parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 10.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint (T0340)V55.CB (T0340)I72.CB 3.8680 6.4467 8.3806 107.0345 Constraint (T0340)V55.CB (T0340)S71.CB 3.2583 5.4306 7.0597 107.0345 Constraint (T0340)V55.CB (T0340)V68.CB 4.3562 7.2604 9.4385 107.0345 Constraint (T0340)V35.CB (T0340)A48.CB 3.7441 6.2402 8.1123 107.0345 Constraint (T0340)V35.CB (T0340)R47.CB 4.1948 6.9913 9.0888 107.0345 Constraint (T0340)I32.CB (T0340)L52.CB 4.0464 6.7440 8.7672 107.0345 Constraint (T0340)I32.CB (T0340)Q49.CB 4.0879 6.8131 8.8570 107.0345 Constraint (T0340)I32.CB (T0340)A48.CB 3.4278 5.7130 7.4268 107.0345 Constraint (T0340)I32.CB (T0340)R47.CB 4.2262 7.0436 9.1567 107.0345 Constraint (T0340)Y31.CB (T0340)L52.CB 4.3830 7.3050 9.4965 107.0345 Constraint (T0340)Y31.CB (T0340)Q49.CB 4.0238 6.7063 8.7181 107.0345 Constraint (T0340)S34.CB (T0340)A48.CB 3.7344 6.2240 8.0912 106.0345 Constraint (T0340)R33.CB (T0340)A48.CB 3.8939 6.4898 8.4368 106.0345 Constraint (T0340)I32.CB (T0340)R51.CB 4.6835 7.8059 10.1477 106.0345 Constraint (T0340)I32.CB (T0340)D50.CB 2.8679 4.7799 6.2138 106.0345 Constraint (T0340)Y31.CB (T0340)R51.CB 3.3007 5.5011 7.1514 106.0345 Constraint (T0340)Y31.CB (T0340)D50.CB 4.1839 6.9732 9.0651 106.0345 Constraint (T0340)V55.CB (T0340)R80.CB 4.4394 7.3990 9.6187 105.0610 Constraint (T0340)Y31.CB (T0340)A48.CB 4.9524 8.2540 10.7302 104.6127 Constraint (T0340)N56.CB (T0340)R80.CB 3.3299 5.5499 7.2149 104.1609 Constraint (T0340)N56.CB (T0340)A79.CB 3.7520 6.2534 8.1294 104.1609 Constraint (T0340)V55.CB (T0340)A79.CB 3.9578 6.5963 8.5752 104.0611 Constraint (T0340)E54.CB (T0340)R80.CB 4.7881 7.9801 10.3742 104.0611 Constraint (T0340)L52.CB (T0340)V68.CB 4.2033 7.0055 9.1072 104.0348 Constraint (T0340)Q58.CB (T0340)S71.CB 3.8366 6.3943 8.3126 104.0348 Constraint (T0340)V35.CB (T0340)L46.CB 3.5887 5.9812 7.7755 104.0348 Constraint (T0340)I32.CB (T0340)L46.CB 3.6783 6.1304 7.9696 104.0348 Constraint (T0340)R33.CB (T0340)Q49.CB 5.0778 8.4631 11.0020 103.0345 Constraint (T0340)I53.CB (T0340)V84.CB 3.4769 5.7949 7.5333 102.8610 Constraint (T0340)L52.CB (T0340)V84.CB 4.9752 8.2920 10.7797 102.8610 Constraint (T0340)I32.CB (T0340)A41.CB 4.7146 7.8577 10.2150 102.0359 Constraint (T0340)N56.CB (T0340)S71.CB 4.5766 7.6277 9.9160 102.0345 Constraint (T0340)R51.CB (T0340)V84.CB 2.8837 4.8062 6.2481 101.8610 Constraint (T0340)V60.CB (T0340)S71.CB 4.3353 7.2255 9.3932 101.0359 Constraint (T0340)Q30.CB (T0340)V68.CB 3.1487 5.2479 6.8223 101.0345 Constraint (T0340)Q30.CB (T0340)L52.CB 2.8466 4.7444 6.1677 101.0345 Constraint (T0340)E54.CB (T0340)V83.CB 5.2304 8.7173 11.3324 100.8612 Constraint (T0340)I53.CB (T0340)V83.CB 4.0699 6.7831 8.8181 100.8612 Constraint (T0340)L52.CB (T0340)V83.CB 3.5291 5.8818 7.6464 100.8612 Constraint (T0340)Q30.CB (T0340)R51.CB 4.1122 6.8536 8.9097 100.0345 Constraint (T0340)R51.CB (T0340)V83.CB 3.8722 6.4536 8.3897 99.8612 Constraint (T0340)N56.CB (T0340)E78.CB 5.0631 8.4386 10.9702 99.0611 Constraint (T0340)Q30.CB (T0340)H65.CB 4.0426 6.7376 8.7589 98.9127 Constraint (T0340)D50.CB (T0340)V84.CB 4.0878 6.8130 8.8569 98.8613 Constraint (T0340)D50.CB (T0340)V83.CB 2.6627 4.4378 5.7691 98.8613 Constraint (T0340)N56.CB (T0340)L81.CB 4.8143 8.0238 10.4309 98.1609 Constraint (T0340)V55.CB (T0340)L81.CB 3.5004 5.8340 7.5842 98.1609 Constraint (T0340)Q30.CB (T0340)I53.CB 5.0351 8.3918 10.9094 98.0346 Constraint (T0340)Q30.CB (T0340)V60.CB 3.2977 5.4962 7.1451 98.0345 Constraint (T0340)H22.CB (T0340)S34.CB 5.3161 8.8602 11.5183 97.9918 Constraint (T0340)H22.CB (T0340)R33.CB 2.6417 4.4029 5.7237 97.9918 Constraint (T0340)H22.CB (T0340)I32.CB 4.7266 7.8777 10.2410 97.9918 Constraint (T0340)H22.CB (T0340)Y31.CB 3.1445 5.2408 6.8131 97.9918 Constraint (T0340)I32.CB (T0340)V83.CB 4.6192 7.6987 10.0084 97.8615 Constraint (T0340)L46.CB (T0340)V83.CB 4.1425 6.9041 8.9753 97.8615 Constraint (T0340)E54.CB (T0340)L81.CB 4.1892 6.9820 9.0766 97.1610 Constraint (T0340)L21.CB (T0340)V69.CB 4.3294 7.2157 9.3804 96.9918 Constraint (T0340)L21.CB (T0340)V68.CB 3.9776 6.6293 8.6181 96.9918 Constraint (T0340)L21.CB (T0340)L52.CB 4.0967 6.8278 8.8761 96.9918 Constraint (T0340)L21.CB (T0340)R33.CB 3.7317 6.2195 8.0854 96.9918 Constraint (T0340)L21.CB (T0340)I32.CB 3.5891 5.9818 7.7764 96.9918 Constraint (T0340)I53.CB (T0340)L81.CB 5.0394 8.3989 10.9186 96.0611 Constraint (T0340)L52.CB (T0340)L81.CB 3.5744 5.9574 7.7446 96.0611 Constraint (T0340)V55.CB (T0340)L82.CB 4.7191 7.8651 10.2247 96.0611 Constraint (T0340)E54.CB (T0340)L82.CB 2.4659 4.1099 5.3428 96.0611 Constraint (T0340)L21.CB (T0340)H65.CB 4.3713 7.2854 9.4711 95.9919 Constraint (T0340)L21.CB (T0340)Y31.CB 3.9226 6.5377 8.4990 95.9919 Constraint (T0340)F19.CB (T0340)D36.CB 4.0416 6.7359 8.7567 95.9918 Constraint (T0340)F19.CB (T0340)V35.CB 3.1150 5.1917 6.7492 95.9918 Constraint (T0340)R47.CB (T0340)V83.CB 5.0996 8.4994 11.0492 95.7396 Constraint (T0340)N56.CB (T0340)R75.CB 3.6530 6.0883 7.9147 95.2919 Constraint (T0340)I53.CB (T0340)L82.CB 2.9479 4.9132 6.3872 95.0612 Constraint (T0340)L52.CB (T0340)L82.CB 4.4626 7.4377 9.6690 95.0612 Constraint (T0340)F19.CB (T0340)S34.CB 4.0514 6.7523 8.7780 94.9919 Constraint (T0340)F19.CB (T0340)R33.CB 4.7453 7.9088 10.2814 94.9919 Constraint (T0340)F19.CB (T0340)I32.CB 3.2121 5.3535 6.9595 94.9919 Constraint (T0340)Y17.CB (T0340)I72.CB 4.2543 7.0906 9.2178 94.9919 Constraint (T0340)Y17.CB (T0340)D36.CB 5.2083 8.6805 11.2846 94.9919 Constraint (T0340)N20.CB (T0340)D36.CB 4.7408 7.9013 10.2717 94.9918 Constraint (T0340)N20.CB (T0340)V35.CB 4.7273 7.8789 10.2425 94.9918 Constraint (T0340)N20.CB (T0340)S34.CB 2.7001 4.5001 5.8502 94.9918 Constraint (T0340)V55.CB (T0340)R75.CB 4.1820 6.9701 9.0611 94.7067 Constraint (T0340)L21.CB (T0340)I72.CB 4.6305 7.7176 10.0328 93.9921 Constraint (T0340)Y17.CB (T0340)A79.CB 3.8743 6.4571 8.3943 93.9920 Constraint (T0340)N20.CB (T0340)R33.CB 2.7926 4.6543 6.0506 93.9919 Constraint (T0340)N20.CB (T0340)I32.CB 4.2429 7.0714 9.1929 93.9919 Constraint (T0340)Q30.CB (T0340)D50.CB 5.7020 9.5033 12.3543 93.7349 Constraint (T0340)L46.CB (T0340)L81.CB 4.5574 7.5957 9.8744 93.0614 Constraint (T0340)Q30.CB (T0340)V55.CB 5.4823 9.1372 11.8784 93.0346 Constraint (T0340)F19.CB (T0340)A41.CB 2.6630 4.4383 5.7698 92.9931 Constraint (T0340)F19.CB (T0340)L46.CB 3.7946 6.3243 8.2215 92.9921 Constraint (T0340)F19.CB (T0340)P40.CB 5.0273 8.3788 10.8924 92.9921 Constraint (T0340)F19.CB (T0340)A48.CB 5.2147 8.6911 11.2985 92.9921 Constraint (T0340)D50.CB (T0340)L81.CB 5.2240 8.7067 11.3187 92.8613 Constraint (T0340)S23.CB (T0340)H65.CB 3.3986 5.6643 7.3635 91.9978 Constraint (T0340)Y17.CB (T0340)A41.CB 3.2295 5.3824 6.9972 91.9932 Constraint (T0340)F19.CB (T0340)A42.CB 4.9835 8.3059 10.7976 91.9931 Constraint (T0340)Y17.CB (T0340)L46.CB 5.2478 8.7463 11.3702 91.9922 Constraint (T0340)Y17.CB (T0340)P40.CB 3.1422 5.2370 6.8081 91.9922 Constraint (T0340)Y17.CB (T0340)S39.CB 4.1809 6.9682 9.0586 91.9922 Constraint (T0340)Y17.CB (T0340)V35.CB 5.6338 9.3896 12.2065 91.9919 Constraint (T0340)L21.CB (T0340)S34.CB 5.3485 8.9142 11.5885 91.9918 Constraint (T0340)V35.CB (T0340)D50.CB 5.4688 9.1147 11.8491 91.0345 Constraint (T0340)H22.CB (T0340)H65.CB 4.5392 7.5654 9.8350 90.9975 Constraint (T0340)L21.CB (T0340)Q30.CB 3.1671 5.2786 6.8621 90.9919 Constraint (T0340)P40.CB (T0340)A79.CB 5.2246 8.7077 11.3200 90.9465 Constraint (T0340)N59.CB (T0340)L82.CB 5.3306 8.8843 11.5495 90.8616 Constraint (T0340)N56.CB (T0340)L82.CB 5.6118 9.3530 12.1589 90.0613 Constraint (T0340)F19.CB (T0340)S39.CB 4.2706 7.1177 9.2530 89.9924 Constraint (T0340)R11.CB (T0340)A79.CB 4.5875 7.6458 9.9396 89.9921 Constraint (T0340)L10.CB (T0340)R80.CB 4.6204 7.7007 10.0109 89.9921 Constraint (T0340)L10.CB (T0340)P40.CB 3.1320 5.2199 6.7859 89.9921 Constraint (T0340)Q30.CB (T0340)L63.CB 4.3089 7.1815 9.3359 89.1140 Constraint (T0340)V60.CB (T0340)L82.CB 5.3380 8.8967 11.5657 89.0614 Constraint (T0340)L10.CB (T0340)A79.CB 2.9172 4.8621 6.3207 88.9922 Constraint (T0340)L10.CB (T0340)L46.CB 4.7639 7.9399 10.3219 88.9921 Constraint (T0340)H9.CB (T0340)R80.CB 3.0357 5.0596 6.5774 87.9921 Constraint (T0340)R11.CB (T0340)P40.CB 3.8877 6.4795 8.4233 86.9978 Constraint (T0340)H9.CB (T0340)A79.CB 4.2975 7.1625 9.3112 86.9922 Constraint (T0340)C8.CB (T0340)R80.CB 4.2773 7.1288 9.2675 86.9922 Constraint (T0340)F19.CB (T0340)I72.CB 5.3007 8.8345 11.4849 86.9921 Constraint (T0340)C8.CB (T0340)L46.CB 3.6843 6.1405 7.9826 86.9921 Constraint (T0340)L7.CB (T0340)E54.CB 5.2331 8.7218 11.3384 86.9921 Constraint (T0340)R11.CB (T0340)E78.CB 3.3902 5.6503 7.3454 86.9921 Constraint (T0340)R51.CB (T0340)V60.CB 5.3467 8.9112 11.5845 86.0349 Constraint (T0340)Q30.CB (T0340)E61.CB 4.9840 8.3066 10.7986 86.0345 Constraint (T0340)S23.CB (T0340)R33.CB 5.2505 8.7508 11.3760 85.9981 Constraint (T0340)N20.CB (T0340)A48.CB 5.3645 8.9409 11.6232 85.9935 Constraint (T0340)L7.CB (T0340)R80.CB 3.8451 6.4085 8.3311 85.9923 Constraint (T0340)L10.CB (T0340)E78.CB 4.2746 7.1243 9.2616 85.9922 Constraint (T0340)F19.CB (T0340)D50.CB 5.4317 9.0528 11.7687 85.9919 Constraint (T0340)L10.CB (T0340)S44.CB 3.5170 5.8617 7.6202 84.9934 Constraint (T0340)C8.CB (T0340)V83.CB 3.7324 6.2207 8.0869 84.9924 Constraint (T0340)C8.CB (T0340)A79.CB 5.1354 8.5590 11.1267 84.9923 Constraint (T0340)R6.CB (T0340)V84.CB 4.6854 7.8090 10.1517 84.9922 Constraint (T0340)C8.CB (T0340)S44.CB 3.7136 6.1893 8.0460 84.9921 Constraint (T0340)R51.CB (T0340)L82.CB 5.7072 9.5120 12.3657 84.9408 Constraint (T0340)L10.CB (T0340)A41.CB 3.7587 6.2645 8.1439 83.9934 Constraint (T0340)N20.CB (T0340)Y31.CB 5.6716 9.4526 12.2884 83.9922 Constraint (T0340)I72.CB (T0340)L81.CB 5.3020 8.8366 11.4876 83.1670 Constraint (T0340)V60.CB (T0340)L81.CB 5.4389 9.0648 11.7842 83.0624 Constraint (T0340)F19.CB (T0340)L52.CB 5.4886 9.1477 11.8920 82.9976 Constraint (T0340)Y17.CB (T0340)L81.CB 5.1744 8.6241 11.2113 82.9976 Constraint (T0340)R6.CB (T0340)D50.CB 5.0532 8.4220 10.9486 82.9924 Constraint (T0340)L7.CB (T0340)V83.CB 4.7270 7.8783 10.2418 82.9924 Constraint (T0340)R6.CB (T0340)V83.CB 3.3261 5.5435 7.2065 82.9924 Constraint (T0340)Y17.CB (T0340)R75.CB 5.1754 8.6257 11.2134 82.9923 Constraint (T0340)H9.CB (T0340)E78.CB 3.7540 6.2567 8.1337 82.9923 Constraint (T0340)A41.CB (T0340)L81.CB 5.3043 8.8404 11.4925 82.9405 Constraint (T0340)I32.CB (T0340)L81.CB 5.5126 9.1877 11.9440 82.3141 Constraint (T0340)L52.CB (T0340)I72.CB 5.1671 8.6118 11.1954 82.1159 Constraint (T0340)C8.CB (T0340)A41.CB 5.0244 8.3739 10.8861 81.9934 Constraint (T0340)L10.CB (T0340)L81.CB 4.1659 6.9432 9.0261 81.9921 Constraint (T0340)H9.CB (T0340)L81.CB 4.6344 7.7240 10.0412 81.9921 Constraint (T0340)C8.CB (T0340)L81.CB 3.0123 5.0205 6.5266 81.9921 Constraint (T0340)K12.CB (T0340)P40.CB 3.6804 6.1341 7.9743 80.9934 Constraint (T0340)P5.CB (T0340)I53.CB 4.2501 7.0836 9.2086 80.9925 Constraint (T0340)K12.CB (T0340)A79.CB 4.0297 6.7162 8.7310 80.9921 Constraint (T0340)Y17.CB (T0340)S44.CB 5.5070 9.1783 11.9318 79.9935 Constraint (T0340)C8.CB (T0340)L82.CB 4.6067 7.6778 9.9811 79.9923 Constraint (T0340)Q30.CB (T0340)V69.CB 5.2314 8.7190 11.3347 79.7351 Constraint (T0340)L10.CB (T0340)F19.CB 5.1900 8.6500 11.2450 78.9978 Constraint (T0340)P5.CB (T0340)V84.CB 3.1994 5.3324 6.9321 78.9925 Constraint (T0340)L7.CB (T0340)L81.CB 4.3596 7.2660 9.4458 78.9922 Constraint (T0340)R11.CB (T0340)D77.CB 3.9030 6.5050 8.4565 78.9921 Constraint (T0340)P5.CB (T0340)V83.CB 4.2523 7.0872 9.2134 77.9926 Constraint (T0340)L7.CB (T0340)L82.CB 3.2658 5.4429 7.0758 77.9923 Constraint (T0340)K12.CB (T0340)D77.CB 3.5943 5.9904 7.7876 77.9921 Constraint (T0340)Q49.CB (T0340)V83.CB 5.7812 9.6354 12.5260 77.7396 Constraint (T0340)V60.CB (T0340)I72.CB 5.4051 9.0084 11.7110 77.0422 Constraint (T0340)Q30.CB (T0340)E67.CB 5.3509 8.9181 11.5935 77.0421 Constraint (T0340)N20.CB (T0340)A41.CB 5.6739 9.4565 12.2935 76.9995 Constraint (T0340)F19.CB (T0340)L81.CB 5.5328 9.2214 11.9878 76.9980 Constraint (T0340)S23.CB (T0340)R64.CB 5.2797 8.7995 11.4394 76.9980 Constraint (T0340)S23.CB (T0340)V68.CB 4.7353 7.8922 10.2599 76.9978 Constraint (T0340)R6.CB (T0340)L82.CB 4.3962 7.3270 9.5251 76.9924 Constraint (T0340)K12.CB (T0340)E78.CB 4.5241 7.5402 9.8022 76.9922 Constraint (T0340)N56.CB (T0340)I72.CB 5.2453 8.7421 11.3647 76.2980 Constraint (T0340)R51.CB (T0340)P86.CB 4.4228 7.3713 9.5826 75.9942 Constraint (T0340)C8.CB (T0340)D50.CB 5.2802 8.8003 11.4404 75.9937 Constraint (T0340)H9.CB (T0340)S44.CB 4.4807 7.4679 9.7083 75.9934 Constraint (T0340)R11.CB (T0340)S44.CB 5.2345 8.7242 11.3415 75.9934 Constraint (T0340)K12.CB (T0340)E76.CB 4.5655 7.6092 9.8920 74.9923 Constraint (T0340)L10.CB (T0340)R43.CB 5.1188 8.5314 11.0908 73.9934 Constraint (T0340)L21.CB (T0340)D50.CB 5.7525 9.5875 12.4637 73.9921 Constraint (T0340)D24.CB (T0340)H65.CB 3.3546 5.5910 7.2683 73.7451 Constraint (T0340)D50.CB (T0340)P86.CB 4.4905 7.4842 9.7294 73.7429 Constraint (T0340)Q30.CB (T0340)R64.CB 5.3190 8.8650 11.5245 73.2983 Constraint (T0340)R6.CB (T0340)L81.CB 5.2074 8.6790 11.2827 72.9924 Constraint (T0340)Q58.CB (T0340)V68.CB 5.3020 8.8367 11.4878 72.2924 Constraint (T0340)P5.CB (T0340)L82.CB 3.6972 6.1620 8.0106 71.9926 Constraint (T0340)K12.CB (T0340)R75.CB 4.5366 7.5610 9.8293 71.9922 Constraint (T0340)Q58.CB (T0340)E67.CB 5.4553 9.0922 11.8199 71.7410 Constraint (T0340)V35.CB (T0340)S44.CB 5.6147 9.3578 12.1651 71.7362 Constraint (T0340)L52.CB (T0340)L63.CB 5.3891 8.9818 11.6763 71.1215 Constraint (T0340)L10.CB (T0340)S39.CB 5.2812 8.8019 11.4425 70.9981 Constraint (T0340)L21.CB (T0340)V60.CB 5.5009 9.1681 11.9186 70.9920 Constraint (T0340)Q49.CB (T0340)P86.CB 3.5463 5.9105 7.6836 69.9956 Constraint (T0340)P5.CB (T0340)R51.CB 5.6422 9.4036 12.2247 69.9937 Constraint (T0340)R6.CB (T0340)L46.CB 5.3536 8.9227 11.5995 69.9927 Constraint (T0340)S44.CB (T0340)L81.CB 5.3797 8.9661 11.6560 69.3212 Constraint (T0340)L10.CB (T0340)R75.CB 5.4325 9.0541 11.7704 68.9983 Constraint (T0340)A41.CB (T0340)D50.CB 5.6685 9.4474 12.2817 68.1207 Constraint (T0340)R33.CB (T0340)D50.CB 5.8060 9.6766 12.5796 68.1198 Constraint (T0340)P28.CB (T0340)E61.CB 4.3068 7.1781 9.3315 67.7348 Constraint (T0340)L52.CB (T0340)E61.CB 5.3024 8.8373 11.4885 67.6206 Constraint (T0340)L52.CB (T0340)S71.CB 5.6257 9.3761 12.1890 65.9994 Constraint (T0340)F19.CB (T0340)R47.CB 5.6274 9.3790 12.1927 65.9981 Constraint (T0340)P5.CB (T0340)E54.CB 5.5371 9.2285 11.9970 65.9939 Constraint (T0340)N56.CB (T0340)A74.CB 5.2719 8.7864 11.4224 64.9992 Constraint (T0340)Y17.CB (T0340)A42.CB 5.7752 9.6254 12.5130 64.9938 Constraint (T0340)R51.CB (T0340)E61.CB 5.1272 8.5453 11.1089 64.9927 Constraint (T0340)L10.CB (T0340)D77.CB 5.6195 9.3659 12.1757 64.9926 Constraint (T0340)Q30.CB (T0340)I72.CB 5.4699 9.1166 11.8515 64.6203 Constraint (T0340)A41.CB (T0340)A79.CB 5.6309 9.3848 12.2002 63.9995 Constraint (T0340)V55.CB (T0340)A74.CB 5.4902 9.1503 11.8954 62.9994 Constraint (T0340)R11.CB (T0340)R43.CB 5.3515 8.9191 11.5948 62.9991 Constraint (T0340)C8.CB (T0340)L52.CB 5.6724 9.4540 12.2903 60.9922 Constraint (T0340)H22.CB (T0340)A48.CB 5.7318 9.5530 12.4189 59.9996 Constraint (T0340)Y31.CB (T0340)V83.CB 5.5761 9.2934 12.0814 59.9983 Constraint (T0340)L21.CB (T0340)R51.CB 5.7124 9.5207 12.3769 58.9924 Constraint (T0340)R4.CB (T0340)V84.CB 4.3173 7.1955 9.3542 57.9983 Constraint (T0340)Q49.CB (T0340)V84.CB 5.7885 9.6476 12.5418 57.8686 Constraint (T0340)R11.CB (T0340)E76.CB 5.4288 9.0480 11.7624 55.9928 Constraint (T0340)Y17.CB (T0340)K73.CB 5.3542 8.9237 11.6009 55.9925 Constraint (T0340)Y31.CB (T0340)V84.CB 5.7249 9.5415 12.4039 54.1209 Constraint (T0340)E54.CB (T0340)S71.CB 5.5057 9.1762 11.9291 53.9995 Constraint (T0340)S23.CB (T0340)R51.CB 5.0702 8.4504 10.9855 53.9986 Constraint (T0340)S23.CB (T0340)L63.CB 5.2537 8.7562 11.3831 53.9980 Constraint (T0340)R6.CB (T0340)I53.CB 5.8420 9.7367 12.6577 51.9996 Constraint (T0340)D24.CB (T0340)R64.CB 3.6640 6.1067 7.9388 50.9985 Constraint (T0340)Q58.CB (T0340)R75.CB 5.3203 8.8672 11.5274 50.9984 Constraint (T0340)S23.CB (T0340)V60.CB 5.2641 8.7734 11.4054 50.9981 Constraint (T0340)D50.CB (T0340)L82.CB 5.8485 9.7475 12.6717 50.9454 Constraint (T0340)K25.CB (T0340)H65.CB 4.2275 7.0458 9.1595 49.7454 Constraint (T0340)P28.CB (T0340)R51.CB 5.2204 8.7006 11.3108 49.7412 Constraint (T0340)V55.CB (T0340)E67.CB 5.4055 9.0091 11.7119 48.0424 Constraint (T0340)D24.CB (T0340)V68.CB 3.9636 6.6060 8.5878 47.9996 Constraint (T0340)P14.CB (T0340)D77.CB 4.8327 8.0545 10.4708 47.9993 Constraint (T0340)N56.CB (T0340)E76.CB 4.5209 7.5349 9.7954 47.9993 Constraint (T0340)Y17.CB (T0340)I32.CB 5.8132 9.6887 12.5953 47.9921 Constraint (T0340)E61.CB (T0340)V84.CB 5.6723 9.4539 12.2900 46.9995 Constraint (T0340)L3.CB (T0340)V84.CB 3.9223 6.5372 8.4983 46.9986 Constraint (T0340)S23.CB (T0340)L52.CB 5.0791 8.4652 11.0047 46.9982 Constraint (T0340)K25.CB (T0340)R64.CB 3.7758 6.2930 8.1809 46.9982 Constraint (T0340)R27.CB (T0340)E61.CB 4.7177 7.8629 10.2218 46.9981 Constraint (T0340)P28.CB (T0340)H65.CB 5.3675 8.9458 11.6295 46.9928 Constraint (T0340)Q15.CB (T0340)S39.CB 4.4607 7.4346 9.6649 45.9979 Constraint (T0340)P28.CB (T0340)L63.CB 5.1566 8.5943 11.1726 45.9979 Constraint (T0340)Q30.CB (T0340)V83.CB 5.7609 9.6015 12.4819 45.9939 Constraint (T0340)Y31.CB (T0340)H65.CB 5.5649 9.2749 12.0574 45.9189 Constraint (T0340)Q58.CB (T0340)L82.CB 5.8349 9.7248 12.6423 45.1160 Constraint (T0340)Q30.CB (T0340)S71.CB 5.6147 9.3579 12.1653 44.9992 Constraint (T0340)Q15.CB (T0340)P40.CB 4.4427 7.4046 9.6259 44.9980 Constraint (T0340)H9.CB (T0340)P40.CB 5.6594 9.4323 12.2620 44.9979 Constraint (T0340)L10.CB (T0340)I72.CB 5.6528 9.4214 12.2478 43.9983 Constraint (T0340)P40.CB (T0340)E78.CB 5.6934 9.4890 12.3358 42.1996 Constraint (T0340)D24.CB (T0340)L63.CB 3.9982 6.6637 8.6628 41.9998 Constraint (T0340)Y17.CB (T0340)V55.CB 5.5883 9.3139 12.1080 41.9979 Constraint (T0340)Y31.CB (T0340)P86.CB 4.8530 8.0883 10.5148 41.9959 Constraint (T0340)Q30.CB (T0340)E54.CB 5.8362 9.7269 12.6450 41.1200 Constraint (T0340)K12.CB (T0340)I72.CB 5.5651 9.2752 12.0578 40.9924 Constraint (T0340)D24.CB (T0340)A66.CB 4.7111 7.8519 10.2075 40.7472 Constraint (T0340)F19.CB (T0340)S44.CB 5.6956 9.4927 12.3405 39.9993 Constraint (T0340)N20.CB (T0340)V69.CB 5.4388 9.0646 11.7840 39.9984 Constraint (T0340)R4.CB (T0340)V83.CB 5.5215 9.2024 11.9632 39.9983 Constraint (T0340)S34.CB (T0340)R47.CB 5.6662 9.4437 12.2768 39.7424 Constraint (T0340)P28.CB (T0340)V60.CB 5.0371 8.3952 10.9138 39.6131 Constraint (T0340)S44.CB (T0340)A79.CB 5.5937 9.3228 12.1196 38.9999 Constraint (T0340)L7.CB (T0340)I53.CB 5.7391 9.5652 12.4348 38.9998 Constraint (T0340)R47.CB (T0340)P86.CB 4.5634 7.6057 9.8874 38.9995 Constraint (T0340)D24.CB (T0340)V60.CB 4.9634 8.2724 10.7541 38.0000 Constraint (T0340)Y17.CB (T0340)E78.CB 5.6038 9.3396 12.1415 37.9997 Constraint (T0340)S23.CB (T0340)I32.CB 5.4446 9.0744 11.7967 37.9986 Constraint (T0340)K12.CB (T0340)S39.CB 5.2244 8.7073 11.3195 37.9985 Constraint (T0340)H9.CB (T0340)N56.CB 5.7354 9.5589 12.4266 37.9929 Constraint (T0340)S26.CB (T0340)R64.CB 4.3806 7.3011 9.4914 36.9991 Constraint (T0340)V55.CB (T0340)A70.CB 5.6645 9.4409 12.2731 36.2997 Constraint (T0340)E54.CB (T0340)L63.CB 5.6868 9.4779 12.3213 35.9929 Constraint (T0340)D24.CB (T0340)E67.CB 4.5045 7.5074 9.7597 35.0000 Constraint (T0340)A48.CB (T0340)P86.CB 5.1459 8.5764 11.1494 34.9996 Constraint (T0340)L10.CB (T0340)A42.CB 5.8510 9.7516 12.6771 34.9986 Constraint (T0340)D24.CB (T0340)V69.CB 5.1801 8.6335 11.2236 33.9999 Constraint (T0340)H22.CB (T0340)L52.CB 5.8261 9.7102 12.6232 33.9995 Constraint (T0340)C8.CB (T0340)P40.CB 5.6757 9.4595 12.2973 33.9983 Constraint (T0340)P14.CB (T0340)P40.CB 5.4638 9.1064 11.8383 33.9959 Constraint (T0340)P14.CB (T0340)E76.CB 4.7870 7.9783 10.3717 33.9929 Constraint (T0340)R27.CB (T0340)R51.CB 5.2733 8.7888 11.4254 33.7409 Constraint (T0340)Q15.CB (T0340)D36.CB 4.9376 8.2294 10.6982 32.9986 Constraint (T0340)N59.CB (T0340)S71.CB 5.6192 9.3653 12.1750 32.9985 Constraint (T0340)Q58.CB (T0340)A74.CB 5.4839 9.1399 11.8819 32.9985 Constraint (T0340)F19.CB (T0340)A79.CB 5.6758 9.4597 12.2976 32.9983 Constraint (T0340)K12.CB (T0340)A41.CB 5.4858 9.1429 11.8858 32.9942 Constraint (T0340)E54.CB (T0340)V84.CB 5.6216 9.3693 12.1801 32.8686 Constraint (T0340)V35.CB (T0340)Q49.CB 5.7687 9.6144 12.4988 32.0364 Constraint (T0340)Q58.CB (T0340)I72.CB 5.3126 8.8544 11.5107 31.9984 Constraint (T0340)H22.CB (T0340)Q49.CB 5.6726 9.4543 12.2905 31.9983 Constraint (T0340)S23.CB (T0340)A66.CB 5.4762 9.1270 11.8651 31.9979 Constraint (T0340)H22.CB (T0340)R51.CB 5.8272 9.7121 12.6257 31.9939 Constraint (T0340)S26.CB (T0340)H65.CB 4.5602 7.6003 9.8803 31.8732 Constraint (T0340)V55.CB (T0340)V69.CB 5.7659 9.6098 12.4928 31.2984 Constraint (T0340)S23.CB (T0340)V69.CB 5.1754 8.6257 11.2135 30.9980 Constraint (T0340)D24.CB (T0340)R51.CB 4.2986 7.1644 9.3137 30.7069 Constraint (T0340)R11.CB (T0340)R80.CB 5.7529 9.5882 12.4647 29.9997 Constraint (T0340)L3.CB (T0340)P86.CB 3.9330 6.5549 8.5214 29.9985 Constraint (T0340)H22.CB (T0340)V68.CB 5.7450 9.5751 12.4476 29.9983 Constraint (T0340)P40.CB (T0340)D77.CB 5.7654 9.6091 12.4918 29.9689 Constraint (T0340)D36.CB (T0340)L46.CB 5.6944 9.4907 12.3380 29.9192 Constraint (T0340)E54.CB (T0340)V68.CB 5.7510 9.5849 12.4604 29.0408 Constraint (T0340)R27.CB (T0340)R64.CB 4.9098 8.1830 10.6379 28.9998 Constraint (T0340)R6.CB (T0340)R47.CB 5.2223 8.7038 11.3149 28.9986 Constraint (T0340)S71.CB (T0340)L81.CB 5.6074 9.3456 12.1493 28.8469 Constraint (T0340)K25.CB (T0340)E67.CB 5.1105 8.5175 11.0727 27.9986 Constraint (T0340)K25.CB (T0340)L63.CB 4.4163 7.3605 9.5686 27.9986 Constraint (T0340)P28.CB (T0340)R64.CB 5.1272 8.5453 11.1089 27.9986 Constraint (T0340)V68.CB (T0340)L81.CB 5.5055 9.1758 11.9286 27.8687 Constraint (T0340)I53.CB (T0340)L63.CB 5.7955 9.6591 12.5568 26.9986 Constraint (T0340)R4.CB (T0340)P86.CB 4.7730 7.9550 10.3415 26.9982 Constraint (T0340)Q30.CB (T0340)L81.CB 5.8403 9.7338 12.6539 26.8629 Constraint (T0340)R27.CB (T0340)L63.CB 4.6440 7.7399 10.0619 25.9998 Constraint (T0340)Q58.CB (T0340)R80.CB 5.8582 9.7637 12.6928 25.9998 Constraint (T0340)L10.CB (T0340)V55.CB 5.5643 9.2739 12.0561 25.9981 Constraint (T0340)Q49.CB (T0340)S87.CB 5.0088 8.3480 10.8524 25.9978 Constraint (T0340)R51.CB (T0340)S87.CB 5.3654 8.9423 11.6251 25.9963 Constraint (T0340)V55.CB (T0340)V83.CB 5.7331 9.5551 12.4217 24.9998 Constraint (T0340)Q15.CB (T0340)D77.CB 5.4457 9.0762 11.7991 24.9997 Constraint (T0340)C8.CB (T0340)R43.CB 5.7089 9.5148 12.3692 24.9983 Constraint (T0340)L52.CB (T0340)H65.CB 5.6884 9.4806 12.3248 24.9206 Constraint (T0340)N56.CB (T0340)D77.CB 5.2938 8.8230 11.4699 24.1922 Constraint (T0340)E61.CB (T0340)L82.CB 5.7126 9.5210 12.3772 23.9997 Constraint (T0340)L63.CB (T0340)I72.CB 5.8921 9.8201 12.7661 23.9987 Constraint (T0340)C8.CB (T0340)R47.CB 5.4439 9.0732 11.7952 23.9986 Constraint (T0340)Q58.CB (T0340)A70.CB 5.5311 9.2185 11.9841 23.9984 Constraint (T0340)K25.CB (T0340)A66.CB 4.9606 8.2676 10.7479 23.7456 Constraint (T0340)Y31.CB (T0340)V68.CB 5.7963 9.6604 12.5586 23.1212 Constraint (T0340)D24.CB (T0340)L52.CB 5.1648 8.6080 11.1905 23.0000 Constraint (T0340)K25.CB (T0340)V68.CB 5.4995 9.1658 11.9155 22.9986 Constraint (T0340)Q15.CB (T0340)K73.CB 4.1888 6.9813 9.0757 22.9945 Constraint (T0340)I32.CB (T0340)P86.CB 5.3135 8.8559 11.5126 21.9960 Constraint (T0340)P28.CB (T0340)I53.CB 4.3242 7.2070 9.3691 21.7423 Constraint (T0340)V60.CB (T0340)V69.CB 5.5404 9.2339 12.0041 21.2979 Constraint (T0340)V60.CB (T0340)V83.CB 5.7468 9.5780 12.4514 21.1214 Constraint (T0340)V55.CB (T0340)K73.CB 5.9024 9.8373 12.7885 20.9987 Constraint (T0340)R33.CB (T0340)H65.CB 5.5469 9.2449 12.0184 20.9203 Constraint (T0340)S34.CB (T0340)L46.CB 5.7832 9.6387 12.5302 20.1216 Constraint (T0340)Q30.CB (T0340)A66.CB 5.3536 8.9226 11.5994 20.0424 Constraint (T0340)C8.CB (T0340)F19.CB 5.8722 9.7870 12.7231 19.9999 Constraint (T0340)L21.CB (T0340)L63.CB 5.7012 9.5021 12.3527 19.9984 Constraint (T0340)K12.CB (T0340)K73.CB 5.4644 9.1073 11.8395 19.9984 Constraint (T0340)L21.CB (T0340)V55.CB 5.3860 8.9767 11.6697 19.9982 Constraint (T0340)S34.CB (T0340)Q49.CB 5.6957 9.4929 12.3407 19.9206 Constraint (T0340)N59.CB (T0340)V68.CB 5.4398 9.0663 11.7861 19.2925 Constraint (T0340)R6.CB (T0340)S44.CB 5.7390 9.5650 12.4345 18.9996 Constraint (T0340)P28.CB (T0340)N59.CB 5.0327 8.3879 10.9042 18.7423 Constraint (T0340)S44.CB (T0340)R80.CB 5.6037 9.3395 12.1414 18.2999 Constraint (T0340)S44.CB (T0340)V83.CB 5.6111 9.3519 12.1575 18.1217 Constraint (T0340)C8.CB (T0340)I32.CB 5.8427 9.7379 12.6592 17.9999 Constraint (T0340)C8.CB (T0340)Y17.CB 5.7200 9.5333 12.3932 17.9999 Constraint (T0340)L10.CB (T0340)E76.CB 5.7000 9.4999 12.3499 17.9999 Constraint (T0340)R4.CB (T0340)S87.CB 4.5369 7.5614 9.8299 17.9996 Constraint (T0340)P14.CB (T0340)S39.CB 5.4281 9.0468 11.7609 17.9987 Constraint (T0340)L3.CB (T0340)S87.CB 4.4529 7.4214 9.6479 17.9986 Constraint (T0340)S26.CB (T0340)A66.CB 4.9852 8.3086 10.8012 17.0000 Constraint (T0340)K25.CB (T0340)E61.CB 5.3812 8.9687 11.6593 16.9999 Constraint (T0340)M2.CB (T0340)V84.CB 5.3585 8.9308 11.6101 16.9999 Constraint (T0340)L21.CB (T0340)L81.CB 5.9051 9.8419 12.7944 16.9998 Constraint (T0340)L7.CB (T0340)S44.CB 5.5833 9.3055 12.0972 16.9996 Constraint (T0340)D24.CB (T0340)E61.CB 5.4108 9.0180 11.7234 16.9996 Constraint (T0340)N20.CB (T0340)H65.CB 5.6431 9.4052 12.2268 16.9994 Constraint (T0340)Y17.CB (T0340)R43.CB 5.7690 9.6151 12.4996 16.9941 Constraint (T0340)P28.CB (T0340)V84.CB 5.1088 8.5147 11.0691 16.8687 Constraint (T0340)D24.CB (T0340)R33.CB 4.9335 8.2226 10.6894 16.7470 Constraint (T0340)L3.CB (T0340)R51.CB 4.9679 8.2799 10.7638 15.9998 Constraint (T0340)D24.CB (T0340)Q49.CB 5.6220 9.3700 12.1810 15.9997 Constraint (T0340)Q15.CB (T0340)I72.CB 4.9215 8.2024 10.6632 15.9997 Constraint (T0340)S44.CB (T0340)E78.CB 5.8257 9.7096 12.6224 15.1999 Constraint (T0340)Y17.CB (T0340)D77.CB 5.4472 9.0787 11.8024 15.0000 Constraint (T0340)V55.CB (T0340)E76.CB 5.6099 9.3498 12.1548 15.0000 Constraint (T0340)L52.CB (T0340)A79.CB 5.8402 9.7336 12.6537 14.9999 Constraint (T0340)F19.CB (T0340)Y31.CB 5.8879 9.8132 12.7572 14.9994 Constraint (T0340)H9.CB (T0340)R43.CB 5.6593 9.4321 12.2618 14.9986 Constraint (T0340)Q15.CB (T0340)E76.CB 5.1230 8.5383 11.0998 14.9952 Constraint (T0340)Q30.CB (T0340)N59.CB 5.6256 9.3759 12.1887 14.4200 Constraint (T0340)R27.CB (T0340)H65.CB 4.4609 7.4348 9.6652 13.9998 Constraint (T0340)R27.CB (T0340)V60.CB 5.3711 8.9518 11.6373 13.9985 Constraint (T0340)N20.CB (T0340)I72.CB 5.6497 9.4162 12.2410 13.9984 Constraint (T0340)Q15.CB (T0340)A74.CB 5.1327 8.5544 11.1208 13.9959 Constraint (T0340)I32.CB (T0340)V68.CB 5.5946 9.3243 12.1216 13.7424 Constraint (T0340)S26.CB (T0340)E67.CB 5.4555 9.0925 11.8202 13.0000 Constraint (T0340)S26.CB (T0340)L63.CB 5.4635 9.1059 11.8376 13.0000 Constraint (T0340)H9.CB (T0340)L46.CB 5.7881 9.6468 12.5408 12.9999 Constraint (T0340)Q15.CB (T0340)A41.CB 5.7752 9.6254 12.5130 12.9999 Constraint (T0340)P28.CB (T0340)L52.CB 4.8225 8.0375 10.4487 12.9998 Constraint (T0340)P5.CB (T0340)D50.CB 5.7223 9.5372 12.3983 12.9998 Constraint (T0340)Q15.CB (T0340)R75.CB 4.2577 7.0962 9.2250 12.9997 Constraint (T0340)A41.CB (T0340)V83.CB 5.6188 9.3646 12.1740 12.9996 Constraint (T0340)L46.CB (T0340)A79.CB 5.8052 9.6753 12.5779 11.9999 Constraint (T0340)V60.CB (T0340)A70.CB 5.6873 9.4788 12.3225 11.9997 Constraint (T0340)S23.CB (T0340)E67.CB 5.5554 9.2590 12.0367 11.9996 Constraint (T0340)P28.CB (T0340)V68.CB 5.1057 8.5095 11.0623 11.9985 Constraint (T0340)L21.CB (T0340)A66.CB 5.6494 9.4157 12.2404 11.9984 Constraint (T0340)S26.CB (T0340)E61.CB 4.9502 8.2504 10.7255 11.8728 Constraint (T0340)P40.CB (T0340)L81.CB 5.6103 9.3505 12.1557 11.2986 Constraint (T0340)K12.CB (T0340)R43.CB 5.0218 8.3697 10.8807 11.0000 Constraint (T0340)L3.CB (T0340)V83.CB 5.6575 9.4291 12.2578 10.9999 Constraint (T0340)R27.CB (T0340)V68.CB 5.3468 8.9114 11.5848 10.9998 Constraint (T0340)P28.CB (T0340)E54.CB 5.6331 9.3886 12.2051 10.9998 Constraint (T0340)F19.CB (T0340)V68.CB 5.6023 9.3372 12.1383 10.9995 Constraint (T0340)R11.CB (T0340)A41.CB 5.2663 8.7772 11.4104 10.9984 Constraint (T0340)D50.CB (T0340)S87.CB 5.3390 8.8984 11.5679 10.9979 Constraint (T0340)R51.CB (T0340)L81.CB 5.8732 9.7887 12.7254 10.9941 Constraint (T0340)L52.CB (T0340)E67.CB 5.3936 8.9893 11.6861 10.7425 Constraint (T0340)Q30.CB (T0340)V84.CB 5.6014 9.3357 12.1365 10.1217 Constraint (T0340)I53.CB (T0340)V68.CB 5.6856 9.4760 12.3188 10.1202 Constraint (T0340)S26.CB (T0340)R51.CB 4.3718 7.2863 9.4722 10.0354 Constraint (T0340)P14.CB (T0340)R75.CB 5.1852 8.6419 11.2345 10.0000 Constraint (T0340)N20.CB (T0340)S39.CB 5.3575 8.9292 11.6079 9.9999 Constraint (T0340)C8.CB (T0340)E54.CB 5.4184 9.0307 11.7399 9.9993 Constraint (T0340)H9.CB (T0340)D77.CB 5.6467 9.4112 12.2346 9.9987 Constraint (T0340)C8.CB (T0340)E78.CB 5.8153 9.6922 12.5998 9.9987 Constraint (T0340)K25.CB (T0340)V60.CB 5.0010 8.3349 10.8354 9.9986 Constraint (T0340)I53.CB (T0340)P86.CB 5.5141 9.1902 11.9473 9.9960 Constraint (T0340)Q58.CB (T0340)L81.CB 5.5329 9.2216 11.9880 9.7470 Constraint (T0340)R4.CB (T0340)D50.CB 5.7915 9.6525 12.5482 8.9999 Constraint (T0340)L46.CB (T0340)P86.CB 5.8235 9.7058 12.6175 8.9997 Constraint (T0340)I32.CB (T0340)A42.CB 5.9289 9.8816 12.8460 8.9997 Constraint (T0340)Q15.CB (T0340)A79.CB 5.2626 8.7709 11.4022 8.9997 Constraint (T0340)P5.CB (T0340)P86.CB 5.1869 8.6449 11.2383 8.9984 Constraint (T0340)Y31.CB (T0340)V60.CB 5.4774 9.1289 11.8676 8.9981 Constraint (T0340)P14.CB (T0340)K73.CB 5.4068 9.0113 11.7147 8.9981 Constraint (T0340)K12.CB (T0340)S44.CB 5.2003 8.6672 11.2673 8.0000 Constraint (T0340)Q15.CB (T0340)A42.CB 5.6897 9.4829 12.3278 7.9999 Constraint (T0340)L21.CB (T0340)A48.CB 5.5602 9.2671 12.0472 7.9997 Constraint (T0340)R4.CB (T0340)R51.CB 5.7365 9.5608 12.4291 7.9996 Constraint (T0340)C8.CB (T0340)V55.CB 5.4890 9.1484 11.8929 7.9996 Constraint (T0340)F19.CB (T0340)V69.CB 5.5838 9.3063 12.0982 7.9985 Constraint (T0340)R47.CB (T0340)S87.CB 5.0831 8.4718 11.0133 7.9981 Constraint (T0340)A41.CB (T0340)L52.CB 5.3388 8.8980 11.5674 7.2994 Constraint (T0340)S26.CB (T0340)V84.CB 4.8618 8.1029 10.5338 7.2882 Constraint (T0340)S26.CB (T0340)I53.CB 5.1971 8.6619 11.2604 7.1618 Constraint (T0340)Q49.CB (T0340)T88.CB 5.1921 8.6535 11.2496 7.0000 Constraint (T0340)R27.CB (T0340)E67.CB 5.3627 8.9379 11.6193 7.0000 Constraint (T0340)M2.CB (T0340)V83.CB 5.9158 9.8597 12.8175 7.0000 Constraint (T0340)Q15.CB (T0340)R43.CB 5.6166 9.3609 12.1692 7.0000 Constraint (T0340)R11.CB (T0340)R75.CB 5.7003 9.5006 12.3507 6.9999 Constraint (T0340)L3.CB (T0340)I53.CB 5.2367 8.7278 11.3462 6.9999 Constraint (T0340)L21.CB (T0340)L46.CB 5.6292 9.3820 12.1966 6.9999 Constraint (T0340)H9.CB (T0340)A41.CB 5.6457 9.4095 12.2324 6.9997 Constraint (T0340)N56.CB (T0340)V68.CB 5.4002 9.0003 11.7004 6.9997 Constraint (T0340)H9.CB (T0340)L82.CB 5.2032 8.6719 11.2735 6.9996 Constraint (T0340)R11.CB (T0340)S39.CB 4.4333 7.3888 9.6055 6.9984 Constraint (T0340)R47.CB (T0340)T88.CB 5.2923 8.8204 11.4666 6.8736 Constraint (T0340)K25.CB (T0340)P86.CB 5.5168 9.1947 11.9531 6.4146 Constraint (T0340)R27.CB (T0340)I53.CB 5.2089 8.6815 11.2859 6.1218 Constraint (T0340)V60.CB (T0340)V84.CB 5.8769 9.7949 12.7334 6.1218 Constraint (T0340)R4.CB (T0340)L82.CB 5.5304 9.2173 11.9825 6.0000 Constraint (T0340)D24.CB (T0340)P86.CB 5.7584 9.5973 12.4765 6.0000 Constraint (T0340)A48.CB (T0340)V83.CB 5.8097 9.6828 12.5877 6.0000 Constraint (T0340)F19.CB (T0340)V83.CB 5.8175 9.6959 12.6046 6.0000 Constraint (T0340)Y17.CB (T0340)E76.CB 4.6712 7.7854 10.1210 5.9999 Constraint (T0340)R6.CB (T0340)P86.CB 5.1415 8.5692 11.1399 5.9998 Constraint (T0340)F19.CB (T0340)Q30.CB 5.4846 9.1411 11.8834 5.9997 Constraint (T0340)S23.CB (T0340)E61.CB 4.9817 8.3028 10.7936 5.9997 Constraint (T0340)E54.CB (T0340)E67.CB 5.5818 9.3029 12.0938 5.9997 Constraint (T0340)R51.CB (T0340)V68.CB 5.8387 9.7311 12.6504 5.9996 Constraint (T0340)Y17.CB (T0340)L52.CB 5.5265 9.2109 11.9741 5.9994 Constraint (T0340)Y31.CB (T0340)R47.CB 5.7738 9.6230 12.5099 5.9987 Constraint (T0340)Q49.CB (T0340)R89.CB 5.2415 8.7359 11.3567 5.9986 Constraint (T0340)K12.CB (T0340)A74.CB 5.7856 9.6427 12.5355 5.9986 Constraint (T0340)H22.CB (T0340)V69.CB 5.1762 8.6269 11.2150 5.9984 Constraint (T0340)N20.CB (T0340)Q30.CB 5.8639 9.7731 12.7051 5.9984 Constraint (T0340)Q58.CB (T0340)V69.CB 4.8653 8.1089 10.5416 5.9984 Constraint (T0340)Y17.CB (T0340)N56.CB 5.0415 8.4024 10.9232 5.9984 Constraint (T0340)L10.CB (T0340)N56.CB 4.5671 7.6119 9.8954 5.9984 Constraint (T0340)R27.CB (T0340)V84.CB 5.3322 8.8870 11.5531 5.9955 Constraint (T0340)I32.CB (T0340)H65.CB 5.5411 9.2352 12.0057 5.9206 Constraint (T0340)R51.CB (T0340)H65.CB 5.8478 9.7463 12.6702 5.6206 Constraint (T0340)D36.CB (T0340)A48.CB 5.2899 8.8166 11.4615 5.4216 Constraint (T0340)S34.CB (T0340)D50.CB 5.9460 9.9100 12.8830 5.1219 Constraint (T0340)I53.CB (T0340)E67.CB 5.7167 9.5278 12.3862 5.1216 Constraint (T0340)Y31.CB (T0340)I53.CB 5.3519 8.9198 11.5957 5.1216 Constraint (T0340)D24.CB (T0340)I53.CB 5.0310 8.3850 10.9005 5.0000 Constraint (T0340)D24.CB (T0340)D50.CB 5.8043 9.6739 12.5761 5.0000 Constraint (T0340)L21.CB (T0340)V83.CB 5.9804 9.9673 12.9574 5.0000 Constraint (T0340)R27.CB (T0340)N59.CB 5.5769 9.2948 12.0833 5.0000 Constraint (T0340)M2.CB (T0340)P86.CB 4.1820 6.9701 9.0611 4.9999 Constraint (T0340)P14.CB (T0340)E78.CB 5.2584 8.7641 11.3933 4.9998 Constraint (T0340)L21.CB (T0340)S71.CB 5.5926 9.3210 12.1174 4.9997 Constraint (T0340)L21.CB (T0340)R64.CB 5.8849 9.8082 12.7507 4.9997 Constraint (T0340)L21.CB (T0340)E67.CB 5.7291 9.5485 12.4131 4.9995 Constraint (T0340)K12.CB (T0340)N56.CB 4.3067 7.1779 9.3313 4.9985 Constraint (T0340)P40.CB (T0340)I72.CB 5.5460 9.2433 12.0163 4.3000 Constraint (T0340)R4.CB (T0340)I53.CB 5.9365 9.8942 12.8625 4.0000 Constraint (T0340)S1.CB (T0340)P86.CB 3.2004 5.3340 6.9342 3.9999 Constraint (T0340)N20.CB (T0340)L46.CB 5.6278 9.3796 12.1935 3.9999 Constraint (T0340)S71.CB (T0340)R80.CB 5.4645 9.1075 11.8397 3.9999 Constraint (T0340)L3.CB (T0340)D50.CB 4.9983 8.3306 10.8298 3.9998 Constraint (T0340)N56.CB (T0340)K73.CB 5.7452 9.5754 12.4480 3.9997 Constraint (T0340)C8.CB (T0340)I53.CB 5.5822 9.3037 12.0948 3.9997 Constraint (T0340)R6.CB (T0340)R51.CB 5.6480 9.4133 12.2374 3.9997 Constraint (T0340)L21.CB (T0340)D36.CB 5.6030 9.3384 12.1399 3.9996 Constraint (T0340)L7.CB (T0340)V84.CB 5.1707 8.6178 11.2031 3.9986 Constraint (T0340)K25.CB (T0340)Q49.CB 5.4894 9.1489 11.8936 3.8736 Constraint (T0340)K25.CB (T0340)R51.CB 5.5668 9.2780 12.0614 3.8736 Constraint (T0340)A41.CB (T0340)I72.CB 5.6076 9.3460 12.1498 3.3000 Constraint (T0340)S26.CB (T0340)P86.CB 4.7265 7.8774 10.2407 3.1219 Constraint (T0340)N56.CB (T0340)A70.CB 5.9464 9.9107 12.8839 3.0000 Constraint (T0340)V55.CB (T0340)E78.CB 5.9740 9.9566 12.9436 3.0000 Constraint (T0340)P28.CB (T0340)E67.CB 5.3577 8.9295 11.6083 3.0000 Constraint (T0340)R27.CB (T0340)A66.CB 4.9706 8.2843 10.7696 3.0000 Constraint (T0340)R27.CB (T0340)L52.CB 5.7378 9.5630 12.4319 3.0000 Constraint (T0340)D24.CB (T0340)V83.CB 5.9892 9.9820 12.9766 3.0000 Constraint (T0340)L21.CB (T0340)K73.CB 5.9322 9.8870 12.8531 3.0000 Constraint (T0340)F19.CB (T0340)V55.CB 5.9878 9.9796 12.9735 3.0000 Constraint (T0340)Q15.CB (T0340)P37.CB 5.1433 8.5721 11.1437 3.0000 Constraint (T0340)L10.CB (T0340)V35.CB 5.9946 9.9911 12.9884 3.0000 Constraint (T0340)P5.CB (T0340)L81.CB 5.2789 8.7981 11.4376 3.0000 Constraint (T0340)P5.CB (T0340)E61.CB 5.8172 9.6953 12.6038 3.0000 Constraint (T0340)P5.CB (T0340)L52.CB 5.6763 9.4605 12.2987 3.0000 Constraint (T0340)R51.CB (T0340)R89.CB 4.9871 8.3119 10.8054 3.0000 Constraint (T0340)R33.CB (T0340)R47.CB 5.7799 9.6332 12.5231 3.0000 Constraint (T0340)R33.CB (T0340)L46.CB 5.8758 9.7930 12.7309 3.0000 Constraint (T0340)P14.CB (T0340)A79.CB 5.3086 8.8476 11.5019 3.0000 Constraint (T0340)S26.CB (T0340)L52.CB 4.9351 8.2252 10.6927 3.0000 Constraint (T0340)V68.CB (T0340)A79.CB 4.8191 8.0318 10.4413 3.0000 Constraint (T0340)E61.CB (T0340)V83.CB 5.9479 9.9131 12.8871 2.9999 Constraint (T0340)R47.CB (T0340)V84.CB 5.9796 9.9659 12.9557 2.9999 Constraint (T0340)I32.CB (T0340)I72.CB 5.5700 9.2833 12.0683 2.9999 Constraint (T0340)H9.CB (T0340)R75.CB 5.9720 9.9534 12.9394 2.9999 Constraint (T0340)R4.CB (T0340)R47.CB 5.9270 9.8784 12.8419 2.9999 Constraint (T0340)L3.CB (T0340)Q49.CB 4.3435 7.2391 9.4108 2.9999 Constraint (T0340)L3.CB (T0340)Y31.CB 5.4994 9.1657 11.9154 2.9999 Constraint (T0340)P5.CB (T0340)R89.CB 4.3728 7.2880 9.4744 2.9999 Constraint (T0340)R4.CB (T0340)R89.CB 4.6857 7.8095 10.1524 2.9998 Constraint (T0340)R4.CB (T0340)T88.CB 4.6169 7.6949 10.0033 2.9998 Constraint (T0340)R51.CB (T0340)T88.CB 5.8352 9.7253 12.6428 2.9997 Constraint (T0340)F19.CB (T0340)H65.CB 5.9772 9.9619 12.9505 2.9997 Constraint (T0340)Y17.CB (T0340)S71.CB 5.3949 8.9916 11.6890 2.9997 Constraint (T0340)Y17.CB (T0340)V69.CB 5.3874 8.9789 11.6726 2.9997 Constraint (T0340)Y17.CB (T0340)V68.CB 4.5028 7.5046 9.7560 2.9997 Constraint (T0340)Y17.CB (T0340)Q30.CB 5.7622 9.6037 12.4849 2.9997 Constraint (T0340)N56.CB (T0340)V69.CB 5.9418 9.9030 12.8738 2.9997 Constraint (T0340)A41.CB (T0340)V55.CB 5.9391 9.8984 12.8680 2.9997 Constraint (T0340)R33.CB (T0340)L52.CB 5.8163 9.6938 12.6020 2.9997 Constraint (T0340)S23.CB (T0340)N59.CB 5.8972 9.8287 12.7774 2.9997 Constraint (T0340)S23.CB (T0340)I53.CB 5.5927 9.3212 12.1176 2.9997 Constraint (T0340)H22.CB (T0340)V60.CB 5.7494 9.5823 12.4570 2.9997 Constraint (T0340)L21.CB (T0340)I53.CB 5.9242 9.8736 12.8357 2.9997 Constraint (T0340)N20.CB (T0340)L52.CB 5.7387 9.5645 12.4338 2.9997 Constraint (T0340)N20.CB (T0340)Q49.CB 5.8116 9.6861 12.5919 2.9997 Constraint (T0340)F19.CB (T0340)Q49.CB 5.9100 9.8501 12.8051 2.9997 Constraint (T0340)F19.CB (T0340)P37.CB 4.7964 7.9941 10.3923 2.9997 Constraint (T0340)Y17.CB (T0340)P37.CB 4.7603 7.9338 10.3140 2.9997 Constraint (T0340)L10.CB (T0340)L52.CB 5.6675 9.4458 12.2796 2.9997 Constraint (T0340)H9.CB (T0340)V55.CB 5.9926 9.9877 12.9840 2.9997 Constraint (T0340)C8.CB (T0340)R51.CB 5.3615 8.9359 11.6167 2.9997 Constraint (T0340)Q58.CB (T0340)A79.CB 5.6940 9.4901 12.3371 2.9987 Constraint (T0340)Q58.CB (T0340)K73.CB 5.4350 9.0583 11.7758 2.9987 Constraint (T0340)E54.CB (T0340)I72.CB 5.9663 9.9438 12.9269 2.9987 Constraint (T0340)A48.CB (T0340)R89.CB 5.8254 9.7089 12.6216 2.9987 Constraint (T0340)R47.CB (T0340)L81.CB 5.4129 9.0215 11.7280 2.9987 Constraint (T0340)A42.CB (T0340)E78.CB 5.5464 9.2441 12.0173 2.9987 Constraint (T0340)S39.CB (T0340)A79.CB 5.7118 9.5196 12.3755 2.9987 Constraint (T0340)P37.CB (T0340)L46.CB 5.9025 9.8376 12.7888 2.9987 Constraint (T0340)Q30.CB (T0340)Q58.CB 5.3386 8.8977 11.5671 2.9987 Constraint (T0340)L21.CB (T0340)Q58.CB 5.0873 8.4788 11.0224 2.9987 Constraint (T0340)N20.CB (T0340)K73.CB 5.5518 9.2530 12.0289 2.9987 Constraint (T0340)P14.CB (T0340)P37.CB 5.9682 9.9470 12.9311 2.9987 Constraint (T0340)P14.CB (T0340)D36.CB 4.1625 6.9374 9.0187 2.9987 Constraint (T0340)K12.CB (T0340)V55.CB 5.5558 9.2596 12.0375 2.9987 Constraint (T0340)R11.CB (T0340)N56.CB 5.5887 9.3145 12.1089 2.9987 Constraint (T0340)R11.CB (T0340)A42.CB 4.3458 7.2430 9.4159 2.9987 Constraint (T0340)H9.CB (T0340)A42.CB 4.9170 8.1950 10.6535 2.9987 Constraint (T0340)R6.CB (T0340)L52.CB 5.6877 9.4795 12.3234 2.9987 Constraint (T0340)A48.CB (T0340)S87.CB 5.1645 8.6075 11.1897 2.9981 Constraint (T0340)Y31.CB (T0340)S87.CB 5.0656 8.4426 10.9754 2.9979 Constraint (T0340)L52.CB (T0340)P86.CB 5.5678 9.2796 12.0635 2.9961 Constraint (T0340)R6.CB (T0340)R80.CB 5.9808 9.9680 12.9584 2.9943 Constraint (T0340)D36.CB (T0340)R47.CB 5.8015 9.6692 12.5699 2.4219 Constraint (T0340)R33.CB (T0340)R51.CB 5.7732 9.6219 12.5085 2.4219 Constraint (T0340)E54.CB (T0340)A79.CB 5.7735 9.6225 12.5092 2.3219 Constraint (T0340)R51.CB (T0340)L63.CB 5.4659 9.1099 11.8428 2.1219 Constraint (T0340)I32.CB (T0340)V84.CB 5.4622 9.1037 11.8348 2.1219 Constraint (T0340)I32.CB (T0340)L63.CB 4.8675 8.1125 10.5463 2.1219 Constraint (T0340)I32.CB (T0340)I53.CB 5.9918 9.9863 12.9822 2.1219 Constraint (T0340)I32.CB (T0340)S44.CB 5.9938 9.9896 12.9865 2.1219 Constraint (T0340)Y31.CB (T0340)L63.CB 3.7304 6.2173 8.0825 2.1219 Constraint (T0340)I53.CB (T0340)R89.CB 5.1786 8.6311 11.2204 2.0000 Constraint (T0340)L52.CB (T0340)V69.CB 5.5878 9.3131 12.1070 2.0000 Constraint (T0340)R51.CB (T0340)L90.CB 5.5966 9.3276 12.1259 2.0000 Constraint (T0340)L10.CB (T0340)D36.CB 5.9762 9.9604 12.9485 2.0000 Constraint (T0340)H9.CB (T0340)E76.CB 5.6903 9.4838 12.3290 2.0000 Constraint (T0340)S1.CB (T0340)R47.CB 5.1861 8.6435 11.2365 2.0000 Constraint (T0340)S26.CB (T0340)V68.CB 3.9319 6.5532 8.5192 2.0000 Constraint (T0340)S26.CB (T0340)V60.CB 3.9034 6.5056 8.4573 2.0000 Constraint (T0340)D24.CB (T0340)V84.CB 5.9767 9.9611 12.9494 2.0000 Constraint (T0340)S26.CB (T0340)Q49.CB 5.1498 8.5830 11.1579 2.0000 Constraint (T0340)L3.CB (T0340)R89.CB 5.7454 9.5757 12.4484 1.9999 Constraint (T0340)S1.CB (T0340)Q49.CB 5.7925 9.6542 12.5505 1.9999 Constraint (T0340)D24.CB (T0340)S34.CB 5.4206 9.0343 11.7447 1.9999 Constraint (T0340)S23.CB (T0340)I72.CB 4.7488 7.9147 10.2892 1.9999 Constraint (T0340)S23.CB (T0340)D50.CB 5.7564 9.5940 12.4722 1.9999 Constraint (T0340)S23.CB (T0340)S34.CB 5.2411 8.7352 11.3557 1.9999 Constraint (T0340)H22.CB (T0340)A41.CB 5.6721 9.4535 12.2896 1.9999 Constraint (T0340)H22.CB (T0340)D36.CB 4.9583 8.2639 10.7430 1.9999 Constraint (T0340)H22.CB (T0340)V35.CB 4.8778 8.1297 10.5687 1.9999 Constraint (T0340)R11.CB (T0340)L81.CB 4.2403 7.0672 9.1874 1.9999 Constraint (T0340)H9.CB (T0340)V83.CB 3.8810 6.4684 8.4089 1.9999 Constraint (T0340)H22.CB (T0340)R64.CB 5.8343 9.7238 12.6409 1.9998 Constraint (T0340)N20.CB (T0340)V68.CB 5.2438 8.7396 11.3615 1.9998 Constraint (T0340)L10.CB (T0340)L82.CB 4.3743 7.2905 9.4777 1.9998 Constraint (T0340)P5.CB (T0340)S87.CB 3.1770 5.2949 6.8834 1.9998 Constraint (T0340)R47.CB (T0340)L90.CB 5.9582 9.9304 12.9095 1.9991 Constraint (T0340)R4.CB (T0340)L90.CB 3.9270 6.5450 8.5085 1.9991 Constraint (T0340)L3.CB (T0340)L90.CB 5.1216 8.5360 11.0968 1.9991 Constraint (T0340)P14.CB (T0340)A74.CB 5.0828 8.4713 11.0127 1.9981 Constraint (T0340)Q30.CB (T0340)P86.CB 5.4550 9.0917 11.8192 1.9980 Constraint (T0340)L46.CB (T0340)T88.CB 5.3732 8.9553 11.6418 1.5809 Constraint (T0340)P40.CB (T0340)R80.CB 5.1547 8.5911 11.1684 1.0999 Constraint (T0340)P28.CB (T0340)V83.CB 4.9867 8.3112 10.8045 1.0000 Constraint (T0340)P28.CB (T0340)L82.CB 5.8500 9.7500 12.6751 1.0000 Constraint (T0340)P28.CB (T0340)D50.CB 5.3546 8.9244 11.6017 1.0000 Constraint (T0340)R27.CB (T0340)V83.CB 5.7614 9.6023 12.4830 1.0000 Constraint (T0340)S26.CB (T0340)N59.CB 5.5730 9.2883 12.0747 1.0000 Constraint (T0340)Y17.CB (T0340)A74.CB 5.1518 8.5863 11.1622 1.0000 Constraint (T0340)P14.CB (T0340)A70.CB 5.9229 9.8716 12.8331 1.0000 Constraint (T0340)R11.CB (T0340)I72.CB 5.7217 9.5362 12.3971 1.0000 Constraint (T0340)R11.CB (T0340)L46.CB 5.3708 8.9514 11.6368 1.0000 Constraint (T0340)H9.CB (T0340)E54.CB 5.9535 9.9225 12.8992 1.0000 Constraint (T0340)H9.CB (T0340)L52.CB 5.5264 9.2106 11.9738 1.0000 Constraint (T0340)H9.CB (T0340)D50.CB 5.4789 9.1315 11.8709 1.0000 Constraint (T0340)S1.CB (T0340)S87.CB 5.9151 9.8586 12.8161 1.0000 Constraint (T0340)L3.CB (T0340)L82.CB 5.9611 9.9352 12.9158 1.0000 Constraint (T0340)S26.CB (T0340)V83.CB 5.9853 9.9755 12.9681 1.0000 Constraint (T0340)S26.CB (T0340)D50.CB 5.8397 9.7328 12.6526 1.0000 Constraint (T0340)S23.CB (T0340)A48.CB 5.4835 9.1391 11.8808 1.0000 Constraint (T0340)K25.CB (T0340)S87.CB 5.0785 8.4641 11.0034 1.0000 Constraint (T0340)K25.CB (T0340)V84.CB 5.1523 8.5871 11.1632 1.0000 Constraint (T0340)Q15.CB (T0340)V69.CB 5.8255 9.7091 12.6218 1.0000 Constraint (T0340)I72.CB (T0340)L82.CB 5.7918 9.6531 12.5490 0.9999 Constraint (T0340)L46.CB (T0340)L82.CB 4.8894 8.1490 10.5937 0.9999 Constraint (T0340)S44.CB (T0340)L82.CB 4.9959 8.3265 10.8244 0.9999 Constraint (T0340)A41.CB (T0340)L82.CB 5.5818 9.3030 12.0939 0.9999 Constraint (T0340)A41.CB (T0340)R80.CB 5.8399 9.7332 12.6531 0.9999 Constraint (T0340)I32.CB (T0340)L82.CB 5.6266 9.3776 12.1909 0.9999 Constraint (T0340)Q30.CB (T0340)L82.CB 5.8706 9.7844 12.7197 0.9999 Constraint (T0340)S23.CB (T0340)L82.CB 5.9242 9.8736 12.8357 0.9999 Constraint (T0340)S23.CB (T0340)S71.CB 5.2093 8.6821 11.2867 0.9999 Constraint (T0340)S23.CB (T0340)V55.CB 5.2324 8.7207 11.3369 0.9999 Constraint (T0340)H22.CB (T0340)I72.CB 5.5547 9.2579 12.0352 0.9999 Constraint (T0340)L21.CB (T0340)L82.CB 5.4872 9.1453 11.8889 0.9999 Constraint (T0340)L21.CB (T0340)R80.CB 5.4549 9.0915 11.8189 0.9999 Constraint (T0340)L21.CB (T0340)A42.CB 5.4450 9.0750 11.7975 0.9999 Constraint (T0340)L21.CB (T0340)A41.CB 2.5263 4.2106 5.4737 0.9999 Constraint (T0340)L21.CB (T0340)P40.CB 4.5531 7.5886 9.8651 0.9999 Constraint (T0340)L21.CB (T0340)S39.CB 4.3677 7.2795 9.4634 0.9999 Constraint (T0340)L21.CB (T0340)V35.CB 3.7579 6.2632 8.1421 0.9999 Constraint (T0340)N20.CB (T0340)R43.CB 5.3914 8.9857 11.6814 0.9999 Constraint (T0340)N20.CB (T0340)A42.CB 3.9985 6.6642 8.6635 0.9999 Constraint (T0340)N20.CB (T0340)P40.CB 3.4251 5.7085 7.4211 0.9999 Constraint (T0340)N20.CB (T0340)P37.CB 4.6514 7.7524 10.0781 0.9999 Constraint (T0340)F19.CB (T0340)L82.CB 5.7131 9.5218 12.3783 0.9999 Constraint (T0340)F19.CB (T0340)R80.CB 3.9022 6.5036 8.4547 0.9999 Constraint (T0340)F19.CB (T0340)R75.CB 5.5248 9.2079 11.9703 0.9999 Constraint (T0340)F19.CB (T0340)R43.CB 5.4840 9.1400 11.8819 0.9999 Constraint (T0340)K12.CB (T0340)R80.CB 4.2247 7.0412 9.1535 0.9999 Constraint (T0340)L10.CB (T0340)L21.CB 4.5783 7.6306 9.9197 0.9999 Constraint (T0340)L10.CB (T0340)N20.CB 5.4118 9.0196 11.7255 0.9999 Constraint (T0340)E61.CB (T0340)P86.CB 5.0590 8.4317 10.9613 0.9999 Constraint (T0340)N59.CB (T0340)V84.CB 4.9448 8.2414 10.7138 0.9999 Constraint (T0340)N56.CB (T0340)V83.CB 4.6613 7.7688 10.0995 0.9999 Constraint (T0340)V55.CB (T0340)V84.CB 4.5700 7.6166 9.9016 0.9999 Constraint (T0340)E54.CB (T0340)P86.CB 4.5604 7.6006 9.8808 0.9999 Constraint (T0340)I53.CB (T0340)S87.CB 5.3073 8.8456 11.4992 0.9999 Constraint (T0340)P28.CB (T0340)P86.CB 5.4887 9.1478 11.8921 0.9999 Constraint (T0340)Y17.CB (T0340)V83.CB 5.1034 8.5057 11.0574 0.9999 Constraint (T0340)Q15.CB (T0340)L81.CB 5.9859 9.9764 12.9693 0.9999 Constraint (T0340)K12.CB (T0340)L81.CB 5.8305 9.7175 12.6327 0.9999 Constraint (T0340)K12.CB (T0340)P37.CB 3.7321 6.2202 8.0862 0.9999 Constraint (T0340)K12.CB (T0340)D36.CB 5.2066 8.6777 11.2810 0.9999 Constraint (T0340)R11.CB (T0340)P37.CB 5.9764 9.9607 12.9489 0.9999 Constraint (T0340)L10.CB (T0340)V83.CB 3.4818 5.8031 7.5440 0.9999 Constraint (T0340)C8.CB (T0340)V84.CB 3.7067 6.1779 8.0312 0.9999 Constraint (T0340)R6.CB (T0340)S87.CB 4.8015 8.0026 10.4033 0.9999 Constraint (T0340)P5.CB (T0340)T88.CB 3.6600 6.1000 7.9299 0.9999 Constraint (T0340)L3.CB (T0340)T88.CB 5.1600 8.5999 11.1799 0.9999 Constraint (T0340)M2.CB (T0340)S87.CB 5.9461 9.9102 12.8833 0.9999 Constraint (T0340)I32.CB (T0340)S87.CB 5.9097 9.8496 12.8045 0.9981 Constraint (T0340)D50.CB (T0340)T88.CB 3.6060 6.0099 7.8129 0.8736 Constraint (T0340)A79.CB (T0340)L90.CB 4.7570 7.9284 10.3069 0.7073 Constraint (T0340)A79.CB (T0340)R89.CB 5.2317 8.7195 11.3354 0.7073 Constraint (T0340)A79.CB (T0340)T88.CB 3.1318 5.2197 6.7856 0.7073 Constraint (T0340)E78.CB (T0340)L90.CB 4.8890 8.1484 10.5929 0.7073 Constraint (T0340)E78.CB (T0340)R89.CB 3.4978 5.8297 7.5786 0.7073 Constraint (T0340)E78.CB (T0340)T88.CB 4.1108 6.8513 8.9067 0.7073 Constraint (T0340)D77.CB (T0340)L90.CB 2.5457 4.2428 5.5157 0.7073 Constraint (T0340)D77.CB (T0340)R89.CB 4.1120 6.8533 8.9093 0.7073 Constraint (T0340)D77.CB (T0340)T88.CB 3.9841 6.6402 8.6322 0.7073 Constraint (T0340)E76.CB (T0340)L90.CB 3.2040 5.3400 6.9419 0.7073 Constraint (T0340)E76.CB (T0340)R89.CB 3.7669 6.2782 8.1616 0.7073 Constraint (T0340)E76.CB (T0340)T88.CB 5.9855 9.9758 12.9686 0.7073 Constraint (T0340)R75.CB (T0340)L90.CB 3.8897 6.4829 8.4277 0.7073 Constraint (T0340)R75.CB (T0340)T88.CB 5.5458 9.2430 12.0159 0.7073 Constraint (T0340)K73.CB (T0340)L90.CB 5.9925 9.9875 12.9838 0.7073 Constraint (T0340)I72.CB (T0340)L90.CB 5.4082 9.0137 11.7178 0.7073 Constraint (T0340)I72.CB (T0340)T88.CB 4.9386 8.2309 10.7002 0.7073 Constraint (T0340)V55.CB (T0340)T88.CB 5.9103 9.8505 12.8057 0.7073 Constraint (T0340)S44.CB (T0340)R89.CB 5.6300 9.3834 12.1984 0.7073 Constraint (T0340)S44.CB (T0340)T88.CB 3.5428 5.9047 7.6761 0.7073 Constraint (T0340)R43.CB (T0340)R89.CB 4.7707 7.9511 10.3365 0.7073 Constraint (T0340)R43.CB (T0340)T88.CB 4.7588 7.9314 10.3108 0.7073 Constraint (T0340)A41.CB (T0340)T88.CB 5.4937 9.1561 11.9029 0.7073 Constraint (T0340)P40.CB (T0340)L90.CB 4.2003 7.0005 9.1006 0.7073 Constraint (T0340)P40.CB (T0340)R89.CB 4.0174 6.6956 8.7043 0.7073 Constraint (T0340)P40.CB (T0340)T88.CB 3.1855 5.3092 6.9020 0.7073 Constraint (T0340)S39.CB (T0340)L90.CB 5.5093 9.1821 11.9367 0.7073 Constraint (T0340)S39.CB (T0340)T88.CB 5.6440 9.4066 12.2286 0.7073 Constraint (T0340)D36.CB (T0340)Q49.CB 5.6326 9.3876 12.2039 0.3000 Constraint (T0340)V35.CB (T0340)L52.CB 5.1678 8.6130 11.1969 0.3000 Constraint (T0340)I32.CB (T0340)V60.CB 5.8654 9.7757 12.7084 0.3000 Constraint (T0340)R89.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: