 9.8926 12.8603 76.9927 Constraint (T0340)P5.CB (T0340)D50.CB 6.1181 10.1969 13.2559 76.9926 Constraint (T0340)V68.CB (T0340)L81.CB 6.0612 10.1020 13.1326 76.1685 Constraint (T0340)C8.CB (T0340)V84.CB 6.7149 11.1915 14.5490 75.9935 Constraint (T0340)K12.CB (T0340)I72.CB 5.9452 9.9087 12.8813 75.9922 Constraint (T0340)E61.CB (T0340)V84.CB 6.0108 10.0179 13.0233 74.9924 Constraint (T0340)H9.CB (T0340)A41.CB 6.5687 10.9479 14.2322 73.9992 Constraint (T0340)H9.CB (T0340)V83.CB 6.7394 11.2323 14.6020 73.9937 Constraint (T0340)Q15.CB (T0340)P40.CB 5.2561 8.7601 11.3881 73.9935 Constraint (T0340)E61.CB (T0340)L82.CB 6.1658 10.2763 13.3592 73.9925 Constraint (T0340)P28.CB (T0340)E61.CB 4.5102 7.5170 9.7721 73.7348 Constraint (T0340)D24.CB (T0340)R51.CB 5.7114 9.5191 12.3748 73.4527 Constraint (T0340)N20.CB (T0340)H65.CB 6.3729 10.6215 13.8080 72.9981 Constraint (T0340)L21.CB (T0340)K73.CB 6.6401 11.0668 14.3869 72.9921 Constraint (T0340)L46.CB (T0340)V84.CB 6.8674 11.4457 14.8794 72.8688 Constraint (T0340)S44.CB (T0340)R80.CB 6.3663 10.6106 13.7937 72.1628 Constraint (T0340)L7.CB (T0340)L46.CB 6.7040 11.1734 14.5254 71.9997 Constraint (T0340)S23.CB (T0340)V69.CB 5.8949 9.8249 12.7723 71.9978 Constraint (T0340)P5.CB (T0340)L82.CB 3.6972 6.1620 8.0106 71.9926 Constraint (T0340)P5.CB (T0340)L81.CB 6.3907 10.6511 13.8464 71.9926 Constraint (T0340)P28.CB (T0340)L63.CB 5.5843 9.3072 12.0993 71.9921 Constraint (T0340)P28.CB (T0340)H65.CB 5.8164 9.6940 12.6022 71.6133 Constraint (T0340)P40.CB (T0340)D77.CB 6.3232 10.5387 13.7003 71.1685 Constraint (T0340)Q30.CB (T0340)L82.CB 6.7470 11.2450 14.6185 71.0613 Constraint (T0340)L21.CB (T0340)E67.CB 6.5771 10.9618 14.2504 70.9981 Constraint (T0340)Y17.CB (T0340)L52.CB 6.4439 10.7398 13.9618 70.9919 Constraint (T0340)E54.CB (T0340)I72.CB 6.7165 11.1942 14.5525 70.1201 Constraint (T0340)L21.CB (T0340)R64.CB 6.6043 11.0071 14.3093 69.9984 Constraint (T0340)L21.CB (T0340)L63.CB 6.2494 10.4156 13.5403 69.9984 Constraint (T0340)R6.CB (T0340)S44.CB 6.2638 10.4396 13.5715 69.9981 Constraint (T0340)N20.CB (T0340)V68.CB 6.7353 11.2256 14.5932 69.9981 Constraint (T0340)S23.CB (T0340)V60.CB 5.6428 9.4047 12.2261 69.9981 Constraint (T0340)L10.CB (T0340)V35.CB 6.5746 10.9577 14.2450 69.9978 Constraint (T0340)S44.CB (T0340)V83.CB 6.1892 10.3153 13.4098 69.8685 Constraint (T0340)Y17.CB (T0340)E76.CB 6.5624 10.9374 14.2186 68.9984 Constraint (T0340)R11.CB (T0340)S39.CB 6.3053 10.5088 13.6615 68.9978 Constraint (T0340)R47.CB (T0340)P86.CB 5.3974 8.9956 11.6943 68.9956 Constraint (T0340)F19.CB (T0340)V69.CB 6.5717 10.9529 14.2388 68.9923 Constraint (T0340)L52.CB (T0340)E67.CB 6.5924 10.9874 14.2836 68.7423 Constraint (T0340)P28.CB (T0340)R64.CB 5.9089 9.8481 12.8026 67.9924 Constraint (T0340)K12.CB (T0340)K73.CB 6.1715 10.2858 13.3716 67.9922 Constraint (T0340)D24.CB (T0340)V68.CB 4.7582 7.9303 10.3094 67.7454 Constraint (T0340)R27.CB (T0340)E61.CB 5.2476 8.7460 11.3698 67.7406 Constraint (T0340)H9.CB (T0340)R75.CB 6.6693 11.1154 14.4501 66.9983 Constraint (T0340)D24.CB (T0340)L52.CB 5.8469 9.7448 12.6682 66.7467 Constraint (T0340)D24.CB (T0340)R33.CB 6.2425 10.4042 13.5255 66.7454 Constraint (T0340)D24.CB (T0340)R64.CB 4.3973 7.3288 9.5275 65.9978 Constraint (T0340)Y17.CB (T0340)V69.CB 6.5175 10.8624 14.1212 64.9923 Constraint (T0340)L7.CB (T0340)S44.CB 6.3645 10.6075 13.7897 63.9995 Constraint (T0340)Y31.CB (T0340)P86.CB 5.4047 9.0079 11.7102 63.9955 Constraint (T0340)L10.CB (T0340)E76.CB 6.3722 10.6203 13.8064 63.9931 Constraint (T0340)C8.CB (T0340)R43.CB 6.3431 10.5719 13.7435 62.9981 Constraint (T0340)S23.CB (T0340)E67.CB 6.4277 10.7128 13.9266 62.9980 Constraint (T0340)Q15.CB (T0340)S39.CB 5.0057 8.3429 10.8458 62.9963 Constraint (T0340)P14.CB (T0340)D77.CB 5.2004 8.6673 11.2674 62.9954 Constraint (T0340)F19.CB (T0340)V68.CB 6.6268 11.0446 14.3580 61.9994 Constraint (T0340)R4.CB (T0340)V84.CB 4.4520 7.4201 9.6461 61.9982 Constraint (T0340)D24.CB (T0340)L63.CB 4.9025 8.1708 10.6221 61.9978 Constraint (T0340)V35.CB (T0340)V83.CB 6.8915 11.4858 14.9315 61.8687 Constraint (T0340)R4.CB (T0340)V83.CB 5.7911 9.6518 12.5474 60.9983 Constraint (T0340)Q15.CB (T0340)D36.CB 5.6618 9.4363 12.2672 60.9979 Constraint (T0340)L10.CB (T0340)I32.CB 6.8953 11.4922 14.9399 60.9978 Constraint (T0340)N56.CB (T0340)V68.CB 6.5607 10.9345 14.2149 60.9202 Constraint (T0340)K25.CB (T0340)H65.CB 4.6268 7.7113 10.0247 60.7453 Constraint (T0340)R27.CB (T0340)R51.CB 5.9638 9.9396 12.9215 60.7409 Constraint (T0340)Q30.CB (T0340)A70.CB 6.9388 11.5647 15.0341 60.7409 Constraint (T0340)N20.CB (T0340)D50.CB 6.9159 11.5264 14.9844 59.9996 Constraint (T0340)D24.CB (T0340)E61.CB 6.1799 10.2999 13.3899 59.9992 Constraint (T0340)D24.CB (T0340)V60.CB 5.4948 9.1581 11.9055 58.9979 Constraint (T0340)A48.CB (T0340)P86.CB 5.7518 9.5863 12.4622 58.9956 Constraint (T0340)L21.CB (T0340)A70.CB 6.8115 11.3526 14.7583 57.9981 Constraint (T0340)S44.CB (T0340)E78.CB 6.5433 10.9055 14.1772 57.9470 Constraint (T0340)S71.CB (T0340)R80.CB 6.6131 11.0218 14.3283 57.1213 Constraint (T0340)P40.CB (T0340)I72.CB 6.7197 11.1995 14.5594 57.0366 Constraint (T0340)I32.CB (T0340)V60.CB 6.8332 11.3887 14.8054 56.0347 Constraint (T0340)Y17.CB (T0340)S34.CB 6.8999 11.4998 14.9498 55.9921 Constraint (T0340)R4.CB (T0340)L82.CB 6.5592 10.9320 14.2116 54.9983 Constraint (T0340)N59.CB (T0340)L81.CB 6.9016 11.5027 14.9535 54.8673 Constraint (T0340)I32.CB (T0340)S44.CB 6.8247 11.3745 14.7869 54.1213 Constraint (T0340)K12.CB (T0340)S44.CB 6.3912 10.6520 13.8475 53.9941 Constraint (T0340)P28.CB (T0340)V68.CB 6.2805 10.4675 13.6077 53.9927 Constraint (T0340)R4.CB (T0340)I53.CB 6.7741 11.2902 14.6772 52.9995 Constraint (T0340)Q15.CB (T0340)D77.CB 6.0862 10.1437 13.1868 52.9994 Constraint (T0340)L3.CB (T0340)V84.CB 4.1776 6.9627 9.0516 52.9983 Constraint (T0340)K12.CB (T0340)R43.CB 6.2936 10.4893 13.6361 52.9938 Constraint (T0340)S26.CB (T0340)H65.CB 5.2857 8.8095 11.4523 52.8722 Constraint (T0340)V68.CB (T0340)A79.CB 6.5116 10.8526 14.1084 52.0685 Constraint (T0340)P5.CB (T0340)P86.CB 6.4500 10.7500 13.9750 51.9943 Constraint (T0340)R27.CB (T0340)H65.CB 6.0744 10.1241 13.1613 50.9994 Constraint (T0340)I32.CB (T0340)P86.CB 5.9258 9.8764 12.8393 50.9956 Constraint (T0340)Y17.CB (T0340)S71.CB 6.7826 11.3043 14.6956 50.9939 Constraint (T0340)K12.CB (T0340)R80.CB 6.7585 11.2641 14.6433 50.9923 Constraint (T0340)Q30.CB (T0340)Q49.CB 6.9425 11.5708 15.0420 50.6132 Constraint (T0340)L7.CB (T0340)D50.CB 7.0342 11.7236 15.2407 49.9984 Constraint (T0340)L10.CB (T0340)L52.CB 6.7873 11.3121 14.7057 49.9978 Constraint (T0340)D24.CB (T0340)A66.CB 5.0295 8.3826 10.8973 49.7458 Constraint (T0340)Y31.CB (T0340)E61.CB 6.8660 11.4433 14.8762 49.7421 Constraint (T0340)P28.CB (T0340)I53.CB 5.7118 9.5197 12.3756 49.7351 Constraint (T0340)D24.CB (T0340)E67.CB 5.1248 8.5414 11.1038 47.9986 Constraint (T0340)L3.CB (T0340)V83.CB 6.3911 10.6518 13.8474 47.9984 Constraint (T0340)R6.CB (T0340)P86.CB 6.5809 10.9682 14.2586 47.9942 Constraint (T0340)P14.CB (T0340)E76.CB 5.2780 8.7967 11.4358 47.9929 Constraint (T0340)D24.CB (T0340)V69.CB 5.6184 9.3640 12.1732 47.7458 Constraint (T0340)R27.CB (T0340)R64.CB 5.5497 9.2494 12.0243 46.9997 Constraint (T0340)V55.CB (T0340)E76.CB 6.2309 10.3848 13.5003 46.9994 Constraint (T0340)S23.CB (T0340)Q49.CB 6.8273 11.3788 14.7924 46.9986 Constraint (T0340)C8.CB (T0340)A42.CB 6.6496 11.0826 14.4074 46.9983 Constraint (T0340)N56.CB (T0340)K73.CB 6.7168 11.1947 14.5531 46.9983 Constraint (T0340)K25.CB (T0340)R64.CB 3.7758 6.2930 8.1809 46.9982 Constraint (T0340)Q15.CB (T0340)A41.CB 6.3723 10.6204 13.8066 46.9980 Constraint (T0340)K25.CB (T0340)V68.CB 6.0736 10.1227 13.1595 46.7455 Constraint (T0340)P40.CB (T0340)R75.CB 6.8155 11.3591 14.7668 46.4216 Constraint (T0340)S26.CB (T0340)L63.CB 6.2894 10.4823 13.6269 45.9987 Constraint (T0340)H9.CB (T0340)R43.CB 6.3043 10.5072 13.6594 45.9983 Constraint (T0340)Q15.CB (T0340)K73.CB 5.4394 9.0657 11.7854 45.9925 Constraint (T0340)K25.CB (T0340)A66.CB 5.6044 9.3406 12.1428 45.7455 Constraint (T0340)P28.CB (T0340)L52.CB 6.2576 10.4293 13.5581 45.6207 Constraint (T0340)R47.CB (T0340)L81.CB 6.8223 11.3705 14.7816 45.1926 Constraint (T0340)L3.CB (T0340)R51.CB 6.0172 10.0287 13.0373 44.9985 Constraint (T0340)K25.CB (T0340)L63.CB 5.1419 8.5699 11.1409 44.9982 Constraint (T0340)Q30.CB (T0340)Q58.CB 6.7410 11.2351 14.6056 44.9981 Constraint (T0340)R27.CB (T0340)L63.CB 5.4932 9.1553 11.9019 42.9992 Constraint (T0340)R4.CB (T0340)D50.CB 6.4059 10.6765 13.8795 42.9984 Constraint (T0340)P14.CB (T0340)S39.CB 6.1150 10.1917 13.2493 42.9984 Constraint (T0340)E54.CB (T0340)R75.CB 6.6545 11.0909 14.4182 41.9990 Constraint (T0340)R4.CB (T0340)P86.CB 5.4519 9.0865 11.8125 41.9982 Constraint (T0340)F19.CB (T0340)V55.CB 6.6592 11.0986 14.4282 41.9981 Constraint (T0340)R11.CB (T0340)L81.CB 6.8053 11.3422 14.7449 41.9979 Constraint (T0340)R27.CB (T0340)V60.CB 6.1475 10.2458 13.3196 41.9979 Constraint (T0340)D50.CB (T0340)S87.CB 6.3407 10.5678 13.7381 41.8655 Constraint (T0340)K25.CB (T0340)E67.CB 5.6819 9.4698 12.3108 41.7455 Constraint (T0340)R51.CB (T0340)L63.CB 6.6749 11.1248 14.4622 41.1217 Constraint (T0340)C8.CB (T0340)V35.CB 6.6513 11.0855 14.4112 40.9999 Constraint (T0340)L3.CB (T0340)D50.CB 6.3854 10.6424 13.8351 40.9998 Constraint (T0340)P5.CB (T0340)E61.CB 6.6725 11.1209 14.4572 40.9997 Constraint (T0340)S26.CB (T0340)R64.CB 4.5832 7.6387 9.9303 40.9987 Constraint (T0340)S23.CB (T0340)E61.CB 6.1960 10.3266 13.4246 40.9982 Constraint (T0340)H9.CB (T0340)E76.CB 6.5477 10.9129 14.1867 39.9997 Constraint (T0340)Q49.CB (T0340)S87.CB 5.4841 9.1402 11.8822 39.9964 Constraint (T0340)N20.CB (T0340)A42.CB 6.9107 11.5179 14.9733 39.9937 Constraint (T0340)P37.CB (T0340)A48.CB 6.8390 11.3983 14.8178 39.4157 Constraint (T0340)E61.CB (T0340)V83.CB 6.8736 11.4560 14.8928 38.9997 Constraint (T0340)K12.CB (T0340)A74.CB 6.4412 10.7354 13.9560 38.9925 Constraint (T0340)P37.CB (T0340)L46.CB 6.7706 11.2843 14.6696 38.4198 Constraint (T0340)S23.CB (T0340)D50.CB 6.5619 10.9366 14.2175 37.9986 Constraint (T0340)D50.CB (T0340)V60.CB 6.9386 11.5643 15.0336 37.7351 Constraint (T0340)V60.CB (T0340)R75.CB 6.7203 11.2005 14.5607 36.9997 Constraint (T0340)L3.CB (T0340)P86.CB 4.3693 7.2822 9.4668 36.9985 Constraint (T0340)L10.CB (T0340)D36.CB 6.7333 11.2222 14.5889 36.9980 Constraint (T0340)F19.CB (T0340)K73.CB 6.9852 11.6420 15.1347 36.9926 Constraint (T0340)L52.CB (T0340)P86.CB 6.5058 10.8430 14.0959 35.9958 Constraint (T0340)Q15.CB (T0340)E76.CB 6.0442 10.0737 13.0958 35.9930 Constraint (T0340)P28.CB (T0340)N59.CB 5.7911 9.6518 12.5473 35.7407 Constraint (T0340)D24.CB (T0340)S71.CB 6.6023 11.0039 14.3051 35.0000 Constraint (T0340)R51.CB (T0340)S87.CB 5.7342 9.5570 12.4241 34.7436 Constraint (T0340)V60.CB (T0340)A79.CB 6.7866 11.3110 14.7044 34.0687 Constraint (T0340)L10.CB (T0340)L82.CB 6.8482 11.4137 14.8378 33.9982 Constraint (T0340)K12.CB (T0340)L81.CB 6.7773 11.2955 14.6841 33.9925 Constraint (T0340)L52.CB (T0340)R75.CB 6.8059 11.3431 14.7460 32.9997 Constraint (T0340)N56.CB (T0340)A70.CB 6.7111 11.1851 14.5406 32.9997 Constraint (T0340)Y17.CB (T0340)N56.CB 6.6186 11.0311 14.3404 32.9981 Constraint (T0340)P14.CB (T0340)R75.CB 6.2798 10.4663 13.6062 32.9939 Constraint (T0340)K25.CB (T0340)E61.CB 5.9170 9.8617 12.8201 32.7455 Constraint (T0340)L46.CB (T0340)R80.CB 6.9071 11.5119 14.9654 32.1941 Constraint (T0340)Y31.CB (T0340)L63.CB 6.6914 11.1524 14.4981 32.1215 Constraint (T0340)E61.CB (T0340)S71.CB 6.9549 11.5915 15.0689 32.0422 Constraint (T0340)D24.CB (T0340)I72.CB 6.9059 11.5098 14.9627 32.0000 Constraint (T0340)R27.CB (T0340)I53.CB 6.3189 10.5314 13.6909 31.7412 Constraint (T0340)S23.CB (T0340)I72.CB 6.7710 11.2850 14.6706 30.9996 Constraint (T0340)D24.CB (T0340)D50.CB 6.6588 11.0981 14.4275 30.9995 Constraint (T0340)Q15.CB (T0340)A79.CB 6.1982 10.3303 13.4294 30.9984 Constraint (T0340)I32.CB (T0340)H65.CB 6.5241 10.8734 14.1355 30.9202 Constraint (T0340)D24.CB (T0340)A70.CB 6.6704 11.1173 14.4525 30.0000 Constraint (T0340)I53.CB (T0340)S71.CB 7.0571 11.7619 15.2904 29.9996 Constraint (T0340)Y17.CB (T0340)V68.CB 6.7016 11.1693 14.5201 29.9996 Constraint (T0340)R4.CB (T0340)R51.CB 6.3229 10.5382 13.6997 29.9996 Constraint (T0340)R33.CB (T0340)V68.CB 6.9272 11.5453 15.0089 29.9993 Constraint (T0340)Q15.CB (T0340)R43.CB 6.2987 10.4979 13.6472 29.9980 Constraint (T0340)Q15.CB (T0340)R75.CB 5.5056 9.1759 11.9287 29.9926 Constraint (T0340)H22.CB (T0340)A66.CB 6.7706 11.2844 14.6697 28.9977 Constraint (T0340)I53.CB (T0340)P86.CB 6.1675 10.2792 13.3629 28.9946 Constraint (T0340)D24.CB (T0340)Q49.CB 6.0911 10.1518 13.1973 28.7068 Constraint (T0340)Y17.CB (T0340)A74.CB 6.8902 11.4837 14.9288 27.9996 Constraint (T0340)H22.CB (T0340)R64.CB 6.7603 11.2672 14.6473 27.9984 Constraint (T0340)K25.CB (T0340)V60.CB 5.9130 9.8549 12.8114 27.7456 Constraint (T0340)V35.CB (T0340)L81.CB 7.0268 11.7114 15.2248 27.1984 Constraint (T0340)P40.CB (T0340)E76.CB 6.7214 11.2023 14.5630 27.0690 Constraint (T0340)L3.CB (T0340)Q49.CB 6.3011 10.5019 13.6525 26.9999 Constraint (T0340)S23.CB (T0340)I53.CB 6.7341 11.2236 14.5907 26.9984 Constraint (T0340)S26.CB (T0340)R51.CB 5.8065 9.6775 12.5808 26.7424 Constraint (T0340)S26.CB (T0340)E61.CB 5.9229 9.8714 12.8329 26.6196 Constraint (T0340)V60.CB (T0340)R80.CB 7.0318 11.7197 15.2356 26.1215 Constraint (T0340)P14.CB (T0340)E78.CB 6.4330 10.7216 13.9381 25.9995 Constraint (T0340)P14.CB (T0340)A79.CB 6.6757 11.1262 14.4640 25.9984 Constraint (T0340)R4.CB (T0340)S87.CB 5.2046 8.6744 11.2767 25.9983 Constraint (T0340)P14.CB (T0340)K73.CB 6.1623 10.2705 13.3516 25.9928 Constraint (T0340)S26.CB (T0340)A66.CB 5.5615 9.2692 12.0500 25.8736 Constraint (T0340)P28.CB (T0340)E67.CB 6.4833 10.8055 14.0471 25.6195 Constraint (T0340)I32.CB (T0340)V55.CB 6.9154 11.5257 14.9835 25.2979 Constraint (T0340)R6.CB (T0340)I32.CB 6.9382 11.5636 15.0327 25.0000 Constraint (T0340)M2.CB (T0340)V84.CB 5.7017 9.5028 12.3537 24.9999 Constraint (T0340)H9.CB (T0340)E54.CB 7.0613 11.7689 15.2995 24.9994 Constraint (T0340)L7.CB (T0340)E78.CB 6.9098 11.5163 14.9712 24.9928 Constraint (T0340)R27.CB (T0340)V84.CB 6.3937 10.6561 13.8529 24.8690 Constraint (T0340)V35.CB (T0340)L52.CB 6.8441 11.4068 14.8288 24.0408 Constraint (T0340)V69.CB (T0340)A79.CB 6.8309 11.3848 14.8003 24.0000 Constraint (T0340)R27.CB (T0340)V68.CB 6.1525 10.2541 13.3303 23.9998 Constraint (T0340)R27.CB (T0340)E67.CB 6.3972 10.6620 13.8606 23.9998 Constraint (T0340)N20.CB (T0340)Q49.CB 6.8604 11.4339 14.8641 23.9997 Constraint (T0340)R33.CB (T0340)V69.CB 6.6425 11.0708 14.3920 23.9983 Constraint (T0340)K12.CB (T0340)N56.CB 6.2485 10.4141 13.5384 23.9926 Constraint (T0340)D24.CB (T0340)V84.CB 6.7377 11.2295 14.5983 23.7070 Constraint (T0340)N59.CB (T0340)V84.CB 6.8598 11.4330 14.8628 23.1214 Constraint (T0340)L3.CB (T0340)I53.CB 6.2214 10.3689 13.4796 22.9998 Constraint (T0340)S39.CB (T0340)A79.CB 6.7853 11.3088 14.7015 22.9987 Constraint (T0340)Q15.CB (T0340)A74.CB 5.6321 9.3869 12.2029 22.9945 Constraint (T0340)Q15.CB (T0340)I72.CB 5.3601 8.9335 11.6135 22.9926 Constraint (T0340)K25.CB (T0340)R51.CB 6.4031 10.6719 13.8735 22.0354 Constraint (T0340)R27.CB (T0340)N59.CB 6.3589 10.5981 13.7775 21.9998 Constraint (T0340)V55.CB (T0340)H65.CB 6.9349 11.5582 15.0257 21.9206 Constraint (T0340)S26.CB (T0340)E67.CB 5.9469 9.9114 12.8848 21.0000 Constraint (T0340)Q58.CB (T0340)E76.CB 6.8763 11.4604 14.8986 21.0000 Constraint (T0340)L46.CB (T0340)I72.CB 6.9725 11.6209 15.1071 20.9999 Constraint (T0340)R47.CB (T0340)S87.CB 6.1295 10.2158 13.2806 20.9979 Constraint (T0340)Q49.CB (T0340)T88.CB 6.1005 10.1676 13.2179 20.8735 Constraint (T0340)V55.CB (T0340)D77.CB 6.7824 11.3041 14.6953 20.8674 Constraint (T0340)D36.CB (T0340)R47.CB 6.8331 11.3885 14.8050 20.0427 Constraint (T0340)L21.CB (T0340)A79.CB 6.9549 11.5916 15.0690 19.9997 Constraint (T0340)S26.CB (T0340)V68.CB 6.3173 10.5288 13.6874 19.9990 Constraint (T0340)R51.CB (T0340)H65.CB 6.7090 11.1816 14.5361 19.9205 Constraint (T0340)P28.CB (T0340)V84.CB 5.3481 8.9135 11.5876 19.8687 Constraint (T0340)V68.CB (T0340)L82.CB 6.9923 11.6539 15.1501 19.8687 Constraint (T0340)E54.CB (T0340)E67.CB 6.2892 10.4819 13.6265 19.7425 Constraint (T0340)M2.CB (T0340)D50.CB 6.6066 11.0110 14.3144 18.9999 Constraint (T0340)S71.CB (T0340)L82.CB 7.0436 11.7393 15.2611 18.9996 Constraint (T0340)Y17.CB (T0340)V83.CB 6.9732 11.6220 15.1086 18.9995 Constraint (T0340)L3.CB (T0340)S87.CB 4.5752 7.6254 9.9130 18.9986 Constraint (T0340)P37.CB (T0340)R47.CB 6.7535 11.2558 14.6326 18.0000 Constraint (T0340)L46.CB (T0340)P86.CB 6.2370 10.3950 13.5135 17.9997 Constraint (T0340)L21.CB (T0340)D36.CB 6.6872 11.1453 14.4889 17.9993 Constraint (T0340)Y31.CB (T0340)L81.CB 7.0166 11.6944 15.2027 17.9987 Constraint (T0340)R4.CB (T0340)R47.CB 6.6965 11.1609 14.5091 17.9986 Constraint (T0340)K12.CB (T0340)V55.CB 6.4344 10.7240 13.9411 17.9926 Constraint (T0340)I32.CB (T0340)V69.CB 6.7410 11.2350 14.6055 17.0414 Constraint (T0340)K12.CB (T0340)A42.CB 6.6505 11.0842 14.4095 16.9998 Constraint (T0340)K12.CB (T0340)D36.CB 6.5826 10.9711 14.2624 16.9998 Constraint (T0340)D24.CB (T0340)I53.CB 6.4213 10.7021 13.9128 16.9998 Constraint (T0340)F19.CB (T0340)R75.CB 6.9499 11.5831 15.0580 16.9997 Constraint (T0340)Q15.CB (T0340)V69.CB 6.4654 10.7756 14.0083 16.9983 Constraint (T0340)Y31.CB (T0340)S87.CB 6.6188 11.0313 14.3407 16.9978 Constraint (T0340)R33.CB (T0340)P86.CB 7.0271 11.7118 15.2254 16.9962 Constraint (T0340)P28.CB (T0340)E54.CB 5.9897 9.9829 12.9777 16.6204 Constraint (T0340)P40.CB (T0340)R80.CB 6.6981 11.1636 14.5126 16.0998 Constraint (T0340)D24.CB (T0340)P86.CB 6.2689 10.4481 13.5825 16.0000 Constraint (T0340)M2.CB (T0340)R47.CB 6.4325 10.7208 13.9370 16.0000 Constraint (T0340)E61.CB (T0340)P86.CB 6.6995 11.1659 14.5156 15.9999 Constraint (T0340)L46.CB (T0340)V55.CB 7.0115 11.6859 15.1916 15.9996 Constraint (T0340)N20.CB (T0340)P37.CB 6.6957 11.1595 14.5073 15.9996 Constraint (T0340)Q30.CB (T0340)P86.CB 6.3843 10.6405 13.8327 15.9960 Constraint (T0340)P14.CB (T0340)A74.CB 6.4611 10.7685 13.9990 15.9943 Constraint (T0340)P5.CB (T0340)R80.CB 7.0542 11.7571 15.2842 15.9943 Constraint (T0340)R27.CB (T0340)L52.CB 6.5993 10.9988 14.2984 15.8735 Constraint (T0340)D50.CB (T0340)T88.CB 6.5871 10.9786 14.2721 15.8733 Constraint (T0340)V68.CB (T0340)V83.CB 6.6521 11.0868 14.4129 15.8687 Constraint (T0340)K25.CB (T0340)V69.CB 6.6156 11.0260 14.3338 15.7455 Constraint (T0340)M2.CB (T0340)P86.CB 6.0553 10.0921 13.1198 14.9999 Constraint (T0340)Q15.CB (T0340)A42.CB 6.0790 10.1317 13.1712 14.9999 Constraint (T0340)N20.CB (T0340)R47.CB 6.9583 11.5972 15.0763 14.9997 Constraint (T0340)V60.CB (T0340)A74.CB 6.9639 11.6065 15.0885 14.9994 Constraint (T0340)C8.CB (T0340)S39.CB 6.9014 11.5023 14.9530 14.9987 Constraint (T0340)Q15.CB (T0340)E78.CB 6.7080 11.1800 14.5341 13.9998 Constraint (T0340)C8.CB (T0340)R51.CB 6.6923 11.1538 14.4999 13.9996 Constraint (T0340)Q15.CB (T0340)P37.CB 6.1318 10.2197 13.2856 13.9996 Constraint (T0340)Q58.CB (T0340)V69.CB 6.1383 10.2305 13.2996 13.9984 Constraint (T0340)N20.CB (T0340)K73.CB 6.6084 11.0140 14.3182 13.9983 Constraint (T0340)H22.CB (T0340)V60.CB 6.4338 10.7230 13.9399 13.9982 Constraint (T0340)S26.CB (T0340)V60.CB 6.0260 10.0434 13.0564 13.8727 Constraint (T0340)D24.CB (T0340)A48.CB 6.8752 11.4587 14.8962 13.7470 Constraint (T0340)L52.CB (T0340)R64.CB 6.9348 11.5580 15.0254 13.2999 Constraint (T0340)A41.CB (T0340)R80.CB 6.9768 11.6281 15.1165 12.9999 Constraint (T0340)S44.CB (T0340)L82.CB 6.8678 11.4464 14.8803 12.9998 Constraint (T0340)H22.CB (T0340)V35.CB 6.6073 11.0121 14.3157 12.9986 Constraint (T0340)P14.CB (T0340)D36.CB 6.2514 10.4191 13.5448 12.9985 Constraint (T0340)P5.CB (T0340)R47.CB 6.9981 11.6635 15.1625 12.9985 Constraint (T0340)P5.CB (T0340)N59.CB 6.9332 11.5554 15.0220 12.0000 Constraint (T0340)M2.CB (T0340)V83.CB 6.0675 10.1126 13.1463 12.0000 Constraint (T0340)S23.CB (T0340)P86.CB 6.5559 10.9266 14.2045 12.0000 Constraint (T0340)C8.CB (T0340)I72.CB 6.9279 11.5466 15.0106 11.9999 Constraint (T0340)M2.CB (T0340)Q49.CB 7.0082 11.6803 15.1845 11.9999 Constraint (T0340)A70.CB (T0340)A79.CB 6.7921 11.3202 14.7162 11.9999 Constraint (T0340)C8.CB (T0340)R75.CB 7.0147 11.6912 15.1985 11.9999 Constraint (T0340)R4.CB (T0340)Q49.CB 6.9614 11.6024 15.0831 11.9998 Constraint (T0340)F19.CB (T0340)R51.CB 6.9460 11.5767 15.0497 11.9994 Constraint (T0340)R4.CB (T0340)T88.CB 6.2545 10.4242 13.5514 11.9985 Constraint (T0340)L21.CB (T0340)I53.CB 6.5612 10.9353 14.2159 11.9984 Constraint (T0340)R11.CB (T0340)A42.CB 6.2806 10.4677 13.6080 11.9984 Constraint (T0340)Q58.CB (T0340)K73.CB 6.4239 10.7065 13.9184 11.9984 Constraint (T0340)H22.CB (T0340)P86.CB 6.9690 11.6150 15.0995 11.9961 Constraint (T0340)E61.CB (T0340)A70.CB 6.8617 11.4362 14.8671 11.0425 Constraint (T0340)D24.CB (T0340)V55.CB 6.6649 11.1082 14.4406 11.0000 Constraint (T0340)P28.CB (T0340)P86.CB 6.3834 10.6391 13.8308 10.9999 Constraint (T0340)P28.CB (T0340)L82.CB 6.3351 10.5586 13.7261 10.9998 Constraint (T0340)L3.CB (T0340)T88.CB 6.3941 10.6569 13.8539 10.9986 Constraint (T0340)N59.CB (T0340)R80.CB 7.0617 11.7695 15.3003 10.9985 Constraint (T0340)I53.CB (T0340)E67.CB 6.1155 10.1925 13.2502 10.7425 Constraint (T0340)V55.CB (T0340)R64.CB 6.9004 11.5006 14.9508 10.3000 Constraint (T0340)D50.CB (T0340)R89.CB 6.1843 10.3072 13.3993 10.0983 Constraint (T0340)R27.CB (T0340)A66.CB 6.0182 10.0302 13.0393 10.0000 Constraint (T0340)P28.CB (T0340)V83.CB 6.3006 10.5009 13.6512 9.9998 Constraint (T0340)R6.CB (T0340)S87.CB 6.4967 10.8278 14.0762 9.9998 Constraint (T0340)A41.CB (T0340)V55.CB 6.4386 10.7309 13.9502 9.9997 Constraint (T0340)P28.CB (T0340)A66.CB 6.8000 11.3333 14.7333 9.9987 Constraint (T0340)R51.CB (T0340)R89.CB 6.3317 10.5528 13.7187 9.9984 Constraint (T0340)S26.CB (T0340)P86.CB 6.0829 10.1382 13.1797 9.9955 Constraint (T0340)R47.CB (T0340)T88.CB 5.6369 9.3948 12.2132 9.8736 Constraint (T0340)S26.CB (T0340)Q49.CB 6.4223 10.7038 13.9150 9.8734 Constraint (T0340)Q30.CB (T0340)L46.CB 6.9275 11.5458 15.0095 9.6209 Constraint (T0340)S26.CB (T0340)I53.CB 5.4458 9.0763 11.7992 9.0355 Constraint (T0340)P14.CB (T0340)R43.CB 6.6105 11.0176 14.3228 9.0000 Constraint (T0340)N56.CB (T0340)E67.CB 6.7035 11.1726 14.5243 9.0000 Constraint (T0340)R43.CB (T0340)A79.CB 7.0778 11.7963 15.3352 8.9999 Constraint (T0340)L10.CB (T0340)D50.CB 6.9254 11.5423 15.0050 8.9999 Constraint (T0340)Q15.CB (T0340)V35.CB 6.8789 11.4648 14.9042 8.9999 Constraint (T0340)L3.CB (T0340)R47.CB 6.6225 11.0375 14.3487 8.9998 Constraint (T0340)P5.CB (T0340)S87.CB 5.8581 9.7635 12.6926 8.9998 Constraint (T0340)F19.CB (T0340)H65.CB 6.5020 10.8366 14.0876 8.9997 Constraint (T0340)Q15.CB (T0340)S71.CB 6.9632 11.6054 15.0870 8.9997 Constraint (T0340)Q49.CB (T0340)R89.CB 5.8393 9.7322 12.6519 8.9986 Constraint (T0340)L21.CB (T0340)R47.CB 6.9660 11.6100 15.0930 8.9986 Constraint (T0340)R51.CB (T0340)T88.CB 6.3174 10.5290 13.6878 8.8732 Constraint (T0340)S26.CB (T0340)V84.CB 5.1398 8.5663 11.1362 8.8691 Constraint (T0340)A41.CB (T0340)V68.CB 6.5623 10.9371 14.2182 8.6206 Constraint (T0340)S39.CB (T0340)I72.CB 6.9039 11.5064 14.9584 8.4219 Constraint (T0340)D50.CB (T0340)V68.CB 6.7970 11.3284 14.7269 8.1215 Constraint (T0340)R47.CB (T0340)R89.CB 6.4903 10.8171 14.0622 8.0983 Constraint (T0340)S1.CB (T0340)V84.CB 6.8263 11.3771 14.7902 7.9999 Constraint (T0340)S23.CB (T0340)A48.CB 6.8461 11.4102 14.8333 7.9999 Constraint (T0340)Y31.CB (T0340)V69.CB 6.8812 11.4687 14.9093 7.9985 Constraint (T0340)R4.CB (T0340)R89.CB 6.0518 10.0863 13.1122 7.9985 Constraint (T0340)P14.CB (T0340)I72.CB 6.6592 11.0987 14.4283 7.9981 Constraint (T0340)R27.CB (T0340)Q49.CB 7.0576 11.7627 15.2915 7.8735 Constraint (T0340)S26.CB (T0340)D50.CB 6.8420 11.4033 14.8243 7.7472 Constraint (T0340)I32.CB (T0340)L82.CB 6.8669 11.4448 14.8782 7.1999 Constraint (T0340)S26.CB (T0340)V69.CB 6.5895 10.9825 14.2772 7.0000 Constraint (T0340)L3.CB (T0340)L82.CB 6.3512 10.5854 13.7610 6.9999 Constraint (T0340)P28.CB (T0340)V55.CB 6.9951 11.6584 15.1559 6.9998 Constraint (T0340)P28.CB (T0340)D50.CB 6.1917 10.3195 13.4153 6.9998 Constraint (T0340)I72.CB (T0340)V83.CB 6.8278 11.3797 14.7937 6.9998 Constraint (T0340)Q15.CB (T0340)A70.CB 6.8603 11.4339 14.8641 6.9997 Constraint (T0340)R11.CB (T0340)N56.CB 6.1329 10.2215 13.2880 6.9984 Constraint (T0340)R11.CB (T0340)L46.CB 6.5882 10.9803 14.2743 6.9984 Constraint (T0340)L10.CB (T0340)L21.CB 6.6646 11.1077 14.4400 6.9983 Constraint (T0340)S26.CB (T0340)L52.CB 5.7646 9.6077 12.4900 6.8735 Constraint (T0340)E67.CB (T0340)L81.CB 6.8531 11.4218 14.8484 6.8691 Constraint (T0340)Q30.CB (T0340)A41.CB 6.9643 11.6072 15.0893 6.6206 Constraint (T0340)K25.CB (T0340)P86.CB 5.5168 9.1947 11.9531 6.4146 Constraint (T0340)V55.CB (T0340)A66.CB 7.0993 11.8322 15.3818 6.3000 Constraint (T0340)Y31.CB (T0340)R64.CB 7.1580 11.9299 15.5089 6.2999 Constraint (T0340)S26.CB (T0340)S87.CB 6.5492 10.9153 14.1898 6.2882 Constraint (T0340)I53.CB (T0340)R89.CB 6.3812 10.6353 13.8258 6.0997 Constraint (T0340)A48.CB (T0340)T88.CB 6.2067 10.3444 13.4478 6.0000 Constraint (T0340)A41.CB (T0340)E78.CB 6.8654 11.4424 14.8751 6.0000 Constraint (T0340)S39.CB (T0340)A48.CB 7.0986 11.8310 15.3803 6.0000 Constraint (T0340)R27.CB (T0340)V69.CB 6.7655 11.2759 14.6587 6.0000 Constraint (T0340)F19.CB (T0340)V60.CB 7.0502 11.7503 15.2754 6.0000 Constraint (T0340)L63.CB (T0340)A74.CB 7.1035 11.8392 15.3910 6.0000 Constraint (T0340)R27.CB (T0340)P86.CB 7.1308 11.8847 15.4501 6.0000 Constraint (T0340)K25.CB (T0340)N59.CB 6.5031 10.8384 14.0900 6.0000 Constraint (T0340)S26.CB (T0340)N59.CB 6.4731 10.7886 14.0251 6.0000 Constraint (T0340)I32.CB (T0340)A79.CB 7.0527 11.7545 15.2809 5.9999 Constraint (T0340)L3.CB (T0340)E61.CB 6.5102 10.8503 14.1054 5.9999 Constraint (T0340)R6.CB (T0340)T88.CB 6.6679 11.1132 14.4472 5.9999 Constraint (T0340)Y31.CB (T0340)I72.CB 7.0801 11.8002 15.3402 5.9998 Constraint (T0340)Q30.CB (T0340)K73.CB 6.9139 11.5231 14.9800 5.9998 Constraint (T0340)P5.CB (T0340)P28.CB 6.8623 11.4372 14.8683 5.9998 Constraint (T0340)V35.CB (T0340)P86.CB 7.0825 11.8042 15.3455 5.9998 Constraint (T0340)R27.CB (T0340)S87.CB 6.5472 10.9119 14.1855 5.9998 Constraint (T0340)N56.CB (T0340)V69.CB 6.4337 10.7228 13.9397 5.9997 Constraint (T0340)Q15.CB (T0340)N56.CB 6.5886 10.9811 14.2754 5.9997 Constraint (T0340)Y17.CB (T0340)A70.CB 7.0214 11.7023 15.2130 5.9996 Constraint (T0340)S39.CB (T0340)L81.CB 6.8895 11.4826 14.9273 5.9987 Constraint (T0340)R47.CB (T0340)L82.CB 7.0321 11.7201 15.2361 5.9987 Constraint (T0340)L3.CB (T0340)R89.CB 6.5950 10.9916 14.2891 5.9986 Constraint (T0340)S34.CB (T0340)V69.CB 6.6058 11.0097 14.3126 5.9984 Constraint (T0340)N59.CB (T0340)I72.CB 6.6498 11.0831 14.4080 5.9984 Constraint (T0340)S23.CB (T0340)Q58.CB 6.5779 10.9632 14.2522 5.9984 Constraint (T0340)L21.CB (T0340)E61.CB 6.9195 11.5326 14.9923 5.9984 Constraint (T0340)L21.CB (T0340)Q58.CB 5.9051 9.8419 12.7945 5.9984 Constraint (T0340)L21.CB (T0340)E54.CB 6.4949 10.8249 14.0724 5.9984 Constraint (T0340)P14.CB (T0340)P37.CB 6.3347 10.5579 13.7253 5.9984 Constraint (T0340)A48.CB (T0340)S87.CB 6.0984 10.1641 13.2133 5.9981 Constraint (T0340)K12.CB (T0340)S71.CB 6.6870 11.1450 14.4885 5.9929 Constraint (T0340)L46.CB (T0340)V68.CB 6.8258 11.3764 14.7893 5.1218 Constraint (T0340)Y31.CB (T0340)E67.CB 7.1345 11.8909 15.4581 5.1216 Constraint (T0340)D24.CB (T0340)V83.CB 6.0061 10.0102 13.0132 5.0000 Constraint (T0340)D24.CB (T0340)L81.CB 6.6170 11.0283 14.3368 5.0000 Constraint (T0340)D24.CB (T0340)N59.CB 7.0204 11.7007 15.2110 5.0000 Constraint (T0340)D24.CB (T0340)E54.CB 6.8208 11.3680 14.7784 5.0000 Constraint (T0340)S1.CB (T0340)P86.CB 3.9551 6.5918 8.5694 4.9999 Constraint (T0340)L3.CB (T0340)R27.CB 6.8664 11.4440 14.8772 4.9999 Constraint (T0340)H22.CB (T0340)I72.CB 6.5584 10.9306 14.2098 4.9999 Constraint (T0340)K25.CB (T0340)L52.CB 6.1722 10.2870 13.3731 4.9999 Constraint (T0340)R6.CB (T0340)R89.CB 6.6526 11.0877 14.4140 4.9998 Constraint (T0340)P5.CB (T0340)R89.CB 5.4269 9.0448 11.7583 4.9998 Constraint (T0340)H22.CB (T0340)L63.CB 6.6854 11.1423 14.4850 4.9998 Constraint (T0340)F19.CB (T0340)S71.CB 6.8773 11.4621 14.9008 4.9998 Constraint (T0340)S23.CB (T0340)V55.CB 6.0039 10.0065 13.0085 4.9996 Constraint (T0340)N20.CB (T0340)A66.CB 6.6084 11.0140 14.3182 4.9985 Constraint (T0340)I32.CB (T0340)S87.CB 6.7244 11.2073 14.5695 4.9979 Constraint (T0340)K25.CB (T0340)I53.CB 6.8272 11.3786 14.7922 4.8736 Constraint (T0340)I53.CB (T0340)S87.CB 5.9925 9.9876 12.9838 4.7470 Constraint (T0340)Y31.CB (T0340)A66.CB 7.0190 11.6983 15.2078 4.7428 Constraint (T0340)K12.CB (T0340)L46.CB 7.0446 11.7410 15.2633 4.0000 Constraint (T0340)P40.CB (T0340)V55.CB 6.9758 11.6263 15.1142 4.0000 Constraint (T0340)K25.CB (T0340)S87.CB 6.1206 10.2010 13.2613 4.0000 Constraint (T0340)R27.CB (T0340)E54.CB 7.0753 11.7922 15.3298 4.0000 Constraint (T0340)S1.CB (T0340)Q49.CB 6.0818 10.1363 13.1772 3.9999 Constraint (T0340)K25.CB (T0340)S71.CB 7.1219 11.8698 15.4307 3.9999 Constraint (T0340)V68.CB (T0340)R80.CB 7.1658 11.9430 15.5260 3.9999 Constraint (T0340)D24.CB (T0340)S87.CB 6.3588 10.5981 13.7775 3.9998 Constraint (T0340)L3.CB (T0340)L52.CB 6.6482 11.0804 14.4045 3.9998 Constraint (T0340)M2.CB (T0340)R51.CB 6.6756 11.1259 14.4637 3.9998 Constraint (T0340)S23.CB (T0340)S71.CB 6.6463 11.0772 14.4003 3.9997 Constraint (T0340)R11.CB (T0340)I72.CB 6.7848 11.3080 14.7003 3.9997 Constraint (T0340)R11.CB (T0340)V55.CB 6.9319 11.5531 15.0191 3.9997 Constraint (T0340)R11.CB (T0340)D36.CB 6.8316 11.3860 14.8018 3.9987 Constraint (T0340)H9.CB (T0340)A42.CB 5.4002 9.0003 11.7003 3.9987 Constraint (T0340)L10.CB (T0340)N20.CB 6.6739 11.1231 14.4600 3.9986 Constraint (T0340)K25.CB (T0340)Q49.CB 5.4894 9.1489 11.8936 3.8736 Constraint (T0340)I53.CB (T0340)T88.CB 6.4681 10.7801 14.0142 3.8733 Constraint (T0340)D24.CB (T0340)S34.CB 5.7705 9.6175 12.5027 3.7472 Constraint (T0340)S34.CB (T0340)H65.CB 6.9914 11.6523 15.1481 3.2997 Constraint (T0340)R43.CB (T0340)E78.CB 6.7940 11.3233 14.7203 3.1987 Constraint (T0340)V69.CB (T0340)L81.CB 7.1518 11.9197 15.4956 3.0000 Constraint (T0340)R43.CB (T0340)L81.CB 7.1529 11.9216 15.4980 3.0000 Constraint (T0340)A41.CB (T0340)E76.CB 6.8524 11.4206 14.8468 3.0000 Constraint (T0340)R33.CB (T0340)I72.CB 7.1582 11.9303 15.5094 3.0000 Constraint (T0340)P28.CB (T0340)Q49.CB 7.0402 11.7336 15.2537 3.0000 Constraint (T0340)K25.CB (T0340)A48.CB 6.8708 11.4514 14.8868 3.0000 Constraint (T0340)D24.CB (T0340)L82.CB 7.1118 11.8529 15.4088 3.0000 Constraint (T0340)S23.CB (T0340)V84.CB 7.1849 11.9749 15.5673 3.0000 Constraint (T0340)F19.CB (T0340)E76.CB 6.9246 11.5409 15.0032 3.0000 Constraint (T0340)Y17.CB (T0340)D50.CB 7.1893 11.9822 15.5769 3.0000 Constraint (T0340)P5.CB (T0340)V60.CB 6.6177 11.0294 14.3383 3.0000 Constraint (T0340)P5.CB (T0340)V55.CB 6.9860 11.6433 15.1363 3.0000 Constraint (T0340)S1.CB (T0340)S87.CB 6.2255 10.3758 13.4885 3.0000 Constraint (T0340)E61.CB (T0340)R89.CB 6.6951 11.1585 14.5061 3.0000 Constraint (T0340)K25.CB (T0340)V55.CB 6.9153 11.5254 14.9831 3.0000 Constraint (T0340)K25.CB (T0340)E54.CB 7.1302 11.8837 15.4489 3.0000 Constraint (T0340)N20.CB (T0340)L81.CB 7.1909 11.9848 15.5802 3.0000 Constraint (T0340)P14.CB (T0340)N56.CB 7.0679 11.7799 15.3139 3.0000 Constraint (T0340)L7.CB (T0340)R47.CB 7.1162 11.8604 15.4185 3.0000 Constraint (T0340)S26.CB (T0340)E54.CB 6.9735 11.6226 15.1094 3.0000 Constraint (T0340)E67.CB (T0340)A79.CB 6.5164 10.8607 14.1189 3.0000 Constraint (T0340)P28.CB (T0340)Q58.CB 6.6393 11.0656 14.3852 3.0000 Constraint (T0340)L63.CB (T0340)L81.CB 6.7695 11.2826 14.6674 2.9999 Constraint (T0340)E61.CB (T0340)L81.CB 6.3886 10.6477 13.8420 2.9999 Constraint (T0340)D50.CB (T0340)I72.CB 7.1379 11.8964 15.4654 2.9999 Constraint (T0340)S44.CB (T0340)R75.CB 7.0669 11.7781 15.3116 2.9999 Constraint (T0340)V35.CB (T0340)I72.CB 7.1474 11.9123 15.4860 2.9999 Constraint (T0340)L10.CB (T0340)K73.CB 6.7246 11.2077 14.5700 2.9999 Constraint (T0340)R6.CB (T0340)Q49.CB 7.0302 11.7170 15.2321 2.9999 Constraint (T0340)L3.CB (T0340)A48.CB 6.9021 11.5035 14.9546 2.9999 Constraint (T0340)L3.CB (T0340)Y31.CB 5.4994 9.1657 11.9154 2.9999 Constraint (T0340)L3.CB (T0340)D24.CB 6.7097 11.1828 14.5377 2.9999 Constraint (T0340)P5.CB (T0340)T88.CB 5.4048 9.0080 11.7104 2.9999 Constraint (T0340)L52.CB (T0340)S87.CB 6.7627 11.2712 14.6526 2.9997 Constraint (T0340)R51.CB (T0340)E67.CB 6.8001 11.3336 14.7336 2.9997 Constraint (T0340)Y17.CB (T0340)H65.CB 6.8622 11.4370 14.8681 2.9997 Constraint (T0340)Y17.CB (T0340)V60.CB 6.8959 11.4932 14.9411 2.9997 Constraint (T0340)Y17.CB (T0340)Q30.CB 5.7622 9.6037 12.4849 2.9997 Constraint (T0340)V55.CB (T0340)V84.CB 6.0588 10.0980 13.1274 2.9997 Constraint (T0340)A42.CB (T0340)L52.CB 7.1863 11.9772 15.5704 2.9997 Constraint (T0340)A41.CB (T0340)R51.CB 6.4997 10.8328 14.0827 2.9997 Constraint (T0340)S34.CB (T0340)L52.CB 7.0338 11.7230 15.2399 2.9997 Constraint (T0340)Y31.CB (T0340)V55.CB 7.0713 11.7855 15.3211 2.9997 Constraint (T0340)S23.CB (T0340)N59.CB 5.8972 9.8287 12.7774 2.9997 Constraint (T0340)S23.CB (T0340)E54.CB 6.4502 10.7503 13.9754 2.9997 Constraint (T0340)H22.CB (T0340)E61.CB 7.0137 11.6895 15.1964 2.9997 Constraint (T0340)L21.CB (T0340)N56.CB 6.8417 11.4029 14.8237 2.9997 Constraint (T0340)Y17.CB (T0340)P37.CB 4.7603 7.9338 10.3140 2.9997 Constraint (T0340)Q15.CB (T0340)V55.CB 7.1698 11.9496 15.5345 2.9997 Constraint (T0340)K12.CB (T0340)P37.CB 5.7691 9.6152 12.4998 2.9997 Constraint (T0340)R11.CB (T0340)P37.CB 6.0371 10.0619 13.0805 2.9997 Constraint (T0340)L10.CB (T0340)E54.CB 6.7363 11.2272 14.5954 2.9997 Constraint (T0340)L10.CB (T0340)P37.CB 6.6007 11.0012 14.3016 2.9997 Constraint (T0340)A48.CB (T0340)R89.CB 5.8254 9.7089 12.6216 2.9987 Constraint (T0340)A42.CB (T0340)A79.CB 7.1833 11.9721 15.5637 2.9987 Constraint (T0340)A42.CB (T0340)E78.CB 5.5464 9.2441 12.0173 2.9987 Constraint (T0340)S39.CB (T0340)E78.CB 6.9101 11.5168 14.9719 2.9987 Constraint (T0340)P28.CB (T0340)V69.CB 7.0106 11.6843 15.1896 2.9987 Constraint (T0340)L21.CB (T0340)N59.CB 6.7999 11.3332 14.7331 2.9987 Constraint (T0340)N20.CB (T0340)A70.CB 6.5910 10.9850 14.2805 2.9987 Constraint (T0340)N20.CB (T0340)V55.CB 6.9579 11.5965 15.0755 2.9987 Constraint (T0340)F19.CB (T0340)N56.CB 6.6605 11.1009 14.4312 2.9987 Constraint (T0340)Y17.CB (T0340)Q58.CB 6.6417 11.0696 14.3904 2.9987 Constraint (T0340)P14.CB (T0340)A41.CB 7.1283 11.8805 15.4447 2.9987 Constraint (T0340)P14.CB (T0340)V35.CB 7.0620 11.7700 15.3010 2.9987 Constraint (T0340)K12.CB (T0340)Q58.CB 6.8582 11.4304 14.8595 2.9987 Constraint (T0340)L10.CB (T0340)R47.CB 6.8848 11.4747 14.9171 2.9987 Constraint (T0340)H9.CB (T0340)S39.CB 6.2471 10.4118 13.5353 2.9987 Constraint (T0340)L52.CB (T0340)A66.CB 7.1098 11.8497 15.4047 2.6209 Constraint (T0340)Q30.CB (T0340)A48.CB 7.1038 11.8396 15.3915 2.6209 Constraint (T0340)K25.CB (T0340)V84.CB 5.7331 9.5552 12.4218 2.4146 Constraint (T0340)D50.CB (T0340)L63.CB 7.0327 11.7212 15.2376 2.1219 Constraint (T0340)S44.CB (T0340)I72.CB 6.7139 11.1899 14.5469 2.1219 Constraint (T0340)S39.CB (T0340)K73.CB 7.1801 11.9669 15.5569 2.1219 Constraint (T0340)R33.CB (T0340)L63.CB 6.0627 10.1046 13.1359 2.1219 Constraint (T0340)I32.CB (T0340)L63.CB 4.8675 8.1125 10.5463 2.1219 Constraint (T0340)L46.CB (T0340)S87.CB 6.3243 10.5404 13.7026 2.0000 Constraint (T0340)P40.CB (T0340)K73.CB 6.9708 11.6181 15.1035 2.0000 Constraint (T0340)R27.CB (T0340)Q58.CB 7.0813 11.8021 15.3428 2.0000 Constraint (T0340)R27.CB (T0340)V55.CB 7.1042 11.8403 15.3924 2.0000 Constraint (T0340)R6.CB (T0340)A41.CB 7.0262 11.7103 15.2234 2.0000 Constraint (T0340)M2.CB (T0340)L82.CB 6.2802 10.4670 13.6071 2.0000 Constraint (T0340)M2.CB (T0340)I53.CB 6.2952 10.4919 13.6395 2.0000 Constraint (T0340)E61.CB (T0340)L90.CB 6.5247 10.8744 14.1368 2.0000 Constraint (T0340)I53.CB (T0340)L90.CB 6.7022 11.1704 14.5215 2.0000 Constraint (T0340)I53.CB (T0340)I72.CB 7.0481 11.7469 15.2709 2.0000 Constraint (T0340)R51.CB (T0340)L90.CB 5.5966 9.3276 12.1259 2.0000 Constraint (T0340)S1.CB (T0340)D50.CB 6.6381 11.0636 14.3826 2.0000 Constraint (T0340)S1.CB (T0340)R47.CB 5.1861 8.6435 11.2365 2.0000 Constraint (T0340)S26.CB (T0340)V55.CB 6.7135 11.1892 14.5460 2.0000 Constraint (T0340)S26.CB (T0340)V83.CB 5.9961 9.9935 12.9916 2.0000 Constraint (T0340)S1.CB (T0340)R51.CB 7.0809 11.8014 15.3419 1.9999 Constraint (T0340)S1.CB (T0340)S26.CB 7.0023 11.6705 15.1716 1.9999 Constraint (T0340)H9.CB (T0340)F19.CB 6.1908 10.3179 13.4133 1.9999 Constraint (T0340)S23.CB (T0340)L46.CB 6.1333 10.2222 13.2889 1.9999 Constraint (T0340)S23.CB (T0340)A41.CB 6.2833 10.4721 13.6137 1.9999 Constraint (T0340)S23.CB (T0340)V35.CB 6.3041 10.5068 13.6588 1.9999 Constraint (T0340)S23.CB (T0340)S34.CB 5.2411 8.7352 11.3557 1.9999 Constraint (T0340)H22.CB (T0340)L46.CB 6.4220 10.7033 13.9143 1.9999 Constraint (T0340)H22.CB (T0340)A41.CB 5.6721 9.4535 12.2896 1.9999 Constraint (T0340)H22.CB (T0340)S39.CB 6.5137 10.8562 14.1131 1.9999 Constraint (T0340)H22.CB (T0340)D36.CB 4.9583 8.2639 10.7430 1.9999 Constraint (T0340)R11.CB (T0340)V83.CB 6.8398 11.3996 14.8195 1.9999 Constraint (T0340)H9.CB (T0340)V84.CB 6.5888 10.9813 14.2757 1.9999 Constraint (T0340)M2.CB (T0340)S87.CB 6.3181 10.5301 13.6891 1.9999 Constraint (T0340)H22.CB (T0340)E67.CB 6.8583 11.4304 14.8596 1.9998 Constraint (T0340)I72.CB (T0340)L82.CB 6.0055 10.0091 13.0118 1.9998 Constraint (T0340)R11.CB (T0340)L82.CB 6.8663 11.4439 14.8771 1.9998 Constraint (T0340)C8.CB (T0340)P86.CB 6.2697 10.4494 13.5843 1.9998 Constraint (T0340)D50.CB (T0340)L90.CB 6.2441 10.4068 13.5289 1.9991 Constraint (T0340)Q49.CB (T0340)L90.CB 6.8113 11.3522 14.7579 1.9991 Constraint (T0340)R47.CB (T0340)L90.CB 5.9582 9.9304 12.9095 1.9991 Constraint (T0340)R6.CB (T0340)L90.CB 6.1480 10.2466 13.3206 1.9991 Constraint (T0340)P5.CB (T0340)L90.CB 6.8066 11.3443 14.7476 1.9991 Constraint (T0340)R4.CB (T0340)L90.CB 3.9270 6.5450 8.5085 1.9991 Constraint (T0340)L3.CB (T0340)L90.CB 5.1216 8.5360 11.0968 1.9991 Constraint (T0340)E54.CB (T0340)T88.CB 7.0293 11.7155 15.2302 1.5809 Constraint (T0340)L52.CB (T0340)T88.CB 6.2303 10.3838 13.4989 1.5809 Constraint (T0340)L46.CB (T0340)T88.CB 5.3732 8.9553 11.6418 1.5809 Constraint (T0340)P40.CB (T0340)A74.CB 6.7195 11.1991 14.5589 1.0000 Constraint (T0340)S34.CB (T0340)S44.CB 6.6475 11.0791 14.4028 1.0000 Constraint (T0340)Y31.CB (T0340)R89.CB 6.8328 11.3880 14.8044 1.0000 Constraint (T0340)P28.CB (T0340)S87.CB 6.8373 11.3955 14.8141 1.0000 Constraint (T0340)P28.CB (T0340)L81.CB 6.5377 10.8961 14.1649 1.0000 Constraint (T0340)R27.CB (T0340)V83.CB 5.7614 9.6023 12.4830 1.0000 Constraint (T0340)R27.CB (T0340)L82.CB 6.5393 10.8988 14.1684 1.0000 Constraint (T0340)R27.CB (T0340)D50.CB 6.1484 10.2473 13.3214 1.0000 Constraint (T0340)S26.CB (T0340)Q58.CB 7.0526 11.7544 15.2807 1.0000 Constraint (T0340)P14.CB (T0340)A70.CB 5.9229 9.8716 12.8331 1.0000 Constraint (T0340)P14.CB (T0340)V69.CB 6.1362 10.2271 13.2952 1.0000 Constraint (T0340)R11.CB (T0340)L52.CB 7.0828 11.8047 15.3460 1.0000 Constraint (T0340)R11.CB (T0340)V35.CB 6.7395 11.2324 14.6022 1.0000 Constraint (T0340)R11.CB (T0340)I32.CB 7.1548 11.9246 15.5020 1.0000 Constraint (T0340)H9.CB (T0340)I53.CB 6.5257 10.8761 14.1389 1.0000 Constraint (T0340)H9.CB (T0340)L52.CB 5.5264 9.2106 11.9738 1.0000 Constraint (T0340)H9.CB (T0340)D50.CB 5.4789 9.1315 11.8709 1.0000 Constraint (T0340)H9.CB (T0340)I32.CB 6.6243 11.0405 14.3526 1.0000 Constraint (T0340)L3.CB (T0340)S26.CB 6.0474 10.0790 13.1027 1.0000 Constraint (T0340)S1.CB (T0340)L46.CB 7.0391 11.7318 15.2513 1.0000 Constraint (T0340)S26.CB (T0340)L81.CB 6.6759 11.1265 14.4645 1.0000 Constraint (T0340)S26.CB (T0340)I72.CB 6.9592 11.5987 15.0783 1.0000 Constraint (T0340)S26.CB (T0340)S71.CB 6.8538 11.4230 14.8499 1.0000 Constraint (T0340)S23.CB (T0340)V83.CB 6.0250 10.0417 13.0543 1.0000 Constraint (T0340)S23.CB (T0340)L81.CB 6.0756 10.1260 13.1638 1.0000 Constraint (T0340)S23.CB (T0340)R47.CB 7.0751 11.7918 15.3293 1.0000 Constraint (T0340)S26.CB (T0340)L82.CB 6.9217 11.5362 14.9970 1.0000 Constraint (T0340)S26.CB (T0340)A48.CB 7.0027 11.6711 15.1725 1.0000 Constraint (T0340)S44.CB (T0340)P86.CB 7.0436 11.7393 15.2611 0.9999 Constraint (T0340)A41.CB (T0340)L82.CB 5.5818 9.3030 12.0939 0.9999 Constraint (T0340)P40.CB (T0340)L82.CB 6.5860 10.9767 14.2697 0.9999 Constraint (T0340)K25.CB (T0340)A70.CB 7.1655 11.9425 15.5253 0.9999 Constraint (T0340)S23.CB (T0340)L82.CB 5.9242 9.8736 12.8357 0.9999 Constraint (T0340)S23.CB (T0340)R80.CB 6.9116 11.5193 14.9751 0.9999 Constraint (T0340)S23.CB (T0340)K73.CB 6.5989 10.9981 14.2976 0.9999 Constraint (T0340)S23.CB (T0340)A70.CB 6.1787 10.2979 13.3873 0.9999 Constraint (T0340)H22.CB (T0340)K73.CB 7.0607 11.7678 15.2981 0.9999 Constraint (T0340)L21.CB (T0340)L82.CB 5.4872 9.1453 11.8889 0.9999 Constraint (T0340)L21.CB (T0340)R80.CB 5.4549 9.0915 11.8189 0.9999 Constraint (T0340)L21.CB (T0340)R75.CB 6.8546 11.4243 14.8517 0.9999 Constraint (T0340)L21.CB (T0340)S44.CB 6.0469 10.0781 13.1015 0.9999 Constraint (T0340)L21.CB (T0340)R43.CB 6.6650 11.1083 14.4408 0.9999 Constraint (T0340)L21.CB (T0340)A42.CB 5.4450 9.0750 11.7975 0.9999 Constraint (T0340)L21.CB (T0340)P40.CB 4.5531 7.5886 9.8651 0.9999 Constraint (T0340)L21.CB (T0340)S39.CB 4.3677 7.2795 9.4634 0.9999 Constraint (T0340)N20.CB (T0340)R80.CB 7.1110 11.8517 15.4072 0.9999 Constraint (T0340)N20.CB (T0340)S44.CB 6.4489 10.7482 13.9726 0.9999 Constraint (T0340)N20.CB (T0340)R43.CB 5.3914 8.9857 11.6814 0.9999 Constraint (T0340)N20.CB (T0340)P40.CB 3.4251 5.7085 7.4211 0.9999 Constraint (T0340)F19.CB (T0340)L82.CB 5.7131 9.5218 12.3783 0.9999 Constraint (T0340)F19.CB (T0340)R80.CB 3.9022 6.5036 8.4547 0.9999 Constraint (T0340)F19.CB (T0340)E78.CB 6.0749 10.1249 13.1624 0.9999 Constraint (T0340)K12.CB (T0340)L21.CB 6.3284 10.5473 13.7115 0.9999 Constraint (T0340)R11.CB (T0340)N20.CB 6.8366 11.3943 14.8125 0.9999 Constraint (T0340)C8.CB (T0340)L21.CB 6.3979 10.6631 13.8620 0.9999 Constraint (T0340)V60.CB (T0340)P86.CB 6.3322 10.5537 13.7199 0.9999 Constraint (T0340)N59.CB (T0340)P86.CB 6.0535 10.0891 13.1158 0.9999 Constraint (T0340)N59.CB (T0340)V83.CB 6.5592 10.9321 14.2117 0.9999 Constraint (T0340)Q58.CB (T0340)V84.CB 6.3149 10.5248 13.6822 0.9999 Constraint (T0340)Q58.CB (T0340)V83.CB 6.1125 10.1875 13.2437 0.9999 Constraint (T0340)N56.CB (T0340)V84.CB 6.3424 10.5706 13.7418 0.9999 Constraint (T0340)N56.CB (T0340)V83.CB 4.6613 7.7688 10.0995 0.9999 Constraint (T0340)V55.CB (T0340)P86.CB 6.7684 11.2806 14.6648 0.9999 Constraint (T0340)E54.CB (T0340)P86.CB 4.5604 7.6006 9.8808 0.9999 Constraint (T0340)P40.CB (T0340)V83.CB 6.6127 11.0211 14.3274 0.9999 Constraint (T0340)Y17.CB (T0340)L82.CB 6.6479 11.0799 14.4038 0.9999 Constraint (T0340)Q15.CB (T0340)L81.CB 5.9859 9.9764 12.9693 0.9999 Constraint (T0340)K12.CB (T0340)V35.CB 6.9348 11.5579 15.0253 0.9999 Constraint (T0340)L10.CB (T0340)V84.CB 6.7474 11.2456 14.6193 0.9999 Constraint (T0340)L7.CB (T0340)P86.CB 6.9365 11.5608 15.0291 0.9999 Constraint (T0340)L3.CB (T0340)L46.CB 6.3641 10.6068 13.7889 0.9999 Constraint (T0340)M2.CB (T0340)T88.CB 6.3783 10.6306 13.8197 0.9999 Constraint (T0340)R33.CB (T0340)S87.CB 6.0836 10.1394 13.1812 0.9981 Constraint (T0340)H22.CB (T0340)S87.CB 6.4278 10.7130 13.9270 0.9981 Constraint (T0340)I32.CB (T0340)T88.CB 6.7861 11.3101 14.7032 0.8736 Constraint (T0340)K25.CB (T0340)D50.CB 6.3220 10.5366 13.6976 0.8736 Constraint (T0340)R80.CB (T0340)R89.CB 6.4409 10.7348 13.9553 0.8073 Constraint (T0340)S44.CB (T0340)R89.CB 5.7619 9.6031 12.4840 0.8073 Constraint (T0340)A79.CB (T0340)L90.CB 4.7570 7.9284 10.3069 0.7073 Constraint (T0340)A79.CB (T0340)R89.CB 5.2317 8.7195 11.3354 0.7073 Constraint (T0340)A79.CB (T0340)T88.CB 3.1318 5.2197 6.7856 0.7073 Constraint (T0340)E78.CB (T0340)L90.CB 4.8890 8.1484 10.5929 0.7073 Constraint (T0340)E78.CB (T0340)R89.CB 3.4978 5.8297 7.5786 0.7073 Constraint (T0340)E78.CB (T0340)T88.CB 4.1108 6.8513 8.9067 0.7073 Constraint (T0340)D77.CB (T0340)L90.CB 2.5457 4.2428 5.5157 0.7073 Constraint (T0340)D77.CB (T0340)R89.CB 4.1120 6.8533 8.9093 0.7073 Constraint (T0340)D77.CB (T0340)T88.CB 3.9841 6.6402 8.6322 0.7073 Constraint (T0340)E76.CB (T0340)L90.CB 3.2040 5.3400 6.9419 0.7073 Constraint (T0340)E76.CB (T0340)R89.CB 3.7669 6.2782 8.1616 0.7073 Constraint (T0340)E76.CB (T0340)T88.CB 5.9855 9.9758 12.9686 0.7073 Constraint (T0340)R75.CB (T0340)L90.CB 3.8897 6.4829 8.4277 0.7073 Constraint (T0340)R75.CB (T0340)R89.CB 6.5888 10.9814 14.2758 0.7073 Constraint (T0340)R75.CB (T0340)T88.CB 5.5458 9.2430 12.0159 0.7073 Constraint (T0340)A74.CB (T0340)L90.CB 6.8010 11.3350 14.7354 0.7073 Constraint (T0340)K73.CB (T0340)L90.CB 5.9925 9.9875 12.9838 0.7073 Constraint (T0340)I72.CB (T0340)L90.CB 5.4082 9.0137 11.7178 0.7073 Constraint (T0340)I72.CB (T0340)T88.CB 4.9386 8.2309 10.7002 0.7073 Constraint (T0340)S71.CB (T0340)T88.CB 7.0539 11.7565 15.2834 0.7073 Constraint (T0340)V68.CB (T0340)T88.CB 6.9075 11.5125 14.9662 0.7073 Constraint (T0340)N56.CB (T0340)T88.CB 6.1865 10.3108 13.4040 0.7073 Constraint (T0340)V55.CB (T0340)T88.CB 5.9103 9.8505 12.8057 0.7073 Constraint (T0340)S44.CB (T0340)L90.CB 6.7503 11.2506 14.6257 0.7073 Constraint (T0340)S44.CB (T0340)T88.CB 3.5428 5.9047 7.6761 0.7073 Constraint (T0340)R43.CB (T0340)L90.CB 6.4042 10.6736 13.8757 0.7073 Constraint (T0340)R43.CB (T0340)R89.CB 4.7707 7.9511 10.3365 0.7073 Constraint (T0340)R43.CB (T0340)T88.CB 4.7588 7.9314 10.3108 0.7073 Constraint (T0340)A41.CB (T0340)T88.CB 5.4937 9.1561 11.9029 0.7073 Constraint (T0340)P40.CB (T0340)L90.CB 4.2003 7.0005 9.1006 0.7073 Constraint (T0340)P40.CB (T0340)R89.CB 4.0174 6.6956 8.7043 0.7073 Constraint (T0340)P40.CB (T0340)T88.CB 3.1855 5.3092 6.9020 0.7073 Constraint (T0340)S39.CB (T0340)L90.CB 5.5093 9.1821 11.9367 0.7073 Constraint (T0340)S39.CB (T0340)R89.CB 6.5062 10.8436 14.0967 0.7073 Constraint (T0340)S39.CB (T0340)T88.CB 5.6440 9.4066 12.2286 0.7073 Constraint (T0340)S39.CB (T0340)R75.CB 7.1718 11.9530 15.5389 0.7073 Constraint (T0340)A41.CB (T0340)V69.CB 7.0768 11.7946 15.3330 0.3000 Constraint (T0340)D36.CB (T0340)D50.CB 7.1788 11.9647 15.5541 0.3000 Constraint (T0340)D36.CB (T0340)Q49.CB 5.6326 9.3876 12.2039 0.3000 Constraint (T0340)V35.CB (T0340)V69.CB 7.0014 11.6690 15.1697 0.3000 Constraint (T0340)V35.CB (T0340)V68.CB 7.1005 11.8341 15.3843 0.3000 Constraint (T0340)V35.CB (T0340)H65.CB 6.1665 10.2775 13.3608 0.3000 Constraint (T0340)V35.CB (T0340)R51.CB 6.3092 10.5153 13.6699 0.3000 Constraint (T0340)L52.CB (T0340)R89.CB 7.1175 11.8625 15.4212 0.1000 Constraint (T0340)L46.CB (T0340)R89.CB 6.1598 10.2663 13.3461 0.1000 Constraint (T0340)R43.CB (T0340)R80.CB 6.8354 11.3923 14.8100 0.1000 Constraint (T0340)S39.CB (T0340)D77.CB 6.5583 10.9305 14.2096 0.1000 Constraint (T0340)R89.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: