# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0319/ # command:# Making conformation for sequence T0319 numbered 1 through 135 Created new target T0319 from T0319.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0319/ # command:# reading script from file T0319.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yk4A/T0319-1yk4A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yk4A expands to /projects/compbio/data/pdb/1yk4.pdb.gz 1yk4A:Skipped atom 15, because occupancy 0.22 <= existing 0.780 in 1yk4A Skipped atom 19, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 21, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 23, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 25, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 27, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 77, because occupancy 0.130 <= existing 0.610 in 1yk4A Skipped atom 78, because occupancy 0.260 <= existing 0.610 in 1yk4A Skipped atom 80, because occupancy 0.130 <= existing 0.610 in 1yk4A Skipped atom 81, because occupancy 0.260 <= existing 0.610 in 1yk4A Skipped atom 106, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 108, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 128, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 130, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 132, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 134, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 136, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 138, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 140, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 142, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 166, because occupancy 0.380 <= existing 0.620 in 1yk4A Skipped atom 323, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 325, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 327, because occupancy 0.220 <= existing 0.780 in 1yk4A Skipped atom 398, because occupancy 0.360 <= existing 0.590 in 1yk4A Skipped atom 399, because occupancy 0.060 <= existing 0.590 in 1yk4A Skipped atom 401, because occupancy 0.360 <= existing 0.590 in 1yk4A Skipped atom 402, because occupancy 0.060 <= existing 0.590 in 1yk4A Skipped atom 565, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 567, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 569, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 571, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 573, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 575, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 577, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 579, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 589, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 591, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 593, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 595, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 597, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 599, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 601, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 603, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 613, because occupancy 0.490 <= existing 0.510 in 1yk4A Skipped atom 666, because occupancy 0.340 <= existing 0.660 in 1yk4A Skipped atom 670, because occupancy 0.340 <= existing 0.660 in 1yk4A Skipped atom 672, because occupancy 0.340 <= existing 0.660 in 1yk4A Skipped atom 674, because occupancy 0.340 <= existing 0.660 in 1yk4A Skipped atom 822, because occupancy 0.390 <= existing 0.610 in 1yk4A Skipped atom 824, because occupancy 0.390 <= existing 0.610 in 1yk4A Skipped atom 826, because occupancy 0.390 <= existing 0.610 in 1yk4A Skipped atom 828, because occupancy 0.390 <= existing 0.610 in 1yk4A Skipped atom 830, because occupancy 0.390 <= existing 0.610 in 1yk4A Skipped atom 843, because occupancy 0.260 <= existing 0.740 in 1yk4A Skipped atom 847, because occupancy 0.260 <= existing 0.740 in 1yk4A Skipped atom 849, because occupancy 0.260 <= existing 0.740 in 1yk4A Skipped atom 851, because occupancy 0.260 <= existing 0.740 in 1yk4A Skipped atom 853, because occupancy 0.260 <= existing 0.740 in 1yk4A Skipped atom 855, because occupancy 0.260 <= existing 0.740 in 1yk4A Skipped atom 857, because occupancy 0.260 <= existing 0.740 in 1yk4A Skipped atom 859, because occupancy 0.260 <= existing 0.740 in 1yk4A # T0319 read from 1yk4A/T0319-1yk4A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yk4A read from 1yk4A/T0319-1yk4A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1yk4A to template set # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPGTK # choosing archetypes in rotamer library Number of specific fragments extracted= 1 number of extra gaps= 0 total=1 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_40610537.pdb -s /var/tmp/to_scwrl_40610537.seq -o /var/tmp/from_scwrl_40610537.pdb > /var/tmp/scwrl_40610537.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_40610537.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rlyA/T0319-1rlyA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rlyA expands to /projects/compbio/data/pdb/1rly.pdb.gz 1rlyA:# T0319 read from 1rlyA/T0319-1rlyA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rlyA read from 1rlyA/T0319-1rlyA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1rlyA to template set # found chain 1rlyA in template set T0319 69 :NALP 1rlyA 8 :DALP T0319 73 :PTKPSFPSS 1rlyA 13 :VTCPNHPDA T0319 82 :IQELTDDD 1rlyA 24 :VEDYRAGD T0319 110 :MKCRNCGHI 1rlyA 32 :MICPECGLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=5 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_738393740.pdb -s /var/tmp/to_scwrl_738393740.seq -o /var/tmp/from_scwrl_738393740.pdb > /var/tmp/scwrl_738393740.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_738393740.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gz6A/T0319-1gz6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gz6A expands to /projects/compbio/data/pdb/1gz6.pdb.gz 1gz6A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0319 read from 1gz6A/T0319-1gz6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1gz6A read from 1gz6A/T0319-1gz6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1gz6A to template set # found chain 1gz6A in template set T0319 3 :FLTTNFLKCSVKACDT 1gz6A 35 :LVVVNDLGGDFKGVGK T0319 43 :NPEFLLNIVDRVD 1gz6A 51 :GSSAADKVVEEIR T0319 56 :WPAVLTVAAE 1gz6A 79 :GEKLVKTALD T0319 66 :LGNNA 1gz6A 90 :FGRID T0319 77 :SFPSSIQELTDDDMAILNDLHTLLL 1gz6A 103 :LRDRSFSRISDEDWDIIQRVHLRGS Number of specific fragments extracted= 5 number of extra gaps= 0 total=10 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_19485054.pdb -s /var/tmp/to_scwrl_19485054.seq -o /var/tmp/from_scwrl_19485054.pdb > /var/tmp/scwrl_19485054.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_19485054.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w2lA/T0319-1w2lA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1w2lA expands to /projects/compbio/data/pdb/1w2l.pdb.gz 1w2lA:# T0319 read from 1w2lA/T0319-1w2lA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1w2lA read from 1w2lA/T0319-1w2lA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1w2lA to template set # found chain 1w2lA in template set T0319 21 :DNFPLQYDGSKCQLV 1w2lA 38 :YGSTRTFEDGTTAVA T0319 55 :DWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLH 1w2lA 53 :DENYLRESILQPGAKVVQGYPNVMPASYASLSEREVAALIEFI Number of specific fragments extracted= 2 number of extra gaps= 0 total=12 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1983614029.pdb -s /var/tmp/to_scwrl_1983614029.seq -o /var/tmp/from_scwrl_1983614029.pdb > /var/tmp/scwrl_1983614029.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1983614029.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vq0A/T0319-1vq0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vq0A expands to /projects/compbio/data/pdb/1vq0.pdb.gz 1vq0A:# T0319 read from 1vq0A/T0319-1vq0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vq0A read from 1vq0A/T0319-1vq0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1vq0A to template set # found chain 1vq0A in template set T0319 4 :LTTNFLKCSVKACDTS 1vq0A 140 :LAYYFAVSEQIPSAFS T0319 23 :FPLQYDGSKCQL 1vq0A 156 :IGVLVDSDGVKI T0319 35 :VQDESIEFNPEF 1vq0A 173 :VQIIDRTLEQEK T0319 47 :LLNIVDRVDWPAVLTVAA 1vq0A 198 :ISKLFQEAEPLDVLERIF T0319 68 :NNALPPT 1vq0A 216 :GEKVGFV T0319 77 :SFPSSIQE 1vq0A 230 :KCDCNREK T0319 85 :LTDDDMAILNDLH 1vq0A 242 :LLVLDKKELEDMR T0319 106 :AEGEMKCRNCGHIYYIK 1vq0A 257 :GKGEVVCKWCNTRYVFS Number of specific fragments extracted= 8 number of extra gaps= 0 total=20 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1291554097.pdb -s /var/tmp/to_scwrl_1291554097.seq -o /var/tmp/from_scwrl_1291554097.pdb > /var/tmp/scwrl_1291554097.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1291554097.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fp1D/T0319-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fp1D expands to /projects/compbio/data/pdb/1fp1.pdb.gz 1fp1D:# T0319 read from 1fp1D/T0319-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fp1D read from 1fp1D/T0319-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1fp1D to template set # found chain 1fp1D in template set T0319 37 :DESIEFNPEFLLNIVDR 1fp1D 58 :PPGAFMSPSEIASKLPA T0319 83 :QELTDDDMAILNDLHTLLLQTS 1fp1D 75 :STQHSDLPNRLDRMLRLLASYS T0319 105 :IAEGEMKCRNCG 1fp1D 98 :LTSTTRTIEDGG T0319 117 :HIYYIKNGIPNLLL 1fp1D 112 :RVYGLSMVGKYLVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=24 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1655035324.pdb -s /var/tmp/to_scwrl_1655035324.seq -o /var/tmp/from_scwrl_1655035324.pdb > /var/tmp/scwrl_1655035324.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1655035324.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wdjA/T0319-1wdjA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wdjA expands to /projects/compbio/data/pdb/1wdj.pdb.gz 1wdjA:# T0319 read from 1wdjA/T0319-1wdjA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wdjA read from 1wdjA/T0319-1wdjA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1wdjA to template set # found chain 1wdjA in template set T0319 37 :DESIEFNPEF 1wdjA 6 :DLARPVSEEE T0319 59 :VLTVAAELGN 1wdjA 16 :LRRLSELNPG T0319 72 :PPTKP 1wdjA 31 :SPEGR T0319 82 :IQELTDDDMAILNDLHTLLLQT 1wdjA 38 :VSPTGGESGRRSLQLAYQLARW T0319 104 :SIA 1wdjA 67 :VVF T0319 114 :NCGHIYYIKNG 1wdjA 70 :DSSTGFKFPDG Number of specific fragments extracted= 6 number of extra gaps= 0 total=30 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1905241080.pdb -s /var/tmp/to_scwrl_1905241080.seq -o /var/tmp/from_scwrl_1905241080.pdb > /var/tmp/scwrl_1905241080.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1905241080.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b7yB/T0319-1b7yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b7yB expands to /projects/compbio/data/pdb/1b7y.pdb.gz 1b7yB:# T0319 read from 1b7yB/T0319-1b7yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1b7yB read from 1b7yB/T0319-1b7yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1b7yB to template set # found chain 1b7yB in template set T0319 15 :ACDTSNDNFPLQYDGSKC 1b7yB 432 :GCRVEGEGPTYRVTPPSH T0319 39 :SIEFN 1b7yB 450 :RLDLR T0319 55 :DWPAVLTVAAEL 1b7yB 455 :LEEDLVEEVARI T0319 67 :GNNALPPTKPSFPSSIQELT 1b7yB 468 :GYETIPLALPAFFPAPDNRG T0319 87 :DDDMAILNDLHTLLLQTSIAE 1b7yB 489 :EAPYRKEQRLREVLSGLGFQE Number of specific fragments extracted= 5 number of extra gaps= 0 total=35 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_2004187515.pdb -s /var/tmp/to_scwrl_2004187515.seq -o /var/tmp/from_scwrl_2004187515.pdb > /var/tmp/scwrl_2004187515.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2004187515.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iro/T0319-1iro-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1iro expands to /projects/compbio/data/pdb/1iro.pdb.gz 1iro:Warning: there is no chain 1iro will retry with 1iroA Skipped atom 81, because occupancy 0.310 <= existing 0.690 in 1iro Skipped atom 83, because occupancy 0.310 <= existing 0.690 in 1iro Skipped atom 85, because occupancy 0.310 <= existing 0.690 in 1iro Skipped atom 172, because occupancy 0.450 <= existing 0.550 in 1iro Skipped atom 175, because occupancy 0.450 <= existing 0.550 in 1iro Skipped atom 220, because occupancy 0.490 <= existing 0.510 in 1iro Skipped atom 222, because occupancy 0.490 <= existing 0.510 in 1iro Skipped atom 568, because occupancy 0.260 <= existing 0.740 in 1iro Skipped atom 570, because occupancy 0.260 <= existing 0.740 in 1iro Skipped atom 572, because occupancy 0.260 <= existing 0.740 in 1iro Skipped atom 574, because occupancy 0.260 <= existing 0.740 in 1iro Skipped atom 691, because occupancy 0.450 <= existing 0.550 in 1iro Skipped atom 693, because occupancy 0.450 <= existing 0.550 in 1iro Skipped atom 695, because occupancy 0.450 <= existing 0.550 in 1iro Skipped atom 697, because occupancy 0.450 <= existing 0.550 in 1iro Skipped atom 699, because occupancy 0.450 <= existing 0.550 in 1iro # T0319 read from 1iro/T0319-1iro-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1iro read from 1iro/T0319-1iro-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1iro to template set # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNPGTD Number of specific fragments extracted= 1 number of extra gaps= 0 total=36 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_371653516.pdb -s /var/tmp/to_scwrl_371653516.seq -o /var/tmp/from_scwrl_371653516.pdb > /var/tmp/scwrl_371653516.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_371653516.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v87A/T0319-1v87A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v87A expands to /projects/compbio/data/pdb/1v87.pdb.gz 1v87A:# T0319 read from 1v87A/T0319-1v87A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1v87A read from 1v87A/T0319-1v87A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1v87A to template set # found chain 1v87A in template set T0319 58 :AVLTVAAELGNNA 1v87A 69 :CLLAMYCNGNKDG Number of specific fragments extracted= 1 number of extra gaps= 0 total=37 # command:# reading script from file T0319.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1weoA/T0319-1weoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1weoA expands to /projects/compbio/data/pdb/1weo.pdb.gz 1weoA:# T0319 read from 1weoA/T0319-1weoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1weoA read from 1weoA/T0319-1weoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1weoA to template set # found chain 1weoA in template set T0319 12 :SVKACDTSNDNFPLQ 1weoA 22 :CGDQIGLTVEGDLFV T0319 34 :LVQDESIEFNPEFLLNIVDRVD 1weoA 37 :ACNECGFPACRPCYEYERREGT T0319 67 :GNNAL 1weoA 64 :CKTRY T0319 72 :PPTKPSF 1weoA 71 :LRGSPRV T0319 80 :SSIQELTDDD 1weoA 78 :EGDEDEEDID Number of specific fragments extracted= 5 number of extra gaps= 0 total=42 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_962033002.pdb -s /var/tmp/to_scwrl_962033002.seq -o /var/tmp/from_scwrl_962033002.pdb > /var/tmp/scwrl_962033002.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_962033002.pdb Number of alignments=10 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zin/T0319-1zin-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1zin/T0319-1zin-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zin read from 1zin/T0319-1zin-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zin in training set T0319 45 :EFLLNIVDR 1zin 66 :GIVRERLSK T0319 56 :WPAVLTVAAELGNN 1zin 93 :AEALETMLADIGRK T0319 71 :LP 1zin 107 :LD T0319 84 :EL 1zin 114 :DV T0319 89 :DMAILNDLHT 1zin 116 :RQDVLMERLT T0319 108 :GEMKCRNCGHIYY 1zin 126 :GRRICRNCGATYH Number of specific fragments extracted= 6 number of extra gaps= 0 total=48 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1047372231.pdb -s /var/tmp/to_scwrl_1047372231.seq -o /var/tmp/from_scwrl_1047372231.pdb > /var/tmp/scwrl_1047372231.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1047372231.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rlyA/T0319-1rlyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1rlyA/T0319-1rlyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rlyA read from 1rlyA/T0319-1rlyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1rlyA in template set T0319 68 :NNALP 1rlyA 7 :LDALP T0319 73 :PTKPSFPS 1rlyA 13 :VTCPNHPD T0319 83 :QELTDDD 1rlyA 21 :AILVEDY T0319 106 :AEGEMKCRNCGHI 1rlyA 28 :RAGDMICPECGLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=52 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1707746138.pdb -s /var/tmp/to_scwrl_1707746138.seq -o /var/tmp/from_scwrl_1707746138.pdb > /var/tmp/scwrl_1707746138.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1707746138.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yk4A/T0319-1yk4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1yk4A/T0319-1yk4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yk4A read from 1yk4A/T0319-1yk4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=53 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1372261795.pdb -s /var/tmp/to_scwrl_1372261795.seq -o /var/tmp/from_scwrl_1372261795.pdb > /var/tmp/scwrl_1372261795.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1372261795.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wdjA/T0319-1wdjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1wdjA/T0319-1wdjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wdjA read from 1wdjA/T0319-1wdjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1wdjA in template set T0319 37 :DESIEFNPEFLLN 1wdjA 6 :DLARPVSEEELRR T0319 62 :VAAELG 1wdjA 19 :LSELNP T0319 70 :A 1wdjA 25 :G T0319 72 :PPTK 1wdjA 31 :SPEG T0319 82 :IQELTDDDMAILNDLHTLLLQT 1wdjA 38 :VSPTGGESGRRSLQLAYQLARW T0319 108 :GEMK 1wdjA 66 :GVVF T0319 114 :NCGHIYYIKNGI 1wdjA 70 :DSSTGFKFPDGS Number of specific fragments extracted= 7 number of extra gaps= 0 total=60 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_2073785403.pdb -s /var/tmp/to_scwrl_2073785403.seq -o /var/tmp/from_scwrl_2073785403.pdb > /var/tmp/scwrl_2073785403.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2073785403.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vq0A/T0319-1vq0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1vq0A/T0319-1vq0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vq0A read from 1vq0A/T0319-1vq0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vq0A in template set T0319 6 :TNFLKCSVKACDTS 1vq0A 142 :YYFAVSEQIPSAFS T0319 23 :FPLQYDGSKCQL 1vq0A 156 :IGVLVDSDGVKI T0319 35 :VQDESIEFNPEF 1vq0A 173 :VQIIDRTLEQEK T0319 47 :LLNIVDRVDWPAVLTVAA 1vq0A 198 :ISKLFQEAEPLDVLERIF T0319 68 :NNALPP 1vq0A 216 :GEKVGF T0319 74 :TKPSFPSSIQELT 1vq0A 230 :KCDCNREKAKNAL T0319 87 :DDDMAILNDLHTL 1vq0A 244 :VLDKKELEDMRKE T0319 106 :AEGEMKCRNCGHIYYIK 1vq0A 257 :GKGEVVCKWCNTRYVFS Number of specific fragments extracted= 8 number of extra gaps= 0 total=68 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_333582338.pdb -s /var/tmp/to_scwrl_333582338.seq -o /var/tmp/from_scwrl_333582338.pdb > /var/tmp/scwrl_333582338.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_333582338.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iro/T0319-1iro-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1iro/T0319-1iro-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1iro read from 1iro/T0319-1iro-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNPGTD Number of specific fragments extracted= 1 number of extra gaps= 0 total=69 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_628974580.pdb -s /var/tmp/to_scwrl_628974580.seq -o /var/tmp/from_scwrl_628974580.pdb > /var/tmp/scwrl_628974580.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_628974580.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1woyA/T0319-1woyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1woyA expands to /projects/compbio/data/pdb/1woy.pdb.gz 1woyA:# T0319 read from 1woyA/T0319-1woyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1woyA read from 1woyA/T0319-1woyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1woyA to template set # found chain 1woyA in template set T0319 44 :PEFLLNIVDR 1woyA 68 :KAFVDRVSGR T0319 59 :VLTVAAELGNN 1woyA 78 :FKRAWDLLGIA T0319 82 :IQE 1woyA 89 :YDD T0319 85 :LTDDDMAILNDLHTLLLQT 1woyA 96 :TEERHKKVVQLVLKKVYEA T0319 104 :SIAEGE 1woyA 116 :DIYYGE T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY T0319 131 :PPHL 1woyA 135 :TEKE Number of specific fragments extracted= 7 number of extra gaps= 0 total=76 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1894519217.pdb -s /var/tmp/to_scwrl_1894519217.seq -o /var/tmp/from_scwrl_1894519217.pdb > /var/tmp/scwrl_1894519217.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1894519217.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aa6/T0319-1aa6-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1aa6 expands to /projects/compbio/data/pdb/1aa6.pdb.gz 1aa6:Warning: there is no chain 1aa6 will retry with 1aa6A # T0319 read from 1aa6/T0319-1aa6-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1aa6 read from 1aa6/T0319-1aa6-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1aa6 to template set # found chain 1aa6 in template set T0319 54 :VDWPAVLTVAAELGNN 1aa6 477 :TDWQIISEIATRMGYP T0319 76 :PSFPS 1aa6 493 :MHYNN T0319 89 :DMAILNDLHTL 1aa6 498 :TQEIWDELRHL T0319 112 :CRN 1aa6 509 :CPD Number of specific fragments extracted= 4 number of extra gaps= 0 total=80 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_786039021.pdb -s /var/tmp/to_scwrl_786039021.seq -o /var/tmp/from_scwrl_786039021.pdb > /var/tmp/scwrl_786039021.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_786039021.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cc0A/T0319-2cc0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cc0A expands to /projects/compbio/data/pdb/2cc0.pdb.gz 2cc0A:Skipped atom 13, because occupancy 0.200 <= existing 0.800 in 2cc0A Skipped atom 17, because occupancy 0.200 <= existing 0.800 in 2cc0A Skipped atom 19, because occupancy 0.200 <= existing 0.800 in 2cc0A Skipped atom 120, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 124, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 126, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 346, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 350, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 352, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 523, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 527, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 529, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 531, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 635, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 639, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 641, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 643, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 645, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 647, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 649, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 651, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 732, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 736, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 738, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 740, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 742, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 744, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 862, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 863, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 867, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 868, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 870, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 871, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 951, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 955, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 957, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 959, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 961, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1100, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1104, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1106, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1108, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1110, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1112, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1378, because occupancy 0.200 <= existing 0.800 in 2cc0A Skipped atom 1382, because occupancy 0.200 <= existing 0.800 in 2cc0A Skipped atom 1384, because occupancy 0.200 <= existing 0.800 in 2cc0A Skipped atom 1397, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1401, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1403, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1405, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1407, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1431, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1435, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1437, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1439, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1441, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1443, because occupancy 0.500 <= existing 0.500 in 2cc0A Skipped atom 1457, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1458, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1462, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1463, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1465, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1466, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1468, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1469, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1471, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1472, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1474, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1475, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1477, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1478, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1480, because occupancy 0.330 <= existing 0.330 in 2cc0A Skipped atom 1481, because occupancy 0.330 <= existing 0.330 in 2cc0A # T0319 read from 2cc0A/T0319-2cc0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cc0A read from 2cc0A/T0319-2cc0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2cc0A to template set # found chain 2cc0A in template set T0319 50 :IVDRVDWPAVLTVAAELGNNAL 2cc0A 130 :DWNNASTDAIVQAVSRLGNGQV T0319 75 :K 2cc0A 157 :W T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 158 :PANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHIY 2cc0A 184 :PQTGRAV Number of specific fragments extracted= 4 number of extra gaps= 0 total=84 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1931513969.pdb -s /var/tmp/to_scwrl_1931513969.seq -o /var/tmp/from_scwrl_1931513969.pdb > /var/tmp/scwrl_1931513969.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1931513969.pdb Number of alignments=19 # command:# reading script from file T0319.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dx8A/T0319-1dx8A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dx8A expands to /projects/compbio/data/pdb/1dx8.pdb.gz 1dx8A:# T0319 read from 1dx8A/T0319-1dx8A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1dx8A read from 1dx8A/T0319-1dx8A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1dx8A to template set # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYY 1dx8A 2 :EIDEGKYECEACGYIYE Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rlyA/T0319-1rlyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1rlyA/T0319-1rlyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rlyA read from 1rlyA/T0319-1rlyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1rlyA in template set T0319 69 :NALPPTKPSFPSSIQELTDD 1rlyA 10 :LPRVTCPNHPDAILVEDYRA T0319 108 :GEMKCRNCGHI 1rlyA 30 :GDMICPECGLV Number of specific fragments extracted= 2 number of extra gaps= 0 total=87 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1605539861.pdb -s /var/tmp/to_scwrl_1605539861.seq -o /var/tmp/from_scwrl_1605539861.pdb > /var/tmp/scwrl_1605539861.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1605539861.pdb Number of alignments=20 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yk4A/T0319-1yk4A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1yk4A/T0319-1yk4A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yk4A read from 1yk4A/T0319-1yk4A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIP 1yk4A 3 :KLSCKICGYIYDEDEGDP Number of specific fragments extracted= 1 number of extra gaps= 0 total=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vq0A/T0319-1vq0A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1vq0A/T0319-1vq0A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vq0A read from 1vq0A/T0319-1vq0A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vq0A in template set T0319 27 :YDGSKCQLVQD 1vq0A 219 :VGFVETAEIKY T0319 39 :SIEFNPEFLLNIVDRVDWPAVLTVAAE 1vq0A 230 :KCDCNREKAKNALLVLDKKELEDMRKE T0319 67 :G 1vq0A 257 :G T0319 107 :EGEMKCRNCGHIYYIK 1vq0A 258 :KGEVVCKWCNTRYVFS Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1021784812.pdb -s /var/tmp/to_scwrl_1021784812.seq -o /var/tmp/from_scwrl_1021784812.pdb > /var/tmp/scwrl_1021784812.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1021784812.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1woyA/T0319-1woyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1woyA/T0319-1woyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1woyA read from 1woyA/T0319-1woyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1woyA in template set T0319 4 :LTTNFLKC 1woyA 44 :FFLTGTDE T0319 27 :YDGSKCQLVQDESIE 1woyA 52 :HGETVYRAAQAAGED T0319 43 :NPEFLLNIVDR 1woyA 67 :PKAFVDRVSGR T0319 59 :VLTVAAELGN 1woyA 78 :FKRAWDLLGI T0319 77 :SFPSSIQELTDDDMAILNDLHTLLLQT 1woyA 88 :AYDDFIRTTEERHKKVVQLVLKKVYEA T0319 104 :SIAEGE 1woyA 116 :DIYYGE T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY T0319 131 :PPHLV 1woyA 135 :TEKEL Number of specific fragments extracted= 8 number of extra gaps= 0 total=100 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_586235379.pdb -s /var/tmp/to_scwrl_586235379.seq -o /var/tmp/from_scwrl_586235379.pdb > /var/tmp/scwrl_586235379.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_586235379.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v87A/T0319-1v87A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1v87A/T0319-1v87A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1v87A read from 1v87A/T0319-1v87A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1v87A in template set T0319 87 :DDDMAILNDL 1v87A 7 :GEPEQVIRKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=101 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aa6/T0319-1aa6-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1aa6/T0319-1aa6-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1aa6 read from 1aa6/T0319-1aa6-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1aa6 in template set T0319 53 :RVDWPAVLTVAAELGNN 1aa6 476 :KTDWQIISEIATRMGYP T0319 78 :F 1aa6 493 :M T0319 85 :LTDDDMAILNDLHTL 1aa6 494 :HYNNTQEIWDELRHL T0319 112 :CR 1aa6 509 :CP Number of specific fragments extracted= 4 number of extra gaps= 0 total=105 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_2032894976.pdb -s /var/tmp/to_scwrl_2032894976.seq -o /var/tmp/from_scwrl_2032894976.pdb > /var/tmp/scwrl_2032894976.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2032894976.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5eA/T0319-2b5eA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5eA expands to /projects/compbio/data/pdb/2b5e.pdb.gz 2b5eA:Skipped atom 316, because occupancy 0.200 <= existing 0.800 in 2b5eA Skipped atom 318, because occupancy 0.200 <= existing 0.800 in 2b5eA Skipped atom 338, because occupancy 0.200 <= existing 0.800 in 2b5eA Skipped atom 340, because occupancy 0.200 <= existing 0.800 in 2b5eA # T0319 read from 2b5eA/T0319-2b5eA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2b5eA read from 2b5eA/T0319-2b5eA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2b5eA to template set # found chain 2b5eA in template set Warning: unaligning (T0319)Q36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b5eA)V466 Warning: unaligning (T0319)D37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b5eA)V466 T0319 2 :KFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLV 2b5eA 431 :LIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSES T0319 38 :ESIEFNPEFLLNIVDR 2b5eA 467 :YQGSRSLDSLFDFIKE T0319 54 :VDWPAVLTVAAE 2b5eA 488 :VDGKALYEEAQE Number of specific fragments extracted= 3 number of extra gaps= 1 total=108 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_262692685.pdb -s /var/tmp/to_scwrl_262692685.seq -o /var/tmp/from_scwrl_262692685.pdb > /var/tmp/scwrl_262692685.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_262692685.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fpqA/T0319-1fpqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fpqA expands to /projects/compbio/data/pdb/1fpq.pdb.gz 1fpqA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0319 read from 1fpqA/T0319-1fpqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fpqA read from 1fpqA/T0319-1fpqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1fpqA to template set # found chain 1fpqA in template set T0319 43 :NPEFLLNIVDRV 1fpqA 22 :DSACLSAMVLTT T0319 56 :WPAVLTVAAELGN 1fpqA 37 :YPAVLNAAIDLNL T0319 69 :NALPPTK 1fpqA 55 :KATPPGA T0319 78 :FPSS 1fpqA 72 :LPAS T0319 84 :ELTDDDMAILNDLHTLLLQTS 1fpqA 76 :TQHSDLPNRLDRMLRLLASYS T0319 105 :IAEGEMKCRNCGHI 1fpqA 98 :LTSTTRTIEDGGAE Number of specific fragments extracted= 6 number of extra gaps= 0 total=114 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1859031535.pdb -s /var/tmp/to_scwrl_1859031535.seq -o /var/tmp/from_scwrl_1859031535.pdb > /var/tmp/scwrl_1859031535.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1859031535.pdb Number of alignments=25 # command:# reading script from file T0319.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rlyA/T0319-1rlyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1rlyA/T0319-1rlyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rlyA read from 1rlyA/T0319-1rlyA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1rlyA in template set T0319 69 :NALPPTKPSFPSSIQELTDD 1rlyA 10 :LPRVTCPNHPDAILVEDYRA T0319 108 :GEMKCRNCGHI 1rlyA 30 :GDMICPECGLV Number of specific fragments extracted= 2 number of extra gaps= 0 total=116 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1338299903.pdb -s /var/tmp/to_scwrl_1338299903.seq -o /var/tmp/from_scwrl_1338299903.pdb > /var/tmp/scwrl_1338299903.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1338299903.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yk4A/T0319-1yk4A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1yk4A/T0319-1yk4A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yk4A read from 1yk4A/T0319-1yk4A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=117 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1543324175.pdb -s /var/tmp/to_scwrl_1543324175.seq -o /var/tmp/from_scwrl_1543324175.pdb > /var/tmp/scwrl_1543324175.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1543324175.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vq0A/T0319-1vq0A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1vq0A/T0319-1vq0A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vq0A read from 1vq0A/T0319-1vq0A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vq0A in template set T0319 27 :YDGSKCQLVQD 1vq0A 219 :VGFVETAEIKY T0319 39 :SIEFNPEFLLNIVDRVDWPAVLTVAAE 1vq0A 230 :KCDCNREKAKNALLVLDKKELEDMRKE T0319 67 :G 1vq0A 257 :G T0319 107 :EGEMKCRNCGHIYYIK 1vq0A 258 :KGEVVCKWCNTRYVFS Number of specific fragments extracted= 4 number of extra gaps= 0 total=121 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1985433482.pdb -s /var/tmp/to_scwrl_1985433482.seq -o /var/tmp/from_scwrl_1985433482.pdb > /var/tmp/scwrl_1985433482.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1985433482.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iro/T0319-1iro-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1iro/T0319-1iro-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1iro read from 1iro/T0319-1iro-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIP 1iro 4 :YTCTVCGYIYNPEDGDP Number of specific fragments extracted= 1 number of extra gaps= 0 total=122 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zin/T0319-1zin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1zin/T0319-1zin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zin read from 1zin/T0319-1zin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zin in training set T0319 45 :EFLLNIVDR 1zin 66 :GIVRERLSK T0319 56 :WPAVLTVAAELGNN 1zin 93 :AEALETMLADIGRK T0319 71 :LP 1zin 107 :LD T0319 89 :DMAILNDLHT 1zin 116 :RQDVLMERLT T0319 108 :GEMKCRNCGHIYY 1zin 126 :GRRICRNCGATYH Number of specific fragments extracted= 5 number of extra gaps= 0 total=127 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_395279207.pdb -s /var/tmp/to_scwrl_395279207.seq -o /var/tmp/from_scwrl_395279207.pdb > /var/tmp/scwrl_395279207.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_395279207.pdb Number of alignments=29 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1woyA/T0319-1woyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1woyA/T0319-1woyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1woyA read from 1woyA/T0319-1woyA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1woyA in template set T0319 44 :PEFLLNIVDR 1woyA 68 :KAFVDRVSGR T0319 59 :VLTVAAELGNN 1woyA 78 :FKRAWDLLGIA T0319 82 :IQE 1woyA 89 :YDD T0319 85 :LTDDDMAILNDLHTLLLQT 1woyA 96 :TEERHKKVVQLVLKKVYEA T0319 104 :SIAEGE 1woyA 116 :DIYYGE T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY T0319 131 :PPHL 1woyA 135 :TEKE Number of specific fragments extracted= 7 number of extra gaps= 0 total=134 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_606199759.pdb -s /var/tmp/to_scwrl_606199759.seq -o /var/tmp/from_scwrl_606199759.pdb > /var/tmp/scwrl_606199759.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_606199759.pdb Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1weoA/T0319-1weoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1weoA/T0319-1weoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1weoA read from 1weoA/T0319-1weoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1weoA in template set T0319 12 :SVKACDTSNDNFPLQ 1weoA 22 :CGDQIGLTVEGDLFV T0319 34 :LVQDESIEFNPEFLLNIVDRVD 1weoA 37 :ACNECGFPACRPCYEYERREGT T0319 67 :GNNAL 1weoA 64 :CKTRY T0319 72 :PPTKPSF 1weoA 71 :LRGSPRV T0319 80 :SSIQELTDDD 1weoA 78 :EGDEDEEDID Number of specific fragments extracted= 5 number of extra gaps= 0 total=139 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_358984857.pdb -s /var/tmp/to_scwrl_358984857.seq -o /var/tmp/from_scwrl_358984857.pdb > /var/tmp/scwrl_358984857.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_358984857.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wdjA/T0319-1wdjA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1wdjA/T0319-1wdjA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wdjA read from 1wdjA/T0319-1wdjA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1wdjA in template set T0319 37 :DESIEFNPEF 1wdjA 6 :DLARPVSEEE T0319 59 :VLTVAAELGN 1wdjA 16 :LRRLSELNPG T0319 72 :PPTKP 1wdjA 31 :SPEGR T0319 82 :IQELTDDDMAILNDLHTLLLQT 1wdjA 38 :VSPTGGESGRRSLQLAYQLARW T0319 104 :SIA 1wdjA 67 :VVF T0319 114 :NCGHIYYIKNG 1wdjA 70 :DSSTGFKFPDG Number of specific fragments extracted= 6 number of extra gaps= 0 total=145 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_435889744.pdb -s /var/tmp/to_scwrl_435889744.seq -o /var/tmp/from_scwrl_435889744.pdb > /var/tmp/scwrl_435889744.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_435889744.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fp1D/T0319-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1fp1D/T0319-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fp1D read from 1fp1D/T0319-1fp1D-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1fp1D in template set T0319 37 :DESIEFNPEFLLNIVDR 1fp1D 58 :PPGAFMSPSEIASKLPA T0319 83 :QELTDDDMAILNDLHTLLLQTS 1fp1D 75 :STQHSDLPNRLDRMLRLLASYS T0319 105 :IAEGEMKCRNCG 1fp1D 98 :LTSTTRTIEDGG T0319 117 :HIYYIKNGIPNLLL 1fp1D 112 :RVYGLSMVGKYLVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=149 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_1344593498.pdb -s /var/tmp/to_scwrl_1344593498.seq -o /var/tmp/from_scwrl_1344593498.pdb > /var/tmp/scwrl_1344593498.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1344593498.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cc0A/T0319-2cc0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 2cc0A/T0319-2cc0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cc0A read from 2cc0A/T0319-2cc0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2cc0A in template set T0319 50 :IVDRVDWPAVLTVAAELGNNAL 2cc0A 130 :DWNNASTDAIVQAVSRLGNGQV T0319 75 :K 2cc0A 157 :W T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 158 :PANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHIY 2cc0A 184 :PQTGRAV Number of specific fragments extracted= 4 number of extra gaps= 0 total=153 # request to SCWRL produces command: ulimit -t 122 ; scwrl3 -i /var/tmp/to_scwrl_378469911.pdb -s /var/tmp/to_scwrl_378469911.seq -o /var/tmp/from_scwrl_378469911.pdb > /var/tmp/scwrl_378469911.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_378469911.pdb Number of alignments=34 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0319//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0319/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0319//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0319/manyalignments-local.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0319/manyalignments-local.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0319/manyalignments-local.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f4mA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f4mA expands to /projects/compbio/data/pdb/2f4m.pdb.gz 2f4mA:# T0319 read from 2f4mA/merged-local-a2m # 2f4mA read from 2f4mA/merged-local-a2m # adding 2f4mA to template set # found chain 2f4mA in template set T0319 6 :TNFLK 2f4mA 328 :WDYTD T0319 133 :H 2f4mA 333 :H Number of specific fragments extracted= 2 number of extra gaps= 0 total=155 Number of alignments=35 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=155 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 16 :CDTS 2f4mA 349 :CDAC T0319 126 :PNLLLPPHLV 2f4mA 353 :EDVCDKPLLY Number of specific fragments extracted= 2 number of extra gaps= 0 total=157 Number of alignments=36 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 34 :LVQDESIEFNPEFL 2f4mA 226 :LLLELLHWFKEEFF T0319 49 :NIVDRVD 2f4mA 240 :RWVNNIV T0319 56 :WPAVLTVAAELGN 2f4mA 251 :GGETRSRDEALLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=160 Number of alignments=37 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 83 :QELTDDDMAIL 2f4mA 420 :LSLSESRRKEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=161 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=161 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 80 :SSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCG 2f4mA 215 :DKGTNVSDEDFLLLELLHWFKEEFFRWVNNIVCSKCG Number of specific fragments extracted= 1 number of extra gaps= 0 total=162 Number of alignments=38 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 81 :SIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHI 2f4mA 216 :KGTNVSDEDFLLLELLHWFKEEFFRWVNNIVCSKCGGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=163 Number of alignments=39 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 80 :SSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIY 2f4mA 215 :DKGTNVSDEDFLLLELLHWFKEEFFRWVNNIVCSKCGGET T0319 122 :KNGIPNLLLPPHL 2f4mA 255 :RSRDEALLPNDDE Number of specific fragments extracted= 2 number of extra gaps= 0 total=165 Number of alignments=40 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 43 :NPEFLLNIVDRVDWPAVLTVAAE 2f4mA 184 :NPVLQEKALTCIPVSELKRKAQE T0319 73 :PTKPSF 2f4mA 212 :RKLDKG T0319 83 :QELTDD 2f4mA 218 :TNVSDE T0319 90 :MAILNDLHTLLLQTSIAE 2f4mA 224 :DFLLLELLHWFKEEFFRW T0319 108 :GEMKCRNCGHI 2f4mA 243 :NNIVCSKCGGE T0319 121 :IKNGIPNLLLPPHL 2f4mA 254 :TRSRDEALLPNDDE Number of specific fragments extracted= 6 number of extra gaps= 0 total=171 Number of alignments=41 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 80 :SSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCG 2f4mA 215 :DKGTNVSDEDFLLLELLHWFKEEFFRWVNNIVCSKCG Number of specific fragments extracted= 1 number of extra gaps= 0 total=172 Number of alignments=42 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 84 :ELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHI 2f4mA 219 :NVSDEDFLLLELLHWFKEEFFRWVNNIVCSKCGGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=173 Number of alignments=43 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 80 :SSIQELT 2f4mA 215 :DKGTNVS T0319 88 :DDMAILNDLHTLLL 2f4mA 222 :DEDFLLLELLHWFK T0319 102 :QTSIAEGEMKCRNCGHIY 2f4mA 237 :EFFRWVNNIVCSKCGGET T0319 122 :KNGIPNLLLPPHLV 2f4mA 255 :RSRDEALLPNDDEL Number of specific fragments extracted= 4 number of extra gaps= 0 total=177 Number of alignments=44 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 43 :NPEFLLNIVDRVDWPAVLTVAAE 2f4mA 184 :NPVLQEKALTCIPVSELKRKAQE T0319 67 :GN 2f4mA 212 :RK T0319 72 :PPTKPSFPS 2f4mA 214 :LDKGTNVSD T0319 89 :DMAILNDLHTLLLQTSIAE 2f4mA 223 :EDFLLLELLHWFKEEFFRW T0319 108 :GEMKCRNCGHI 2f4mA 243 :NNIVCSKCGGE T0319 121 :IKNGIPNLLLPPHL 2f4mA 254 :TRSRDEALLPNDDE Number of specific fragments extracted= 6 number of extra gaps= 0 total=183 Number of alignments=45 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 110 :MKCRNCG 2f4mA 245 :IVCSKCG Number of specific fragments extracted= 1 number of extra gaps= 0 total=184 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=184 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 76 :PSFPSS 2f4mA 212 :RKLDKG T0319 84 :ELTDDDMAILNDLHTLLLQ 2f4mA 218 :TNVSDEDFLLLELLHWFKE T0319 103 :TSIAEGEMKCRNCGHIY 2f4mA 238 :FFRWVNNIVCSKCGGET T0319 122 :KNGIPNLLLPPHL 2f4mA 255 :RSRDEALLPNDDE Number of specific fragments extracted= 4 number of extra gaps= 0 total=188 Number of alignments=46 # 2f4mA read from 2f4mA/merged-local-a2m # found chain 2f4mA in template set T0319 43 :NPEFLLNIVDRVDWPAVLTVAAE 2f4mA 184 :NPVLQEKALTCIPVSELKRKAQE T0319 66 :LGN 2f4mA 211 :ARK T0319 72 :PPTKP 2f4mA 214 :LDKGT T0319 85 :LTDDDMAILNDLHTLLLQTSIAE 2f4mA 219 :NVSDEDFLLLELLHWFKEEFFRW T0319 108 :GEMKCRNCGH 2f4mA 243 :NNIVCSKCGG Number of specific fragments extracted= 5 number of extra gaps= 0 total=193 Number of alignments=47 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zin/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1zin/merged-local-a2m # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 3 :FLTTNF 1zin 19 :KIVAAY T0319 12 :SVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPE 1zin 25 :GIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDL T0319 49 :NIVDRVD 1zin 67 :IVRERLS T0319 63 :AAELGNNALPPTKPSFPSSIQELT 1zin 74 :KDDCQNGFLLDGFPRTVAQAEALE T0319 87 :DDDMAILNDLHTLLLQTSIA 1zin 106 :KLDYVIHIDVRQDVLMERLT T0319 110 :MKCRNCGHIYYIKNGIPN 1zin 128 :RICRNCGATYHLIFHPPA Number of specific fragments extracted= 6 number of extra gaps= 0 total=199 Number of alignments=48 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 78 :FPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCG 1zin 68 :VRERLSKDDCQNGFLLDGFPRTVAQAEALETMLADIGRK T0319 132 :PHLV 1zin 107 :LDYV Number of specific fragments extracted= 2 number of extra gaps= 0 total=201 Number of alignments=49 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 42 :FNPE 1zin 67 :IVRE T0319 46 :FLLNIVD 1zin 78 :QNGFLLD T0319 53 :RVDWPAVLTVAAELGNN 1zin 90 :VAQAEALETMLADIGRK T0319 96 :L 1zin 107 :L T0319 97 :HTLLLQT 1zin 109 :YVIHIDV Number of specific fragments extracted= 5 number of extra gaps= 0 total=206 Number of alignments=50 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 70 :ALPPTKPSFP 1zin 141 :FHPPAKPGVC T0319 84 :ELTDDDMAILND 1zin 151 :DKCGGELYQRAD Number of specific fragments extracted= 2 number of extra gaps= 0 total=208 Number of alignments=51 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 46 :FLLNIVDRVDWPAVLTVAAELGNNAL 1zin 81 :FLLDGFPRTVAQAEALETMLADIGRK Number of specific fragments extracted= 1 number of extra gaps= 0 total=209 Number of alignments=52 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 107 :EGEMKCRNCGHIYYIKNGIP 1zin 125 :TGRRICRNCGATYHLIFHPP Number of specific fragments extracted= 1 number of extra gaps= 0 total=210 Number of alignments=53 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=210 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 106 :AEGEMKCRNCGHIYYIKNGIP 1zin 124 :LTGRRICRNCGATYHLIFHPP Number of specific fragments extracted= 1 number of extra gaps= 0 total=211 Number of alignments=54 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 19 :SNDNFPLQYDGSKCQ 1zin 39 :MKEGTPLGLQAKQYM T0319 34 :LVQDESIEFNPEFLLNIVDRVD 1zin 55 :RGDLVPDEVTIGIVRERLSKDD T0319 59 :VL 1zin 77 :CQ T0319 64 :AELGNNALPPTKP 1zin 79 :NGFLLDGFPRTVA T0319 78 :FPSSIQELTDDDMAILNDLHTLLLQTSIA 1zin 92 :QAEALETMLADIGRKLDYVIHIDVRQDVL T0319 107 :EGEMKCRNCGHIYYIKNGIP 1zin 125 :TGRRICRNCGATYHLIFHPP Number of specific fragments extracted= 6 number of extra gaps= 0 total=217 Number of alignments=55 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 89 :DMAILNDL 1zin 117 :QDVLMERL T0319 107 :EGEMKCRNCGHIYYIKNGIPN 1zin 125 :TGRRICRNCGATYHLIFHPPA Number of specific fragments extracted= 2 number of extra gaps= 0 total=219 Number of alignments=56 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 45 :EFLLNIVDR 1zin 66 :GIVRERLSK T0319 56 :WPAVLTVAAELGNN 1zin 93 :AEALETMLADIGRK T0319 71 :LP 1zin 107 :LD T0319 89 :DMAILNDLHT 1zin 116 :RQDVLMERLT T0319 108 :GEMKCRNCGHIYY 1zin 126 :GRRICRNCGATYH Number of specific fragments extracted= 5 number of extra gaps= 0 total=224 Number of alignments=57 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 108 :GEMKCRNCGHIYYIKNGIP 1zin 126 :GRRICRNCGATYHLIFHPP Number of specific fragments extracted= 1 number of extra gaps= 0 total=225 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 19 :SNDNFPLQYDGSK 1zin 39 :MKEGTPLGLQAKQ T0319 32 :CQLVQDESIEFNPEFLLNIVDRVD 1zin 53 :MDRGDLVPDEVTIGIVRERLSKDD T0319 62 :VAAELGNNALPPTKPS 1zin 77 :CQNGFLLDGFPRTVAQ T0319 79 :PSSIQELTDDDMAILNDLHTLLLQTSI 1zin 93 :AEALETMLADIGRKLDYVIHIDVRQDV T0319 106 :AEGEMKCRNCGHIYYIKNGIP 1zin 124 :LTGRRICRNCGATYHLIFHPP Number of specific fragments extracted= 5 number of extra gaps= 0 total=230 Number of alignments=58 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 89 :DMAILNDLH 1zin 117 :QDVLMERLT T0319 108 :GEMKCRNCGHIYYIKNGIPN 1zin 126 :GRRICRNCGATYHLIFHPPA Number of specific fragments extracted= 2 number of extra gaps= 0 total=232 Number of alignments=59 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 45 :EFLLNIVDR 1zin 66 :GIVRERLSK T0319 56 :WPAVLTVAAELGNN 1zin 93 :AEALETMLADIGRK T0319 71 :LP 1zin 107 :LD T0319 84 :EL 1zin 114 :DV T0319 89 :DMAILNDLHT 1zin 116 :RQDVLMERLT T0319 108 :GEMKCRNCGHIYY 1zin 126 :GRRICRNCGATYH Number of specific fragments extracted= 6 number of extra gaps= 0 total=238 Number of alignments=60 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 108 :GEMKCRNCGHIYYI 1zin 126 :GRRICRNCGATYHL Number of specific fragments extracted= 1 number of extra gaps= 0 total=239 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 106 :AEGEMKCRNCGHIYYI 1zin 124 :LTGRRICRNCGATYHL Number of specific fragments extracted= 1 number of extra gaps= 0 total=240 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 94 :NDL 1zin 122 :ERL T0319 107 :EGEMKCRNCGHIYYIKNGIP 1zin 125 :TGRRICRNCGATYHLIFHPP Number of specific fragments extracted= 2 number of extra gaps= 0 total=242 Number of alignments=61 # 1zin read from 1zin/merged-local-a2m # found chain 1zin in training set T0319 56 :WPAVLTVAAELGN 1zin 93 :AEALETMLADIGR T0319 77 :SFP 1zin 106 :KLD T0319 89 :DMAIL 1zin 116 :RQDVL T0319 97 :HTLLL 1zin 121 :MERLT T0319 108 :GEMKCRNCGHIY 1zin 126 :GRRICRNCGATY Number of specific fragments extracted= 5 number of extra gaps= 0 total=247 Number of alignments=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iro/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1iro/merged-local-a2m # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 108 :GEMKCRNCGHIYYIKNGIPNLLLPP 1iro 2 :KKYTCTVCGYIYNPEDGDPDNGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=248 Number of alignments=63 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1iro 3 :KYTCTVCGYIYNPEDGDPDNGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=249 Number of alignments=64 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPP 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=250 Number of alignments=65 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1iro 3 :KYTCTVCGYIYNPEDGDPDNGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=251 Number of alignments=66 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 108 :GEMKCRNCGHIYYIKNGIPNLLLPP 1iro 2 :KKYTCTVCGYIYNPEDGDPDNGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=252 Number of alignments=67 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1iro 3 :KYTCTVCGYIYNPEDGDPDNGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=253 Number of alignments=68 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1iro 3 :KYTCTVCGYIYNPEDGDPDNGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=254 Number of alignments=69 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 111 :KCRNCGHIYYIKNGIPN 1iro 5 :TCTVCGYIYNPEDGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=255 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 111 :KCRNCGHIYYIKNGIPNLLLP 1iro 5 :TCTVCGYIYNPEDGDPDNGVN Number of specific fragments extracted= 1 number of extra gaps= 0 total=256 Number of alignments=70 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHL 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNPGT Number of specific fragments extracted= 1 number of extra gaps= 0 total=257 Number of alignments=71 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNPGTD Number of specific fragments extracted= 1 number of extra gaps= 0 total=258 Number of alignments=72 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 111 :KCRNCGHIYYIKNGIPN 1iro 5 :TCTVCGYIYNPEDGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 111 :KCRNCGHIYYIKNGIPNLLL 1iro 5 :TCTVCGYIYNPEDGDPDNGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=73 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHL 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNPGT Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=74 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNPGTD Number of specific fragments extracted= 1 number of extra gaps= 0 total=262 Number of alignments=75 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 111 :KCRNCGHIYYIKNGIPN 1iro 5 :TCTVCGYIYNPEDGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=263 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 111 :KCRNCGHIYYIKNGIPN 1iro 5 :TCTVCGYIYNPEDGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=264 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPH 1iro 4 :YTCTVCGYIYNPEDGDPDNGVNPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=265 Number of alignments=76 # 1iro read from 1iro/merged-local-a2m # found chain 1iro in template set T0319 110 :MKCRNCGHIYYIKNGIP 1iro 4 :YTCTVCGYIYNPEDGDP Number of specific fragments extracted= 1 number of extra gaps= 0 total=266 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rlyA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1rlyA/merged-local-a2m # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1rlyA 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=267 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 99 :LLLQTSIAEGEMKCRNCGHI 1rlyA 21 :AILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=268 Number of alignments=77 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 101 :LQTSIAEGEMKCRNCGHI 1rlyA 23 :LVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=269 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 100 :LLQTSIAEGEMKCRNCGHIY 1rlyA 22 :ILVEDYRAGDMICPECGLVV Number of specific fragments extracted= 1 number of extra gaps= 0 total=270 Number of alignments=78 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1rlyA 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=271 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 97 :HTLLLQTSIAEGEMKCRNCGHI 1rlyA 19 :PDAILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=272 Number of alignments=79 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 108 :GEMKCRNCGHI 1rlyA 30 :GDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=273 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1rlyA 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=274 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 69 :NALPP 1rlyA 8 :DALPR T0319 74 :TKPSFPSS 1rlyA 14 :TCPNHPDA T0319 82 :IQELTDDD 1rlyA 24 :VEDYRAGD T0319 110 :MKCRNCGHI 1rlyA 32 :MICPECGLV T0319 121 :IKNGI 1rlyA 41 :VGDRV T0319 129 :LLPPHL 1rlyA 46 :IDVGSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=280 Number of alignments=80 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 69 :NALP 1rlyA 8 :DALP T0319 73 :PTKPSFPSS 1rlyA 13 :VTCPNHPDA T0319 82 :IQELTDDD 1rlyA 24 :VEDYRAGD T0319 110 :MKCRNCGHI 1rlyA 32 :MICPECGLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=284 Number of alignments=81 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 108 :GEMKCRNCGHI 1rlyA 30 :GDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=285 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1rlyA 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=286 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 68 :NNALPPTKPSFPSSIQELTDD 1rlyA 7 :LDALPRVTCPNHPDAILVEDY T0319 106 :AEGEMKCRNCGHI 1rlyA 28 :RAGDMICPECGLV T0319 121 :IKNGI 1rlyA 41 :VGDRV T0319 129 :LLPPHLV 1rlyA 46 :IDVGSEW Number of specific fragments extracted= 4 number of extra gaps= 0 total=290 Number of alignments=82 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 68 :NNALP 1rlyA 7 :LDALP T0319 73 :PTKPSFPS 1rlyA 13 :VTCPNHPD T0319 83 :QELTDDD 1rlyA 21 :AILVEDY T0319 106 :AEGEMKCRNCGHI 1rlyA 28 :RAGDMICPECGLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=294 Number of alignments=83 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 108 :GEMKCRNCGHI 1rlyA 30 :GDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=295 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1rlyA 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=296 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 72 :PPTKPSFPSS 1rlyA 12 :RVTCPNHPDA T0319 82 :IQELT 1rlyA 23 :LVEDY T0319 106 :AEGEMKCRNCGHI 1rlyA 28 :RAGDMICPECGLV T0319 121 :IKNGI 1rlyA 41 :VGDRV Number of specific fragments extracted= 4 number of extra gaps= 0 total=300 Number of alignments=84 # 1rlyA read from 1rlyA/merged-local-a2m # found chain 1rlyA in template set T0319 69 :NALPPTKPSFPSSIQELTDD 1rlyA 10 :LPRVTCPNHPDAILVEDYRA T0319 108 :GEMKCRNCGHI 1rlyA 30 :GDMICPECGLV Number of specific fragments extracted= 2 number of extra gaps= 0 total=302 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1woyA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1woyA/merged-local-a2m # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 37 :DESIEFNPEFLLNIVD 1woyA 331 :GQDTPVSEEALRTRYE T0319 53 :RVDWPAVLTVAAELGNNALPPTKP 1woyA 350 :ADDLGNLVQRTRAMLFRFAEGRIP T0319 86 :TDDDMAILNDLHTLL 1woyA 374 :EPVAGEELAEGTGLA Number of specific fragments extracted= 3 number of extra gaps= 0 total=305 Number of alignments=86 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 37 :DESIEFNPEFLLNIVD 1woyA 331 :GQDTPVSEEALRTRYE T0319 53 :RVD 1woyA 349 :LAD T0319 56 :WPAVLTVAAELGNNALPPTKP 1woyA 353 :LGNLVQRTRAMLFRFAEGRIP T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEM 1woyA 374 :EPVAGEELAEGTGLAGRLRPLVREL Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=87 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 37 :DESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFP 1woyA 331 :GQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIP T0319 86 :TDDDMAILNDLHTLL 1woyA 374 :EPVAGEELAEGTGLA Number of specific fragments extracted= 2 number of extra gaps= 0 total=311 Number of alignments=88 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 36 :QDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKP 1woyA 330 :YGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEG T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEM 1woyA 374 :EPVAGEELAEGTGLAGRLRPLVREL Number of specific fragments extracted= 2 number of extra gaps= 0 total=313 Number of alignments=89 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 37 :DESIEFNPEFLLNIVD 1woyA 331 :GQDTPVSEEALRTRYE T0319 53 :RVDWPAVLTVAAELGNNALPPT 1woyA 351 :DDLGNLVQRTRAMLFRFAEGRI T0319 85 :LTDDDMAILNDLHTLL 1woyA 373 :PEPVAGEELAEGTGLA Number of specific fragments extracted= 3 number of extra gaps= 0 total=316 Number of alignments=90 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 36 :QDESIEFNPEFLLNIVD 1woyA 330 :YGQDTPVSEEALRTRYE T0319 53 :RV 1woyA 349 :LA T0319 55 :DWPAVLTVAAELGNNALPPT 1woyA 353 :LGNLVQRTRAMLFRFAEGRI T0319 85 :LTDDDMAILNDLHTLLLQTSIAEGE 1woyA 373 :PEPVAGEELAEGTGLAGRLRPLVRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=320 Number of alignments=91 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY Number of specific fragments extracted= 1 number of extra gaps= 0 total=321 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 55 :DWPAVLTVAAELGNNALPPT 1woyA 81 :AWDLLGIAYDDFIRTTEERH T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYY 1woyA 101 :KKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYT Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=92 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 41 :EFNPEFLLNIVD 1woyA 65 :EDPKAFVDRVSG T0319 58 :AVLTVAAELGNNA 1woyA 77 :RFKRAWDLLGIAY T0319 85 :LTDDDMAILNDLHTLLL 1woyA 96 :TEERHKKVVQLVLKKVY T0319 102 :QTSIAEGE 1woyA 114 :AGDIYYGE T0319 110 :MKCRNCGHIYYIKNGI 1woyA 125 :LYCVSCERFYTEKELV T0319 127 :NLLLPPH 1woyA 141 :EGLCPIH Number of specific fragments extracted= 6 number of extra gaps= 0 total=329 Number of alignments=93 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 44 :PEFLLNIVDR 1woyA 68 :KAFVDRVSGR T0319 59 :VLTVAAELGNNA 1woyA 78 :FKRAWDLLGIAY T0319 83 :QE 1woyA 90 :DD T0319 85 :LTDDDMAILNDLHTLLLQT 1woyA 96 :TEERHKKVVQLVLKKVYEA T0319 104 :SIAEGE 1woyA 116 :DIYYGE T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY T0319 131 :PPHL 1woyA 135 :TEKE Number of specific fragments extracted= 7 number of extra gaps= 0 total=336 Number of alignments=94 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY Number of specific fragments extracted= 1 number of extra gaps= 0 total=337 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 90 :MAILNDLHTL 1woyA 105 :QLVLKKVYEA T0319 103 :TSIAEGE 1woyA 115 :GDIYYGE T0319 110 :MKCRNCGHIYY 1woyA 125 :LYCVSCERFYT Number of specific fragments extracted= 3 number of extra gaps= 0 total=340 Number of alignments=95 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 41 :EFNPEFLLNIV 1woyA 65 :EDPKAFVDRVS T0319 57 :PAVLTVAAELGNNA 1woyA 76 :GRFKRAWDLLGIAY T0319 85 :LTDDDMAILNDLHTLLL 1woyA 96 :TEERHKKVVQLVLKKVY T0319 102 :QTSIAEGE 1woyA 114 :AGDIYYGE T0319 110 :MKCRNCGHIYYIKNG 1woyA 125 :LYCVSCERFYTEKEL T0319 126 :PNLLLPPH 1woyA 140 :VEGLCPIH Number of specific fragments extracted= 6 number of extra gaps= 0 total=346 Number of alignments=96 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 44 :PEFLLNIVDR 1woyA 68 :KAFVDRVSGR T0319 59 :VLTVAAELGNN 1woyA 78 :FKRAWDLLGIA T0319 82 :IQE 1woyA 89 :YDD T0319 85 :LTDDDMAILNDLHTLLLQT 1woyA 96 :TEERHKKVVQLVLKKVYEA T0319 104 :SIAEGE 1woyA 116 :DIYYGE T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY T0319 131 :PPHL 1woyA 135 :TEKE Number of specific fragments extracted= 7 number of extra gaps= 0 total=353 Number of alignments=97 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY Number of specific fragments extracted= 1 number of extra gaps= 0 total=354 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=354 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 37 :DESIEFNPEFLLNIVD 1woyA 61 :QAAGEDPKAFVDRVSG T0319 58 :AVLTVAAELGNNA 1woyA 77 :RFKRAWDLLGIAY T0319 85 :LTDDDMAILNDLHTLLLQT 1woyA 96 :TEERHKKVVQLVLKKVYEA T0319 104 :SIAEGE 1woyA 116 :DIYYGE T0319 110 :MKCRNCGHIYYIKNGI 1woyA 125 :LYCVSCERFYTEKELV Number of specific fragments extracted= 5 number of extra gaps= 0 total=359 Number of alignments=98 # 1woyA read from 1woyA/merged-local-a2m # found chain 1woyA in template set T0319 4 :LTTNFLKC 1woyA 44 :FFLTGTDE T0319 27 :YDGSKCQLVQDESIE 1woyA 52 :HGETVYRAAQAAGED T0319 43 :NPEFLLNIVDR 1woyA 67 :PKAFVDRVSGR T0319 59 :VLTVAAELGN 1woyA 78 :FKRAWDLLGI T0319 77 :SFPSSIQELTDDDMAILNDLHTLLLQT 1woyA 88 :AYDDFIRTTEERHKKVVQLVLKKVYEA T0319 104 :SIAEGE 1woyA 116 :DIYYGE T0319 110 :MKCRNCGHIY 1woyA 125 :LYCVSCERFY T0319 131 :PPHLV 1woyA 135 :TEKEL Number of specific fragments extracted= 8 number of extra gaps= 0 total=367 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dx8A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1dx8A/merged-local-a2m # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 105 :IAEGEMKCRNCGHIYYIKNGIPNLLLPP 1dx8A 3 :IDEGKYECEACGYIYEPEKGDKFAGIPP Number of specific fragments extracted= 1 number of extra gaps= 0 total=368 Number of alignments=100 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 107 :EGEMKCRNCGHIYYIKNGIPNLLLPP 1dx8A 5 :EGKYECEACGYIYEPEKGDKFAGIPP Number of specific fragments extracted= 1 number of extra gaps= 0 total=369 Number of alignments=101 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1dx8A 7 :KYECEACGYIYEPEKGDKFAGIPP Number of specific fragments extracted= 1 number of extra gaps= 0 total=370 Number of alignments=102 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set Warning: unaligning (T0319)T103 because first residue in template chain is (1dx8A)M1 T0319 104 :SIAEGEMKCRNCGHIY 1dx8A 2 :EIDEGKYECEACGYIY Number of specific fragments extracted= 1 number of extra gaps= 0 total=371 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYYIKNG 1dx8A 2 :EIDEGKYECEACGYIYEPEKG Number of specific fragments extracted= 1 number of extra gaps= 0 total=372 Number of alignments=103 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYY 1dx8A 2 :EIDEGKYECEACGYIYE T0319 121 :IKNGIPNLLLPPH 1dx8A 28 :IPPGTPFVDLSDS Number of specific fragments extracted= 2 number of extra gaps= 0 total=374 Number of alignments=104 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYY 1dx8A 2 :EIDEGKYECEACGYIYE T0319 121 :IKNGIPNLLLPPH 1dx8A 28 :IPPGTPFVDLSDS Number of specific fragments extracted= 2 number of extra gaps= 0 total=376 Number of alignments=105 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set Warning: unaligning (T0319)T103 because first residue in template chain is (1dx8A)M1 T0319 104 :SIAEGEMKCRNCGHIY 1dx8A 2 :EIDEGKYECEACGYIY Number of specific fragments extracted= 1 number of extra gaps= 0 total=377 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYYIKNG 1dx8A 2 :EIDEGKYECEACGYIYEPEKG Number of specific fragments extracted= 1 number of extra gaps= 0 total=378 Number of alignments=106 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYY 1dx8A 2 :EIDEGKYECEACGYIYE T0319 121 :IKNGIPNLLLPPH 1dx8A 28 :IPPGTPFVDLSDS Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=107 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYY 1dx8A 2 :EIDEGKYECEACGYIYE T0319 121 :IKNGIPNLLLPPH 1dx8A 28 :IPPGTPFVDLSDS Number of specific fragments extracted= 2 number of extra gaps= 0 total=382 Number of alignments=108 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set Warning: unaligning (T0319)T103 because first residue in template chain is (1dx8A)M1 T0319 104 :SIAEGEMKCRNCGHIYYIKNG 1dx8A 2 :EIDEGKYECEACGYIYEPEKG Number of specific fragments extracted= 1 number of extra gaps= 0 total=383 Number of alignments=109 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYYIKNG 1dx8A 2 :EIDEGKYECEACGYIYEPEKG Number of specific fragments extracted= 1 number of extra gaps= 0 total=384 Number of alignments=110 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYYIKNGI 1dx8A 2 :EIDEGKYECEACGYIYEPEKGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=385 Number of alignments=111 # 1dx8A read from 1dx8A/merged-local-a2m # found chain 1dx8A in template set T0319 104 :SIAEGEMKCRNCGHIYY 1dx8A 2 :EIDEGKYECEACGYIYE Number of specific fragments extracted= 1 number of extra gaps= 0 total=386 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vq0A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1vq0A/merged-local-a2m # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 107 :EGEMKCRNCGHIYYIKN 1vq0A 258 :KGEVVCKWCNTRYVFSE Number of specific fragments extracted= 1 number of extra gaps= 0 total=387 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 76 :PSFPSSIQELTDDDMAILNDLHTL 1vq0A 205 :AEPLDVLERIFGEKVGFVETAEIK T0319 100 :LLQTSIA 1vq0A 249 :ELEDMRK T0319 107 :EGEMKCRNCGHIYYIKNG 1vq0A 258 :KGEVVCKWCNTRYVFSEE Number of specific fragments extracted= 3 number of extra gaps= 0 total=390 Number of alignments=112 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 109 :EMKCRNCGHIYYIK 1vq0A 260 :EVVCKWCNTRYVFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=391 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 56 :WPAVLTVAAELG 1vq0A 185 :VEMIEKNIKNLP T0319 68 :NNALPPT 1vq0A 199 :SKLFQEA T0319 77 :SFPSSIQELTDDDMAILNDL 1vq0A 206 :EPLDVLERIFGEKVGFVETA T0319 97 :HTLLLQTSI 1vq0A 251 :EDMRKEGKG T0319 109 :EMKCRNCGHIYYIKNG 1vq0A 260 :EVVCKWCNTRYVFSEE Number of specific fragments extracted= 5 number of extra gaps= 0 total=396 Number of alignments=113 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 109 :EMKCRNCGHIYYIKN 1vq0A 260 :EVVCKWCNTRYVFSE Number of specific fragments extracted= 1 number of extra gaps= 0 total=397 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 101 :LQTSIAE 1vq0A 250 :LEDMRKE T0319 108 :GEMKCRNCGHIYYIKNGI 1vq0A 259 :GEVVCKWCNTRYVFSEEE Number of specific fragments extracted= 2 number of extra gaps= 0 total=399 Number of alignments=114 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 107 :EGEMKCRNCGHIYYIKNG 1vq0A 258 :KGEVVCKWCNTRYVFSEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=400 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 89 :DMAILNDLHTL 1vq0A 246 :DKKELEDMRKE T0319 106 :AEGEMKCRNCGHIYYIKNG 1vq0A 257 :GKGEVVCKWCNTRYVFSEE Number of specific fragments extracted= 2 number of extra gaps= 0 total=402 Number of alignments=115 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 28 :DGSKCQL 1vq0A 223 :ETAEIKY T0319 39 :SIEFNPEFLLNIVDRV 1vq0A 230 :KCDCNREKAKNALLVL T0319 78 :FPSSIQELTDDD 1vq0A 246 :DKKELEDMRKEG T0319 107 :EGEMKCRNCGHIYYIK 1vq0A 258 :KGEVVCKWCNTRYVFS Number of specific fragments extracted= 4 number of extra gaps= 0 total=406 Number of alignments=116 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 4 :LTTNFLKCSVKACDTS 1vq0A 140 :LAYYFAVSEQIPSAFS T0319 23 :FPLQYDGSKCQL 1vq0A 156 :IGVLVDSDGVKI T0319 35 :VQDESIEFNPEF 1vq0A 173 :VQIIDRTLEQEK T0319 47 :LLNIVDRVDWPAVLTVAA 1vq0A 198 :ISKLFQEAEPLDVLERIF T0319 68 :NNALPPT 1vq0A 216 :GEKVGFV T0319 77 :SFPSSIQE 1vq0A 230 :KCDCNREK T0319 85 :LTDDDMAILNDLH 1vq0A 242 :LLVLDKKELEDMR T0319 106 :AEGEMKCRNCGHIYYIK 1vq0A 257 :GKGEVVCKWCNTRYVFS Number of specific fragments extracted= 8 number of extra gaps= 0 total=414 Number of alignments=117 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 108 :GEMKCRNCGHIYYIKNG 1vq0A 259 :GEVVCKWCNTRYVFSEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=415 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 20 :NDNFPLQYDGSKCQLVQDESIEFNPEFLLNIV 1vq0A 168 :AGGFAVQIIDRTLEQEKVEMIEKNIKNLPSIS T0319 58 :AVLTVAAELGNNA 1vq0A 200 :KLFQEAEPLDVLE T0319 71 :LPPTKPS 1vq0A 214 :IFGEKVG T0319 78 :FPSSIQELTDDDMAILNDLHTLLLQTSIAE 1vq0A 223 :ETAEIKYKCDCNREKAKNALLVLDKKELED T0319 108 :GEMKCRNCGHIYYIKNGI 1vq0A 259 :GEVVCKWCNTRYVFSEEE Number of specific fragments extracted= 5 number of extra gaps= 0 total=420 Number of alignments=118 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 39 :SIEFNPEFLLNIVDRV 1vq0A 230 :KCDCNREKAKNALLVL T0319 78 :FPSSIQELTDDD 1vq0A 246 :DKKELEDMRKEG T0319 107 :EGEMKCRNCGHIYYIK 1vq0A 258 :KGEVVCKWCNTRYVFS Number of specific fragments extracted= 3 number of extra gaps= 0 total=423 Number of alignments=119 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 6 :TNFLKCSVKACDTS 1vq0A 142 :YYFAVSEQIPSAFS T0319 23 :FPLQYDGSKCQL 1vq0A 156 :IGVLVDSDGVKI T0319 35 :VQDESIEFNPEF 1vq0A 173 :VQIIDRTLEQEK T0319 47 :LLNIVDRVDWPAVLTVAA 1vq0A 198 :ISKLFQEAEPLDVLERIF T0319 68 :NNALPP 1vq0A 216 :GEKVGF T0319 74 :TKPSFPSSIQELT 1vq0A 230 :KCDCNREKAKNAL T0319 87 :DDDMAILNDLHTL 1vq0A 244 :VLDKKELEDMRKE T0319 106 :AEGEMKCRNCGHIYYIK 1vq0A 257 :GKGEVVCKWCNTRYVFS Number of specific fragments extracted= 8 number of extra gaps= 0 total=431 Number of alignments=120 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 108 :GEMKCRNCGHIYYIKN 1vq0A 259 :GEVVCKWCNTRYVFSE Number of specific fragments extracted= 1 number of extra gaps= 0 total=432 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 107 :EGEMKCRNCGHIYYIKN 1vq0A 258 :KGEVVCKWCNTRYVFSE Number of specific fragments extracted= 1 number of extra gaps= 0 total=433 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 37 :DESIEFNPEFLLNIVD 1vq0A 228 :KYKCDCNREKAKNALL T0319 77 :SFPSSIQELTDDDM 1vq0A 244 :VLDKKELEDMRKEG T0319 107 :EGEMKCRNCGHIYYIK 1vq0A 258 :KGEVVCKWCNTRYVFS Number of specific fragments extracted= 3 number of extra gaps= 0 total=436 Number of alignments=121 # 1vq0A read from 1vq0A/merged-local-a2m # found chain 1vq0A in template set T0319 27 :YDGSKCQLVQD 1vq0A 219 :VGFVETAEIKY T0319 39 :SIEFNPEFLLNIVDRVDWPAVLTVAAE 1vq0A 230 :KCDCNREKAKNALLVLDKKELEDMRKE T0319 67 :G 1vq0A 257 :G T0319 107 :EGEMKCRNCGHIYYIK 1vq0A 258 :KGEVVCKWCNTRYVFS Number of specific fragments extracted= 4 number of extra gaps= 0 total=440 Number of alignments=122 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rb9/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1rb9/merged-local-a2m # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rb9 3 :KYVCTVCGYEYDPAEGDPDNGVKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=441 Number of alignments=123 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 108 :GEMKCRNCGHIYYIKNGIPNLLLPP 1rb9 2 :KKYVCTVCGYEYDPAEGDPDNGVKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=442 Number of alignments=124 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rb9 3 :KYVCTVCGYEYDPAEGDPDNGVKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=443 Number of alignments=125 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPP 1rb9 4 :YVCTVCGYEYDPAEGDPDNGVKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=444 Number of alignments=126 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rb9 3 :KYVCTVCGYEYDPAEGDPDNGVKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=445 Number of alignments=127 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 108 :GEMKCRNCGHIYYIKNGIPNLLLPP 1rb9 2 :KKYVCTVCGYEYDPAEGDPDNGVKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=446 Number of alignments=128 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rb9 3 :KYVCTVCGYEYDPAEGDPDNGVKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=447 Number of alignments=129 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 111 :KCRNCGHIYYIKNGIPN 1rb9 5 :VCTVCGYEYDPAEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=448 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 111 :KCRNCGHIYYIKNGIPNL 1rb9 5 :VCTVCGYEYDPAEGDPDN Number of specific fragments extracted= 1 number of extra gaps= 0 total=449 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rb9 4 :YVCTVCGYEYDPAEGDPDNGVKPGTS Number of specific fragments extracted= 1 number of extra gaps= 0 total=450 Number of alignments=130 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rb9 4 :YVCTVCGYEYDPAEGDPDNGVKPGTS Number of specific fragments extracted= 1 number of extra gaps= 0 total=451 Number of alignments=131 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 111 :KCRNCGHIYYIKNGIPN 1rb9 5 :VCTVCGYEYDPAEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=452 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 111 :KCRNCGHIYYIKNGIPNL 1rb9 5 :VCTVCGYEYDPAEGDPDN Number of specific fragments extracted= 1 number of extra gaps= 0 total=453 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rb9 4 :YVCTVCGYEYDPAEGDPDNGVKPGTS Number of specific fragments extracted= 1 number of extra gaps= 0 total=454 Number of alignments=132 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rb9 4 :YVCTVCGYEYDPAEGDPDNGVKPGTS Number of specific fragments extracted= 1 number of extra gaps= 0 total=455 Number of alignments=133 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 111 :KCRNCGHIYYIKNGIPN 1rb9 5 :VCTVCGYEYDPAEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=456 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 111 :KCRNCGHIYYIKNGIPN 1rb9 5 :VCTVCGYEYDPAEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=457 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPH 1rb9 4 :YVCTVCGYEYDPAEGDPDNGVKPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=458 Number of alignments=134 # 1rb9 read from 1rb9/merged-local-a2m # found chain 1rb9 in training set T0319 111 :KCRNCGHIYYIKNG 1rb9 5 :VCTVCGYEYDPAEG Number of specific fragments extracted= 1 number of extra gaps= 0 total=459 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v87A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1v87A/merged-local-a2m # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 88 :DDMAILNDLHTLLLQTSIAEGEMKCRN 1v87A 33 :EKLAVASGYSDMTDSKALGPMVVGRLT T0319 115 :CGHIYYI 1v87A 61 :CSHAFHL Number of specific fragments extracted= 2 number of extra gaps= 0 total=461 Number of alignments=135 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 88 :D 1v87A 26 :E T0319 89 :DMAILNDLHTLLLQTSIAEGEMKCR 1v87A 34 :KLAVASGYSDMTDSKALGPMVVGRL T0319 114 :NCGHIYYI 1v87A 60 :KCSHAFHL Number of specific fragments extracted= 3 number of extra gaps= 0 total=464 Number of alignments=136 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 114 :NCGHIYYI 1v87A 60 :KCSHAFHL Number of specific fragments extracted= 1 number of extra gaps= 0 total=465 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 108 :G 1v87A 24 :P T0319 109 :EMKCRNCGHIYY 1v87A 55 :VGRLTKCSHAFH Number of specific fragments extracted= 2 number of extra gaps= 0 total=467 Number of alignments=137 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 107 :EGEMKCRNCGHIY 1v87A 80 :DGSLQCPSCKTIY Number of specific fragments extracted= 1 number of extra gaps= 0 total=468 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 106 :AEGEMKCRNCGHIYY 1v87A 79 :KDGSLQCPSCKTIYG Number of specific fragments extracted= 1 number of extra gaps= 0 total=469 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 106 :AEGEMKCRNCGHIYY 1v87A 79 :KDGSLQCPSCKTIYG Number of specific fragments extracted= 1 number of extra gaps= 0 total=470 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 58 :AVLTVAAELGNNA 1v87A 69 :CLLAMYCNGNKDG Number of specific fragments extracted= 1 number of extra gaps= 0 total=471 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 107 :EGEMKCRNCGHIY 1v87A 80 :DGSLQCPSCKTIY Number of specific fragments extracted= 1 number of extra gaps= 0 total=472 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 106 :AEGEMKCRNCGHIYY 1v87A 79 :KDGSLQCPSCKTIYG Number of specific fragments extracted= 1 number of extra gaps= 0 total=473 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 105 :IAEGEMKCRNCGHIYYIKNG 1v87A 78 :NKDGSLQCPSCKTIYGEKTG Number of specific fragments extracted= 1 number of extra gaps= 0 total=474 Number of alignments=138 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=474 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 107 :EGEMKCRNCGHIY 1v87A 80 :DGSLQCPSCKTIY Number of specific fragments extracted= 1 number of extra gaps= 0 total=475 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 107 :EGEMKCRNCGHIYY 1v87A 80 :DGSLQCPSCKTIYG Number of specific fragments extracted= 1 number of extra gaps= 0 total=476 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 106 :AEGEMKCRNCGHIYYIKNG 1v87A 79 :KDGSLQCPSCKTIYGEKTG Number of specific fragments extracted= 1 number of extra gaps= 0 total=477 # 1v87A read from 1v87A/merged-local-a2m # found chain 1v87A in template set T0319 87 :DDDMAILNDL 1v87A 7 :GEPEQVIRKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=478 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1brfA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1brfA expands to /projects/compbio/data/pdb/1brf.pdb.gz 1brfA:# T0319 read from 1brfA/merged-local-a2m # 1brfA read from 1brfA/merged-local-a2m # adding 1brfA to template set # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=479 Number of alignments=139 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=480 Number of alignments=140 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set Warning: unaligning (T0319)G108 because first residue in template chain is (1brfA)A1 T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=481 Number of alignments=141 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPH 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=482 Number of alignments=142 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=483 Number of alignments=143 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=484 Number of alignments=144 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=485 Number of alignments=145 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 111 :KCRNCGHIYYIKNGIPN 1brfA 4 :VCKICGYIYDEDAGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=486 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 111 :KCRNCGHIYYIKNGIPNLLL 1brfA 4 :VCKICGYIYDEDAGDPDNGI Number of specific fragments extracted= 1 number of extra gaps= 0 total=487 Number of alignments=146 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=488 Number of alignments=147 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=489 Number of alignments=148 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 111 :KCRNCGHIYYIKNGIPN 1brfA 4 :VCKICGYIYDEDAGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=490 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 111 :KCRNCGHIYYIKNGIPNL 1brfA 4 :VCKICGYIYDEDAGDPDN Number of specific fragments extracted= 1 number of extra gaps= 0 total=491 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=492 Number of alignments=149 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=493 Number of alignments=150 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 111 :KCRNCGHIYYIKNGIPN 1brfA 4 :VCKICGYIYDEDAGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=494 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 111 :KCRNCGHIYYIKNGIPN 1brfA 4 :VCKICGYIYDEDAGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=495 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPH 1brfA 2 :KWVCKICGYIYDEDAGDPDNGISPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=496 Number of alignments=151 # 1brfA read from 1brfA/merged-local-a2m # found chain 1brfA in template set T0319 109 :EMKCRNCGHIYYIKNGI 1brfA 2 :KWVCKICGYIYDEDAGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=497 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b7yB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1b7yB/merged-local-a2m # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 52 :DRVDWPAVLTVAAELGNNALPPTKPSFPSSIQEL 1b7yB 163 :NRPDALGLLGLARDLHALGYALVEPEAALKAEAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=498 Number of alignments=152 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set Warning: unaligning (T0319)D87 because of BadResidue code BAD_PEPTIDE in next template residue (1b7yB)P199 T0319 42 :FNP 1b7yB 160 :VTP T0319 52 :DRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELT 1b7yB 163 :NRPDALGLLGLARDLHALGYALVEPEAALKAEALP Number of specific fragments extracted= 2 number of extra gaps= 1 total=500 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set Warning: unaligning (T0319)D87 because of BadResidue code BAD_PEPTIDE in next template residue (1b7yB)P199 T0319 52 :DRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELT 1b7yB 163 :NRPDALGLLGLARDLHALGYALVEPEAALKAEALP Number of specific fragments extracted= 1 number of extra gaps= 1 total=501 Number of alignments=153 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 51 :VDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQEL 1b7yB 162 :PNRPDALGLLGLARDLHALGYALVEPEAALKAEAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=502 Number of alignments=154 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 49 :NIVDRVDWP 1b7yB 658 :EIAQELELP T0319 60 :LTVAAELGNNALPPTKPSFPSSIQELTDDDMAILND 1b7yB 667 :PVHLFELRLPLPDKPLAFQDPSRHPAAFRDLAVVVP Number of specific fragments extracted= 2 number of extra gaps= 0 total=504 Number of alignments=155 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 52 :DRVDWPAVL 1b7yB 163 :NRPDALGLL T0319 61 :TVAAELGNNALPPTKPSFPSSIQELTD 1b7yB 668 :VHLFELRLPLPDKPLAFQDPSRHPAAF Number of specific fragments extracted= 2 number of extra gaps= 0 total=506 Number of alignments=156 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 44 :PEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDD 1b7yB 282 :RLKTLDGVERTLHPEDLVIAGWRGEESFPLGLAGVMGGAESEVRE Number of specific fragments extracted= 1 number of extra gaps= 0 total=507 Number of alignments=157 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set Warning: unaligning (T0319)H117 because of BadResidue code BAD_PEPTIDE in next template residue (1b7yB)V38 Warning: unaligning (T0319)I118 because of BadResidue code BAD_PEPTIDE at template residue (1b7yB)V38 T0319 116 :G 1b7yB 36 :E T0319 119 :YYIKNGI 1b7yB 39 :FPIPRGV Number of specific fragments extracted= 2 number of extra gaps= 1 total=509 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=509 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 57 :PAVLTVAAELGNNALPPTKPSFPSSIQELT 1b7yB 458 :DLVEEVARIQGYETIPLALPAFFPAPDNRG T0319 87 :DDDMAILNDLHTLL 1b7yB 492 :YRKEQRLREVLSGL Number of specific fragments extracted= 2 number of extra gaps= 0 total=511 Number of alignments=158 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 15 :ACDTSNDNFPLQYDGSKC 1b7yB 432 :GCRVEGEGPTYRVTPPSH T0319 39 :SIEFN 1b7yB 450 :RLDLR T0319 55 :DWPAVLTVAAEL 1b7yB 455 :LEEDLVEEVARI T0319 67 :GNNALPPTKPSFPSSIQELT 1b7yB 468 :GYETIPLALPAFFPAPDNRG T0319 87 :DDDMAILNDLHTLLLQTSIAE 1b7yB 489 :EAPYRKEQRLREVLSGLGFQE Number of specific fragments extracted= 5 number of extra gaps= 0 total=516 Number of alignments=159 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 71 :LPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIK 1b7yB 476 :LPAFFPAPDNRGVEAPYRKEQRLREVLSGLGFQEVYTYSFMDPEDARRFRLD Number of specific fragments extracted= 1 number of extra gaps= 0 total=517 Number of alignments=160 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 70 :ALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIY 1b7yB 475 :ALPAFFPAPDNRGVEAPYRKEQRLREVLSGLGFQEVYTYSFMDPEDARRF Number of specific fragments extracted= 1 number of extra gaps= 0 total=518 Number of alignments=161 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 57 :PAVLTVAAEL 1b7yB 457 :EDLVEEVARI T0319 67 :GNNALPPTKPSFPSSIQELT 1b7yB 468 :GYETIPLALPAFFPAPDNRG T0319 87 :DDDMAILNDLHTLL 1b7yB 492 :YRKEQRLREVLSGL Number of specific fragments extracted= 3 number of extra gaps= 0 total=521 Number of alignments=162 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 15 :ACDTSNDNFPLQYDGSKC 1b7yB 432 :GCRVEGEGPTYRVTPPSH T0319 39 :SIEFN 1b7yB 450 :RLDLR T0319 55 :DWPAVLTVAAEL 1b7yB 455 :LEEDLVEEVARI T0319 67 :GNNALPPTKPSFPSSIQELT 1b7yB 468 :GYETIPLALPAFFPAPDNRG T0319 87 :DDDMAILNDLHTLLLQTSIAE 1b7yB 489 :EAPYRKEQRLREVLSGLGFQE Number of specific fragments extracted= 5 number of extra gaps= 0 total=526 Number of alignments=163 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set Warning: unaligning (T0319)H117 because of BadResidue code BAD_PEPTIDE in next template residue (1b7yB)V38 Warning: unaligning (T0319)I118 because of BadResidue code BAD_PEPTIDE at template residue (1b7yB)V38 T0319 116 :G 1b7yB 36 :E T0319 119 :YYIKNGI 1b7yB 39 :FPIPRGV Number of specific fragments extracted= 2 number of extra gaps= 1 total=528 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=528 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 14 :KACDTSNDNFPLQYDGSK 1b7yB 433 :CRVEGEGPTYRVTPPSHR T0319 40 :IEF 1b7yB 451 :LDL T0319 53 :RVDWPAVLTVAAELGNNALPPTKPSFPSSIQE 1b7yB 454 :RLEEDLVEEVARIQGYETIPLALPAFFPAPDN T0319 85 :LTDDDMAILNDLHT 1b7yB 490 :APYRKEQRLREVLS Number of specific fragments extracted= 4 number of extra gaps= 0 total=532 Number of alignments=164 # 1b7yB read from 1b7yB/merged-local-a2m # found chain 1b7yB in template set T0319 14 :KACDTSNDNFPLQYDGSK 1b7yB 433 :CRVEGEGPTYRVTPPSHR T0319 40 :IEFN 1b7yB 451 :LDLR T0319 55 :DWPAVLTVAAEL 1b7yB 455 :LEEDLVEEVARI T0319 67 :GNNALPPTKPS 1b7yB 468 :GYETIPLALPA T0319 78 :FPSSIQELTDDDMAILNDLHTLLLQTSIAE 1b7yB 480 :FPAPDNRGVEAPYRKEQRLREVLSGLGFQE Number of specific fragments extracted= 5 number of extra gaps= 0 total=537 Number of alignments=165 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dl6A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dl6A expands to /projects/compbio/data/pdb/1dl6.pdb.gz 1dl6A:# T0319 read from 1dl6A/merged-local-a2m # 1dl6A read from 1dl6A/merged-local-a2m # adding 1dl6A to template set # found chain 1dl6A in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1dl6A 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=538 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1dl6A 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=539 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1dl6A 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=540 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 101 :LQTSIAEGEMKCRNCGHI 1dl6A 23 :LVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=541 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 99 :LLLQTSIAEGEMKCRNCGHI 1dl6A 21 :AILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=542 Number of alignments=166 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 108 :GEMKCRNCGHI 1dl6A 30 :GDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=543 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1dl6A 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=544 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 72 :PPTKPSFPSSI 1dl6A 12 :RVTCPNHPDAI T0319 83 :QELTDDD 1dl6A 25 :EDYRAGD T0319 110 :MKCRNCGHIY 1dl6A 32 :MICPECGLVV T0319 122 :KNGIPNL 1dl6A 42 :GDRVIDV Number of specific fragments extracted= 4 number of extra gaps= 0 total=548 Number of alignments=167 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 70 :ALPPTKPSFPSSIQELTDDD 1dl6A 10 :LPRVTCPNHPDAILVEDYRA T0319 108 :GEMKCRNCGHIY 1dl6A 30 :GDMICPECGLVV Number of specific fragments extracted= 2 number of extra gaps= 0 total=550 Number of alignments=168 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 108 :GEMKCRNCGHI 1dl6A 30 :GDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=551 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1dl6A 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=552 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 74 :TKPSFPSSI 1dl6A 14 :TCPNHPDAI T0319 83 :QELTD 1dl6A 25 :EDYRA T0319 108 :GEMKCRNCGHI 1dl6A 30 :GDMICPECGLV T0319 121 :IKNGIPNL 1dl6A 41 :VGDRVIDV T0319 130 :LPPH 1dl6A 49 :GSEW Number of specific fragments extracted= 5 number of extra gaps= 0 total=557 Number of alignments=169 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 77 :SFPSSIQELTDD 1dl6A 10 :LPRVTCPNHPDA T0319 104 :SIAE 1dl6A 22 :ILVE T0319 108 :GEMKCRNCGHIY 1dl6A 30 :GDMICPECGLVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=560 Number of alignments=170 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 108 :GEMKCRNCGHI 1dl6A 30 :GDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=561 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 100 :LLQTSIAEGEMKCRNCGHI 1dl6A 22 :ILVEDYRAGDMICPECGLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=562 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 72 :PPTKPSFPSSI 1dl6A 12 :RVTCPNHPDAI T0319 83 :QE 1dl6A 24 :VE T0319 104 :SIAEGEMKCRNCGHI 1dl6A 26 :DYRAGDMICPECGLV T0319 121 :IKNGIPNL 1dl6A 41 :VGDRVIDV Number of specific fragments extracted= 4 number of extra gaps= 0 total=566 Number of alignments=171 # 1dl6A read from 1dl6A/merged-local-a2m # found chain 1dl6A in template set T0319 77 :SFPSSIQELTDD 1dl6A 10 :LPRVTCPNHPDA T0319 104 :SIAE 1dl6A 22 :ILVE T0319 108 :GEMKCRNCGHIY 1dl6A 30 :GDMICPECGLVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=569 Number of alignments=172 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fp1D/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1fp1D/merged-local-a2m # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0319)S30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fp1D)F174 Warning: unaligning (T0319)F78 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fp1D)F174 T0319 17 :DTSNDNFPLQYDG 1fp1D 146 :QVWMNFKEAVVDE T0319 79 :PSSIQELTDDDMAILNDLHTLLLQ 1fp1D 175 :MGKDKKMNQIFNKSMVDVCATEMK Number of specific fragments extracted= 2 number of extra gaps= 0 total=571 Number of alignments=173 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0319)S30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fp1D)F174 Warning: unaligning (T0319)F78 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fp1D)F174 T0319 25 :LQYDG 1fp1D 154 :AVVDE T0319 79 :PSSIQELTDDDMAILNDLHTLLL 1fp1D 175 :MGKDKKMNQIFNKSMVDVCATEM Number of specific fragments extracted= 2 number of extra gaps= 0 total=573 Number of alignments=174 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0319)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fp1D)F174 Warning: unaligning (T0319)L71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fp1D)F174 T0319 5 :TTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNN 1fp1D 94 :SYSVLTSTTRTIEDGGAERVYGLSMVGKYLVPDESRGYLASFTTFLCYPALLQVWMNFKEAVVDE T0319 72 :PPTKPSFPSSIQELTDDDMAILNDL 1fp1D 175 :MGKDKKMNQIFNKSMVDVCATEMKR Number of specific fragments extracted= 2 number of extra gaps= 0 total=575 Number of alignments=175 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0319)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fp1D)F174 T0319 27 :YDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNN 1fp1D 116 :LSMVGKYLVPDESRGYLASFTTFLCYPALLQVWMNFKEAVVDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=576 Number of alignments=176 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0319)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fp1D)F174 Warning: unaligning (T0319)L71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fp1D)F174 T0319 33 :QLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNN 1fp1D 122 :YLVPDESRGYLASFTTFLCYPALLQVWMNFKEAVVDE T0319 72 :PPTKPSFPSSIQELTDDDMAILNDL 1fp1D 175 :MGKDKKMNQIFNKSMVDVCATEMKR Number of specific fragments extracted= 2 number of extra gaps= 0 total=578 Number of alignments=177 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Warning: unaligning (T0319)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fp1D)F174 Warning: unaligning (T0319)L71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fp1D)F174 T0319 23 :FPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNN 1fp1D 112 :RVYGLSMVGKYLVPDESRGYLASFTTFLCYPALLQVWMNFKEAVVDE T0319 72 :PPTKPSFPSSIQELTDDDMAILNDL 1fp1D 175 :MGKDKKMNQIFNKSMVDVCATEMKR Number of specific fragments extracted= 2 number of extra gaps= 0 total=580 Number of alignments=178 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 42 :FNPEFLLNIVDRVDWPAVLTVA 1fp1D 130 :GYLASFTTFLCYPALLQVWMNF Number of specific fragments extracted= 1 number of extra gaps= 0 total=581 Number of alignments=179 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 56 :WPAVLTVAAELGNNAL 1fp1D 37 :YPAVLNAAIDLNLFEI Number of specific fragments extracted= 1 number of extra gaps= 0 total=582 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=582 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 51 :VDRVDWPAVLTVAAELG 1fp1D 32 :TTNLVYPAVLNAAIDLN T0319 69 :NALPPTKP 1fp1D 55 :KATPPGAF T0319 77 :SFPS 1fp1D 71 :KLPA T0319 83 :QELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYI 1fp1D 75 :STQHSDLPNRLDRMLRLLASYSVLTSTTRTIEDGGAERV Number of specific fragments extracted= 4 number of extra gaps= 0 total=586 Number of alignments=180 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 37 :DESIEFNPEFLLNIVDR 1fp1D 58 :PPGAFMSPSEIASKLPA T0319 83 :QELTDDDMAILNDLHTLLLQTS 1fp1D 75 :STQHSDLPNRLDRMLRLLASYS T0319 105 :IAEGEMKCRNCG 1fp1D 98 :LTSTTRTIEDGG T0319 117 :HIYYIKNGIPNLLL 1fp1D 112 :RVYGLSMVGKYLVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=590 Number of alignments=181 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 56 :WPAVLTVAAELGNNAL 1fp1D 37 :YPAVLNAAIDLNLFEI Number of specific fragments extracted= 1 number of extra gaps= 0 total=591 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=591 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 55 :DWPAVLTVAAELG 1fp1D 36 :VYPAVLNAAIDLN T0319 69 :NALPPTKPS 1fp1D 55 :KATPPGAFM T0319 78 :FPSSIQ 1fp1D 72 :LPASTQ T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYI 1fp1D 78 :HSDLPNRLDRMLRLLASYSVLTSTTRTIEDGGAERV Number of specific fragments extracted= 4 number of extra gaps= 0 total=595 Number of alignments=182 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 37 :DESIEFNPEFLLNIV 1fp1D 58 :PPGAFMSPSEIASKL T0319 72 :P 1fp1D 73 :P T0319 80 :S 1fp1D 74 :A T0319 83 :QELTDDDMAILNDLHTLLLQTS 1fp1D 75 :STQHSDLPNRLDRMLRLLASYS T0319 105 :IAEGEMKCRNCG 1fp1D 98 :LTSTTRTIEDGG T0319 117 :HIYYIKNGIPNLLLP 1fp1D 112 :RVYGLSMVGKYLVPD Number of specific fragments extracted= 6 number of extra gaps= 0 total=601 Number of alignments=183 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 56 :WPAVLTVAAELGNNALPPTK 1fp1D 37 :YPAVLNAAIDLNLFEIIAKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=602 Number of alignments=184 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 56 :WPAVLTVAAELGNNALPPTKPS 1fp1D 37 :YPAVLNAAIDLNLFEIIAKATP Number of specific fragments extracted= 1 number of extra gaps= 0 total=603 Number of alignments=185 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 53 :RVDWPAVLTVAAELGN 1fp1D 34 :NLVYPAVLNAAIDLNL T0319 69 :NALPPTK 1fp1D 55 :KATPPGA T0319 76 :PSFPSSIQ 1fp1D 70 :SKLPASTQ T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEM 1fp1D 78 :HSDLPNRLDRMLRLLASYSVLTSTT T0319 119 :YYIKNGIPNL 1fp1D 103 :RTIEDGGAER Number of specific fragments extracted= 5 number of extra gaps= 0 total=608 Number of alignments=186 # 1fp1D read from 1fp1D/merged-local-a2m # found chain 1fp1D in template set T0319 37 :DESIEFNPEFLLN 1fp1D 58 :PPGAFMSPSEIAS T0319 77 :SFPS 1fp1D 71 :KLPA T0319 83 :QELTDDDMAILNDLHTLLLQTS 1fp1D 75 :STQHSDLPNRLDRMLRLLASYS T0319 105 :IAEGEMKCRNCG 1fp1D 98 :LTSTTRTIEDGG T0319 117 :HIYY 1fp1D 112 :RVYG Number of specific fragments extracted= 5 number of extra gaps= 0 total=613 Number of alignments=187 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yk4A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1yk4A/merged-local-a2m # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set Warning: unaligning (T0319)G108 because first residue in template chain is (1yk4A)A2 T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=614 Number of alignments=188 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=615 Number of alignments=189 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set Warning: unaligning (T0319)G108 because first residue in template chain is (1yk4A)A2 T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=616 Number of alignments=190 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPH 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=617 Number of alignments=191 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISP Number of specific fragments extracted= 1 number of extra gaps= 0 total=618 Number of alignments=192 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPH 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=619 Number of alignments=193 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPN 1yk4A 3 :KLSCKICGYIYDEDEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=620 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLP 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGIS Number of specific fragments extracted= 1 number of extra gaps= 0 total=621 Number of alignments=194 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=622 Number of alignments=195 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=623 Number of alignments=196 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPN 1yk4A 3 :KLSCKICGYIYDEDEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=624 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLL 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGI Number of specific fragments extracted= 1 number of extra gaps= 0 total=625 Number of alignments=197 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=626 Number of alignments=198 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPHLV 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=627 Number of alignments=199 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPN 1yk4A 3 :KLSCKICGYIYDEDEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=628 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPN 1yk4A 3 :KLSCKICGYIYDEDEGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=629 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPPH 1yk4A 3 :KLSCKICGYIYDEDEGDPDNGISPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=630 Number of alignments=200 # 1yk4A read from 1yk4A/merged-local-a2m # found chain 1yk4A in template set T0319 109 :EMKCRNCGHIYYIKNGIP 1yk4A 3 :KLSCKICGYIYDEDEGDP Number of specific fragments extracted= 1 number of extra gaps= 0 total=631 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cc0A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 2cc0A/merged-local-a2m # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set Warning: unaligning (T0319)D37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)D13 Warning: unaligning (T0319)E38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)D13 Warning: unaligning (T0319)I40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)S16 Warning: unaligning (T0319)E41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)S16 T0319 34 :LVQ 2cc0A 9 :LTF T0319 39 :S 2cc0A 14 :G T0319 42 :FNPEFLLNIVDRVDWPAVLTVAAELGNNA 2cc0A 17 :GSTQSLLNALRQNGLRATMFNQGQYAAQN T0319 79 :PSSIQELTDDDMAILN 2cc0A 46 :PSLVRAQVDAGMWVAN Number of specific fragments extracted= 4 number of extra gaps= 2 total=635 Number of alignments=201 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set Warning: unaligning (T0319)D37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)D13 Warning: unaligning (T0319)E38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)D13 Warning: unaligning (T0319)I40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)S16 Warning: unaligning (T0319)E41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)S16 T0319 39 :S 2cc0A 14 :G T0319 42 :FNPEFLLNIVDRVDWPAVLTVAAELGNNA 2cc0A 17 :GSTQSLLNALRQNGLRATMFNQGQYAAQN T0319 79 :PSSIQELTDDDMAILND 2cc0A 46 :PSLVRAQVDAGMWVANH T0319 96 :LHTLL 2cc0A 65 :THPHM Number of specific fragments extracted= 4 number of extra gaps= 2 total=639 Number of alignments=202 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set Warning: unaligning (T0319)D37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)D13 Warning: unaligning (T0319)E38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)D13 Warning: unaligning (T0319)I40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)S16 Warning: unaligning (T0319)E41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)S16 T0319 34 :LVQ 2cc0A 9 :LTF T0319 39 :S 2cc0A 14 :G T0319 42 :FNPEFLLNIVDRVDWPAVLTVAAELGNN 2cc0A 17 :GSTQSLLNALRQNGLRATMFNQGQYAAQ T0319 78 :FPSSIQELTDDDMAILN 2cc0A 45 :NPSLVRAQVDAGMWVAN Number of specific fragments extracted= 4 number of extra gaps= 2 total=643 Number of alignments=203 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set Warning: unaligning (T0319)D37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)D13 Warning: unaligning (T0319)E38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)D13 Warning: unaligning (T0319)I40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)S16 Warning: unaligning (T0319)E41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)S16 T0319 34 :LVQ 2cc0A 9 :LTF T0319 39 :S 2cc0A 14 :G T0319 42 :FNPEFLLNIVDRVDWPAVLTVAAELGNN 2cc0A 17 :GSTQSLLNALRQNGLRATMFNQGQYAAQ T0319 78 :FPSSIQELTDDDMAILND 2cc0A 45 :NPSLVRAQVDAGMWVANH Number of specific fragments extracted= 4 number of extra gaps= 2 total=647 Number of alignments=204 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set Warning: unaligning (T0319)D37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)D13 Warning: unaligning (T0319)E38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)D13 Warning: unaligning (T0319)I40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cc0A)S16 Warning: unaligning (T0319)E41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cc0A)S16 T0319 39 :S 2cc0A 14 :G T0319 42 :FNPEFLLNIVDRVDWPAVLTVAAELGNN 2cc0A 17 :GSTQSLLNALRQNGLRATMFNQGQYAAQ T0319 78 :FPSSIQELTDDDMAI 2cc0A 45 :NPSLVRAQVDAGMWV Number of specific fragments extracted= 3 number of extra gaps= 2 total=650 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 44 :PEFLLNIVDRVDWPAVLTVAAELGNN 2cc0A 19 :TQSLLNALRQNGLRATMFNQGQYAAQ T0319 78 :FPSSIQELTDDDMAI 2cc0A 45 :NPSLVRAQVDAGMWV Number of specific fragments extracted= 2 number of extra gaps= 0 total=652 Number of alignments=205 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 57 :PAVLTVAAELGNNAL 2cc0A 137 :DAIVQAVSRLGNGQV Number of specific fragments extracted= 1 number of extra gaps= 0 total=653 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 57 :PAVLTVAAELGNNA 2cc0A 137 :DAIVQAVSRLGNGQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=654 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 57 :PAVLTVAAELGNNA 2cc0A 137 :DAIVQAVSRLGNGQ T0319 74 :TKP 2cc0A 156 :DWP T0319 87 :DDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 159 :ANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHIY 2cc0A 184 :PQTGRAV Number of specific fragments extracted= 4 number of extra gaps= 0 total=658 Number of alignments=206 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 51 :VDRVDWPAVLTVAAELGNNA 2cc0A 131 :WNNASTDAIVQAVSRLGNGQ T0319 73 :PTKP 2cc0A 155 :HDWP T0319 87 :DDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 159 :ANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHIY 2cc0A 184 :PQTGRAV Number of specific fragments extracted= 4 number of extra gaps= 0 total=662 Number of alignments=207 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 57 :PAVLTVAAELGNNAL 2cc0A 137 :DAIVQAVSRLGNGQV Number of specific fragments extracted= 1 number of extra gaps= 0 total=663 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 39 :SIEFNPEF 2cc0A 128 :SQDWNNAS T0319 56 :WPAVLTVAAELGNNALP 2cc0A 136 :TDAIVQAVSRLGNGQVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=665 Number of alignments=208 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 57 :PAVLTVAAELGNNAL 2cc0A 137 :DAIVQAVSRLGNGQV T0319 75 :KP 2cc0A 157 :WP T0319 87 :DDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 159 :ANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHIY 2cc0A 184 :PQTGRAV Number of specific fragments extracted= 4 number of extra gaps= 0 total=669 Number of alignments=209 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 50 :IVDRVDWPAVLTVAAELGNNAL 2cc0A 130 :DWNNASTDAIVQAVSRLGNGQV T0319 75 :K 2cc0A 157 :W T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 158 :PANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHIY 2cc0A 184 :PQTGRAV Number of specific fragments extracted= 4 number of extra gaps= 0 total=673 Number of alignments=210 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 57 :PAVLTVAAELGNNALP 2cc0A 137 :DAIVQAVSRLGNGQVI Number of specific fragments extracted= 1 number of extra gaps= 0 total=674 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=674 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 54 :VDWPAVLTVAAELGNNA 2cc0A 134 :ASTDAIVQAVSRLGNGQ T0319 85 :LTDDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 157 :WPANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHIY 2cc0A 184 :PQTGRAV Number of specific fragments extracted= 3 number of extra gaps= 0 total=677 Number of alignments=211 # 2cc0A read from 2cc0A/merged-local-a2m # found chain 2cc0A in template set T0319 51 :VDRVDWPAVLTVAAELGNNAL 2cc0A 131 :WNNASTDAIVQAVSRLGNGQV T0319 85 :LTDDDMAILNDLHTLLLQTSIAEGEMK 2cc0A 157 :WPANTLAAIPRIAQTLAGKGLCSGMIS T0319 113 :RNCGHI 2cc0A 184 :PQTGRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=680 Number of alignments=212 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rdg/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rdg expands to /projects/compbio/data/pdb/1rdg.pdb.gz 1rdg:Warning: there is no chain 1rdg will retry with 1rdgA # T0319 read from 1rdg/merged-local-a2m # 1rdg read from 1rdg/merged-local-a2m # adding 1rdg to template set # found chain 1rdg in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rdg 3 :IYVCTVCGYEYDPAKGDPDSGIKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=681 Number of alignments=213 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 108 :GEMKCRNCGHIYYIKNGIPNLLLPP 1rdg 2 :DIYVCTVCGYEYDPAKGDPDSGIKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=682 Number of alignments=214 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rdg 3 :IYVCTVCGYEYDPAKGDPDSGIKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=683 Number of alignments=215 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPP 1rdg 4 :YVCTVCGYEYDPAKGDPDSGIKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=684 Number of alignments=216 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rdg 3 :IYVCTVCGYEYDPAKGDPDSGIKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=685 Number of alignments=217 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 108 :GEMKCRNCGHIYYIKNGIPNLLLPP 1rdg 2 :DIYVCTVCGYEYDPAKGDPDSGIKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=686 Number of alignments=218 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 109 :EMKCRNCGHIYYIKNGIPNLLLPP 1rdg 3 :IYVCTVCGYEYDPAKGDPDSGIKP Number of specific fragments extracted= 1 number of extra gaps= 0 total=687 Number of alignments=219 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 111 :KCRNCGHIYYIKNGIPN 1rdg 5 :VCTVCGYEYDPAKGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=688 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 111 :KCRNCGHIYYIKNGIPNL 1rdg 5 :VCTVCGYEYDPAKGDPDS Number of specific fragments extracted= 1 number of extra gaps= 0 total=689 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rdg 4 :YVCTVCGYEYDPAKGDPDSGIKPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=690 Number of alignments=220 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rdg 4 :YVCTVCGYEYDPAKGDPDSGIKPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=691 Number of alignments=221 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 111 :KCRNCGHIYYIKNGIPN 1rdg 5 :VCTVCGYEYDPAKGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=692 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 111 :KCRNCGHIYYIKNGIPNL 1rdg 5 :VCTVCGYEYDPAKGDPDS Number of specific fragments extracted= 1 number of extra gaps= 0 total=693 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rdg 4 :YVCTVCGYEYDPAKGDPDSGIKPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=694 Number of alignments=222 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPHLV 1rdg 4 :YVCTVCGYEYDPAKGDPDSGIKPGTK Number of specific fragments extracted= 1 number of extra gaps= 0 total=695 Number of alignments=223 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 111 :KCRNCGHIYYIKNGIPN 1rdg 5 :VCTVCGYEYDPAKGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=696 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 111 :KCRNCGHIYYIKNGIPN 1rdg 5 :VCTVCGYEYDPAKGDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=697 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 110 :MKCRNCGHIYYIKNGIPNLLLPPH 1rdg 4 :YVCTVCGYEYDPAKGDPDSGIKPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=698 Number of alignments=224 # 1rdg read from 1rdg/merged-local-a2m # found chain 1rdg in template set T0319 111 :KCRNCGHIYYIKNG 1rdg 5 :VCTVCGYEYDPAKG Number of specific fragments extracted= 1 number of extra gaps= 0 total=699 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1weoA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1weoA/merged-local-a2m # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 105 :IAEGEMKCRNCGHIYYIKNGIPNL 1weoA 54 :RREGTQNCPQCKTRYKRLRGSPRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=700 Number of alignments=225 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 105 :IAEGEMKCRNCGHIYYIKNGIPNL 1weoA 54 :RREGTQNCPQCKTRYKRLRGSPRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=701 Number of alignments=226 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 105 :IAEGEMKCRNCGHIYYIKNGIPNL 1weoA 54 :RREGTQNCPQCKTRYKRLRGSPRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=702 Number of alignments=227 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 104 :SIAEGEMKCRNCGHIYYIKNGIPNL 1weoA 53 :ERREGTQNCPQCKTRYKRLRGSPRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=703 Number of alignments=228 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 105 :IAEGEMKCRNCGHIYYIKNGIPNLLLPP 1weoA 54 :RREGTQNCPQCKTRYKRLRGSPRVEGDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=704 Number of alignments=229 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 106 :AEGEMKCRNCGHIYYIKNGIPNLL 1weoA 55 :REGTQNCPQCKTRYKRLRGSPRVE Number of specific fragments extracted= 1 number of extra gaps= 0 total=705 Number of alignments=230 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 100 :LLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL 1weoA 49 :CYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=706 Number of alignments=231 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 99 :LLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL 1weoA 48 :PCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=707 Number of alignments=232 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 68 :NNALPPTKPSFPSSIQELTDDDMAI 1weoA 11 :LKNLDGQFCEICGDQIGLTVEGDLF T0319 98 :TLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV 1weoA 47 :RPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEE Number of specific fragments extracted= 2 number of extra gaps= 0 total=709 Number of alignments=233 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 12 :SVKACDTSNDNFPL 1weoA 22 :CGDQIGLTVEGDLF T0319 33 :QLVQDESIEFNPEFLLNIVDRV 1weoA 36 :VACNECGFPACRPCYEYERREG T0319 66 :LG 1weoA 63 :QC T0319 68 :NNALPPTKPSFPSSIQELTDD 1weoA 67 :RYKRLRGSPRVEGDEDEEDID Number of specific fragments extracted= 4 number of extra gaps= 0 total=713 Number of alignments=234 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 97 :HTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL 1weoA 46 :CRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=714 Number of alignments=235 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 97 :HTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL 1weoA 46 :CRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=715 Number of alignments=236 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 78 :FPSSIQELTDDDM 1weoA 21 :ICGDQIGLTVEGD T0319 97 :HTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV 1weoA 46 :CRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEE Number of specific fragments extracted= 2 number of extra gaps= 0 total=717 Number of alignments=237 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 12 :SVKACDTSNDNFPLQ 1weoA 22 :CGDQIGLTVEGDLFV T0319 34 :LVQDESIEFNPEFLLNIVDRVD 1weoA 37 :ACNECGFPACRPCYEYERREGT T0319 67 :GNNAL 1weoA 64 :CKTRY T0319 72 :PPTKPSF 1weoA 71 :LRGSPRV T0319 80 :SSIQELTDDD 1weoA 78 :EGDEDEEDID Number of specific fragments extracted= 5 number of extra gaps= 0 total=722 Number of alignments=238 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 106 :AEGEMKCRNCGHIYYIKNGIPNLLLPPHL 1weoA 55 :REGTQNCPQCKTRYKRLRGSPRVEGDEDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=723 Number of alignments=239 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 101 :LQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL 1weoA 50 :YEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=724 Number of alignments=240 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 72 :PPTKPSFPSSIQE 1weoA 4 :GSSGPKPLKNLDG T0319 85 :LTDDDMA 1weoA 42 :GFPACRP T0319 100 :LLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV 1weoA 49 :CYEYERREGTQNCPQCKTRYKRLRGSPRVEGDEDEE Number of specific fragments extracted= 3 number of extra gaps= 0 total=727 Number of alignments=241 # 1weoA read from 1weoA/merged-local-a2m # found chain 1weoA in template set T0319 13 :VKACDTSNDNFPL 1weoA 25 :QIGLTVEGDLFVA T0319 35 :VQDESIEFNPEFLLNIVDRVD 1weoA 38 :CNECGFPACRPCYEYERREGT T0319 69 :NALPPTKPSFP 1weoA 59 :QNCPQCKTRYK T0319 81 :SIQ 1weoA 70 :RLR Number of specific fragments extracted= 4 number of extra gaps= 0 total=731 Number of alignments=242 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wdjA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1wdjA/merged-local-a2m # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 119 :YYIKNGIPNLLL 1wdjA 133 :IYLRNGVLLGVL Number of specific fragments extracted= 1 number of extra gaps= 0 total=732 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=732 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 119 :YYIKNGIPNLLL 1wdjA 133 :IYLRNGVLLGVL Number of specific fragments extracted= 1 number of extra gaps= 0 total=733 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=733 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 119 :YYIKNGIPNLLL 1wdjA 133 :IYLRNGVLLGVL Number of specific fragments extracted= 1 number of extra gaps= 0 total=734 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=734 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 50 :IVDRVDWPAVLTVAAE 1wdjA 89 :FVERGAWEALSEAERE T0319 70 :ALPPTKPSFPSSIQELTDDD 1wdjA 105 :GFPPLAPKAVFEVRSASQDP T0319 91 :AILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP 1wdjA 125 :EELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRLEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=737 Number of alignments=243 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 49 :NIVDRVDWPAVLTVAAE 1wdjA 88 :AFVERGAWEALSEAERE T0319 70 :ALPPTKPSFPSSIQELTDDD 1wdjA 105 :GFPPLAPKAVFEVRSASQDP T0319 91 :AILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP 1wdjA 125 :EELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRLEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=740 Number of alignments=244 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 87 :DDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP 1wdjA 121 :SQDPEELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRLEG Number of specific fragments extracted= 1 number of extra gaps= 0 total=741 Number of alignments=245 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 37 :DESIEFNPEF 1wdjA 6 :DLARPVSEEE T0319 59 :VLTVAAELGN 1wdjA 16 :LRRLSELNPG T0319 72 :PPTKP 1wdjA 31 :SPEGR T0319 82 :IQELTDDDMAILNDLHTLLLQT 1wdjA 38 :VSPTGGESGRRSLQLAYQLARW T0319 104 :SIA 1wdjA 67 :VVF T0319 114 :NCGHIYYIKNG 1wdjA 70 :DSSTGFKFPDG Number of specific fragments extracted= 6 number of extra gaps= 0 total=747 Number of alignments=246 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 50 :IVDRVDWPAVLTVAAE 1wdjA 89 :FVERGAWEALSEAERE T0319 70 :ALPPTKPSFPSSIQELTD 1wdjA 105 :GFPPLAPKAVFEVRSASQ T0319 89 :DMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL 1wdjA 123 :DPEELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRLEGVE Number of specific fragments extracted= 3 number of extra gaps= 0 total=750 Number of alignments=247 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 49 :NIVDRVDWPAVLTVAAE 1wdjA 88 :AFVERGAWEALSEAERE T0319 70 :ALPPTKPSFPSSIQELTD 1wdjA 105 :GFPPLAPKAVFEVRSASQ T0319 89 :DMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP 1wdjA 123 :DPEELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRLEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=753 Number of alignments=248 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 86 :TDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP 1wdjA 120 :ASQDPEELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRLEG Number of specific fragments extracted= 1 number of extra gaps= 0 total=754 Number of alignments=249 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 37 :DESIEFNPEFLLN 1wdjA 6 :DLARPVSEEELRR T0319 62 :VAAELG 1wdjA 19 :LSELNP T0319 70 :A 1wdjA 25 :G T0319 72 :PPTK 1wdjA 31 :SPEG T0319 82 :IQELTDDDMAILNDLHTLLLQT 1wdjA 38 :VSPTGGESGRRSLQLAYQLARW T0319 108 :GEMK 1wdjA 66 :GVVF T0319 114 :NCGHIYYIKNGI 1wdjA 70 :DSSTGFKFPDGS Number of specific fragments extracted= 7 number of extra gaps= 0 total=761 Number of alignments=250 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 50 :IVDRVDWPAVLTVAAELGNNALPPTKPS 1wdjA 89 :FVERGAWEALSEAEREGFPPLAPKAVFE T0319 83 :QELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLL 1wdjA 117 :VRSASQDPEELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRL Number of specific fragments extracted= 2 number of extra gaps= 0 total=763 Number of alignments=251 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 49 :NIVDRVDWPAVLTVAAE 1wdjA 88 :AFVERGAWEALSEAERE T0319 70 :ALPPTKPSFPSS 1wdjA 105 :GFPPLAPKAVFE T0319 83 :QELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLL 1wdjA 117 :VRSASQDPEELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRL Number of specific fragments extracted= 3 number of extra gaps= 0 total=766 Number of alignments=252 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 87 :DDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP 1wdjA 121 :SQDPEELRAKMGIYLRNGVLLGVLVDPYARAVEVFRPGKPPLRLEG Number of specific fragments extracted= 1 number of extra gaps= 0 total=767 Number of alignments=253 # 1wdjA read from 1wdjA/merged-local-a2m # found chain 1wdjA in template set T0319 36 :QDESIEFNPEFLL 1wdjA 5 :LDLARPVSEEELR T0319 61 :TVAAE 1wdjA 18 :RLSEL T0319 75 :KPS 1wdjA 23 :NPG T0319 78 :FPSS 1wdjA 31 :SPEG T0319 85 :LTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGI 1wdjA 41 :TGGESGRRSLQLAYQLARWNEERGLGVVFDSSTGFKFPDGS Number of specific fragments extracted= 5 number of extra gaps= 0 total=772 Number of alignments=254 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w2lA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0319 read from 1w2lA/merged-local-a2m # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 71 :LPPTKPSFPSSIQELTDDDMAIL 1w2lA 69 :VQGYPNVMPASYASLSEREVAAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=773 Number of alignments=255 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 51 :VDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAIL 1w2lA 49 :TAVADENYLRESILQPGAKVVQGYPNVMPASYASLSEREVAAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=774 Number of alignments=256 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 47 :LLNIVDRV 1w2lA 34 :FKGLYGST T0319 55 :DWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAIL 1w2lA 53 :DENYLRESILQPGAKVVQGYPNVMPASYASLSEREVAAL Number of specific fragments extracted= 2 number of extra gaps= 0 total=776 Number of alignments=257 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 50 :IVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAIL 1w2lA 48 :TTAVADENYLRESILQPGAKVVQGYPNVMPASYASLSEREVAAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=777 Number of alignments=258 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 29 :GSKCQLVQDE 1w2lA 39 :GSTRTFEDGT T0319 48 :LNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQE 1w2lA 49 :TAVADENYLRESILQPGAKVVQGYPNVMPASYASLSE Number of specific fragments extracted= 2 number of extra gaps= 0 total=779 Number of alignments=259 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 48 :LNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQEL 1w2lA 49 :TAVADENYLRESILQPGAKVVQGYPNVMPASYASLSER Number of specific fragments extracted= 1 number of extra gaps= 0 total=780 Number of alignments=260 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 121 :IKNGIPNLLLPP 1w2lA 68 :VVQGYPNVMPAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=781 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=781 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 16 :CDTSNDNF 1w2lA 27 :SRLVGPSF T0319 27 :YDGSKCQLVQDESIEFNPE 1w2lA 36 :GLYGSTRTFEDGTTAVADE T0319 57 :PAVLTVAAELGNN 1w2lA 55 :NYLRESILQPGAK T0319 71 :LPPTKPS 1w2lA 68 :VVQGYPN T0319 78 :FPSSIQELTDDD 1w2lA 76 :MPASYASLSERE T0319 93 :LNDLHTLLLQ 1w2lA 88 :VAALIEFIKQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=787 Number of alignments=261 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 21 :DNFPLQYDGSKCQLV 1w2lA 38 :YGSTRTFEDGTTAVA T0319 55 :DWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLH 1w2lA 53 :DENYLRESILQPGAKVVQGYPNVMPASYASLSEREVAALIEFI Number of specific fragments extracted= 2 number of extra gaps= 0 total=789 Number of alignments=262 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 121 :IKNGIPNLLLPP 1w2lA 68 :VVQGYPNVMPAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=790 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=790 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 21 :DNF 1w2lA 32 :PSF T0319 26 :QYDGSKCQLVQDESIE 1w2lA 35 :KGLYGSTRTFEDGTTA T0319 42 :FNPEFLLNIV 1w2lA 52 :ADENYLRESI T0319 64 :AE 1w2lA 62 :LQ T0319 67 :GNNALPPTKPS 1w2lA 64 :PGAKVVQGYPN T0319 78 :FPSSIQEL 1w2lA 76 :MPASYASL T0319 89 :DMAILNDLHTLLLQT 1w2lA 84 :SEREVAALIEFIKQQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=797 Number of alignments=263 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 21 :DNFPLQYDGSKCQLV 1w2lA 38 :YGSTRTFEDGTTAVA T0319 55 :DWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLH 1w2lA 53 :DENYLRESILQPGAKVVQGYPNVMPASYASLSEREVAALIEFI Number of specific fragments extracted= 2 number of extra gaps= 0 total=799 Number of alignments=264 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 112 :CRNCGHI 1w2lA 18 :CFSCHSI Number of specific fragments extracted= 1 number of extra gaps= 0 total=800 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=800 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 11 :CSVKACDTSNDNFPLQYDGSKCQLVQDESI 1w2lA 18 :CFSCHSIDGSRLVGPSFKGLYGSTRTFEDG T0319 41 :EF 1w2lA 50 :AV T0319 54 :VDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDM 1w2lA 52 :ADENYLRESILQPGAKVVQGYPNVMPASYASLSEREV T0319 94 :NDLHTLLL 1w2lA 89 :AALIEFIK Number of specific fragments extracted= 4 number of extra gaps= 0 total=804 Number of alignments=265 # 1w2lA read from 1w2lA/merged-local-a2m # found chain 1w2lA in template set T0319 18 :TSNDNFPLQYDGSKCQL 1w2lA 35 :KGLYGSTRTFEDGTTAV T0319 54 :VDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLH 1w2lA 52 :ADENYLRESILQPGAKVVQGYPNVMPASYASLSEREVAALIEFI Number of specific fragments extracted= 2 number of extra gaps= 0 total=806 Number of alignments=266 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2aa1B/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2aa1B expands to /projects/compbio/data/pdb/2aa1.pdb.gz 2aa1B:Skipped atom 1243, because occupancy 0.420 <= existing 0.580 in 2aa1B Skipped atom 1245, because occupancy 0.420 <= existing 0.580 in 2aa1B Skipped atom 1247, because occupancy 0.420 <= existing 0.580 in 2aa1B Skipped atom 1249, because occupancy 0.420 <= existing 0.580 in 2aa1B Skipped atom 1251, because occupancy 0.420 <= existing 0.580 in 2aa1B Skipped atom 1253, because occupancy 0.420 <= existing 0.580 in 2aa1B Skipped atom 2204, because occupancy 0.260 <= existing 0.740 in 2aa1B Skipped atom 2206, because occupancy 0.260 <= existing 0.740 in 2aa1B Skipped atom 2208, because occupancy 0.260 <= existing 0.740 in 2aa1B Skipped atom 2210, because occupancy 0.260 <= existing 0.740 in 2aa1B Skipped atom 2212, because occupancy 0.260 <= existing 0.740 in 2aa1B Skipped atom 2214, because occupancy 0.260 <= existing 0.740 in 2aa1B # T0319 read from 2aa1B/merged-local-a2m # 2aa1B read from 2aa1B/merged-local-a2m # adding 2aa1B to template set # found chain 2aa1B in template set T0319 72 :PPTKPSFP 2aa1B 36 :PWTQRYFG T0319 80 :SSIQELTDDD 2aa1B 49 :YNAAAIAQNA Number of specific fragments extracted= 2 number of extra gaps= 0 total=808 Number of alignments=267 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 71 :LPPTKPSFP 2aa1B 35 :YPWTQRYFG T0319 80 :SSIQELTDD 2aa1B 49 :YNAAAIAQN Number of specific fragments extracted= 2 number of extra gaps= 0 total=810 Number of alignments=268 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 72 :PPTKPSFP 2aa1B 36 :PWTQRYFG T0319 80 :SSIQELTDDD 2aa1B 49 :YNAAAIAQNA Number of specific fragments extracted= 2 number of extra gaps= 0 total=812 Number of alignments=269 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 71 :LPPTKPSFPS 2aa1B 35 :YPWTQRYFGK T0319 81 :SIQELTD 2aa1B 50 :NAAAIAQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=814 Number of alignments=270 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 84 :ELTDDDMAILNDL 2aa1B 2 :EWTDFERATIKDI Number of specific fragments extracted= 1 number of extra gaps= 0 total=815 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=815 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIVDRVDWPAV 2aa1B 2 :EWTDFERATIKDIFSKLEYDVV Number of specific fragments extracted= 1 number of extra gaps= 0 total=816 Number of alignments=271 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 39 :SIEFNPEFLLNIVDRVDWPAVLTVAAELGN 2aa1B 3 :WTDFERATIKDIFSKLEYDVVGPATLARCL Number of specific fragments extracted= 1 number of extra gaps= 0 total=817 Number of alignments=272 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIVDRVDWPAVLTV 2aa1B 2 :EWTDFERATIKDIFSKLEYDVVGPA T0319 63 :AAELGNNALPPTKP 2aa1B 29 :ARCLVVYPWTQRYF T0319 77 :SFPSSIQELTDDDMAILNDLHTLLLQ 2aa1B 44 :KFGNLYNAAAIAQNAMVSKHGTTILN Number of specific fragments extracted= 3 number of extra gaps= 0 total=820 Number of alignments=273 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIV 2aa1B 94 :EKLHVDPDNFKLLA T0319 57 :PAVLTVAAELGN 2aa1B 108 :DCLTIVVAARFG T0319 83 :QELTDDDMAILNDLHTLLLQ 2aa1B 120 :SAFTGEVQAAFQKFMAVVVS Number of specific fragments extracted= 3 number of extra gaps= 0 total=823 Number of alignments=274 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIVDRVDWPAV 2aa1B 2 :EWTDFERATIKDIFSKLEYDVV Number of specific fragments extracted= 1 number of extra gaps= 0 total=824 Number of alignments=275 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 39 :SIEFNPEFLLNIVDRVDWPAVLTV 2aa1B 3 :WTDFERATIKDIFSKLEYDVVGPA Number of specific fragments extracted= 1 number of extra gaps= 0 total=825 Number of alignments=276 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIVDRVDWPAV 2aa1B 2 :EWTDFERATIKDIFSKLEYDVV T0319 60 :LTVAAELG 2aa1B 26 :ATLARCLV T0319 68 :NNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQ 2aa1B 35 :YPWTQRYFGKFGNLYNAAAIAQNAMVSKHGTTILN Number of specific fragments extracted= 3 number of extra gaps= 0 total=828 Number of alignments=277 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIV 2aa1B 94 :EKLHVDPDNFKLLA T0319 57 :PAVLTVAAELGN 2aa1B 108 :DCLTIVVAARFG T0319 83 :QELTDDDMAILNDLHTLLLQ 2aa1B 120 :SAFTGEVQAAFQKFMAVVVS Number of specific fragments extracted= 3 number of extra gaps= 0 total=831 Number of alignments=278 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 41 :EFNPEFLLNIVDRVDWPAV 2aa1B 5 :DFERATIKDIFSKLEYDVV Number of specific fragments extracted= 1 number of extra gaps= 0 total=832 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 40 :IEFNPEFLLNIVDRVDWPAVLTVA 2aa1B 4 :TDFERATIKDIFSKLEYDVVGPAT Number of specific fragments extracted= 1 number of extra gaps= 0 total=833 Number of alignments=279 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIVDRVDWPAV 2aa1B 2 :EWTDFERATIKDIFSKLEYDVV T0319 60 :LTVAAELGNNALPPTKPSFPSSIQE 2aa1B 26 :ATLARCLVVYPWTQRYFGKFGNLYN T0319 85 :LTDDDMAILNDLHTLLLQ 2aa1B 53 :AIAQNAMVSKHGTTILNG Number of specific fragments extracted= 3 number of extra gaps= 0 total=836 Number of alignments=280 # 2aa1B read from 2aa1B/merged-local-a2m # found chain 2aa1B in template set T0319 38 :ESIEFNPEFLLNIV 2aa1B 94 :EKLHVDPDNFKLLA T0319 57 :PAVLTVAAELGN 2aa1B 108 :DCLTIVVAARFG T0319 83 :QELTDDDMAILNDLHTLLLQ 2aa1B 120 :SAFTGEVQAAFQKFMAVVVS Number of specific fragments extracted= 3 number of extra gaps= 0 total=839 Number of alignments=281 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dv1A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dv1A expands to /projects/compbio/data/pdb/1dv1.pdb.gz 1dv1A:Skipped atom 1338, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 1340, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 1342, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 1344, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 1346, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 3132, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 3134, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 3136, because occupancy 0.500 <= existing 0.500 in 1dv1A Skipped atom 3138, because occupancy 0.500 <= existing 0.500 in 1dv1A # T0319 read from 1dv1A/merged-local-a2m # 1dv1A read from 1dv1A/merged-local-a2m # adding 1dv1A to template set # found chain 1dv1A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=839 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 9 :LKCSVKACDTSNDNFPLQYDGSKCQLVQDESIE 1dv1A 24 :LGIKTVAVHSSADRDLKHVLLADETVCIGPAPS T0319 42 :FNPEFLLNIVDRVDWPAVL 1dv1A 61 :LNIPAIISAAEITGAVAIH Number of specific fragments extracted= 2 number of extra gaps= 0 total=841 Number of alignments=282 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 10 :KCSVKACDTSNDNFPLQYDGSKCQLVQDESIE 1dv1A 25 :GIKTVAVHSSADRDLKHVLLADETVCIGPAPS T0319 42 :FNPEFLLNIVDRVDWPAVLTVAAELG 1dv1A 61 :LNIPAIISAAEITGAVAIHPGYGFLS Number of specific fragments extracted= 2 number of extra gaps= 0 total=843 Number of alignments=283 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set Warning: unaligning (T0319)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)M169 Warning: unaligning (T0319)M90 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1dv1A)M169 Warning: unaligning (T0319)M110 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)N195 Warning: unaligning (T0319)G116 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1dv1A)N195 T0319 43 :NPEFLLNIVDRVDWPAVLTV 1dv1A 141 :DMDKNRAIAKRIGYPVIIKA T0319 91 :AILNDLHTLLLQTSIAEGE 1dv1A 170 :RVVRGDAELAQSISMTRAE T0319 117 :HIYYIKNGIPN 1dv1A 196 :DMVYMEKYLEN Number of specific fragments extracted= 3 number of extra gaps= 0 total=846 Number of alignments=284 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 15 :ACDTSNDNFPLQYDGSKCQLVQDESI 1dv1A 30 :AVHSSADRDLKHVLLADETVCIGPAP T0319 42 :FNPEFLLNIVDRVDWPAVLTV 1dv1A 61 :LNIPAIISAAEITGAVAIHPG T0319 63 :AAELGNNALP 1dv1A 92 :AEQVERSGFI Number of specific fragments extracted= 3 number of extra gaps= 0 total=849 Number of alignments=285 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 40 :IEFNPEFLLNIVDR 1dv1A 31 :VHSSADRDLKHVLL T0319 54 :VDWPAVLTVAAELGNNALPPT 1dv1A 61 :LNIPAIISAAEITGAVAIHPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=851 Number of alignments=286 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 42 :FNPEFLLNIVDRVDWPAVL 1dv1A 61 :LNIPAIISAAEITGAVAIH Number of specific fragments extracted= 1 number of extra gaps= 0 total=852 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set Warning: unaligning (T0319)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)M169 Warning: unaligning (T0319)L71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1dv1A)M169 T0319 48 :LNIVDRVDWPAVLTV 1dv1A 146 :RAIAKRIGYPVIIKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=853 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set Warning: unaligning (T0319)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)M169 Warning: unaligning (T0319)L71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1dv1A)M169 T0319 43 :NPEFLLNIVDRVDWPAVLTV 1dv1A 141 :DMDKNRAIAKRIGYPVIIKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=854 Number of alignments=287 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 43 :NPEFLLNIVDRVD 1dv1A 106 :KAETIRLMGDKVS T0319 59 :VLTVAAELGNNALPPTKPSF 1dv1A 119 :AIAAMKKAGVPCVPGSDGPL T0319 83 :QELTDDDMAILNDL 1dv1A 139 :GDDMDKNRAIAKRI Number of specific fragments extracted= 3 number of extra gaps= 0 total=857 Number of alignments=288 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 42 :FNPEFLLNIVDR 1dv1A 105 :PKAETIRLMGDK T0319 57 :PAVLTVAAELGNNALPPTKPSFPSS 1dv1A 117 :VSAIAAMKKAGVPCVPGSDGPLGDD T0319 86 :TDDDMAILNDL 1dv1A 142 :MDKNRAIAKRI T0319 102 :QTSIAEG 1dv1A 153 :GYPVIIK Number of specific fragments extracted= 4 number of extra gaps= 0 total=861 Number of alignments=289 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set Warning: unaligning (T0319)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)M169 Warning: unaligning (T0319)L71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1dv1A)M169 T0319 48 :LNIVDRVDWPAVLTV 1dv1A 146 :RAIAKRIGYPVIIKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=862 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set Warning: unaligning (T0319)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)M169 T0319 45 :EFLLNIVDRVDWPAVLTV 1dv1A 143 :DKNRAIAKRIGYPVIIKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=863 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 43 :NPEFLLNIVDRVD 1dv1A 106 :KAETIRLMGDKVS T0319 59 :VLTVAAELGNNALPPTKPSFPSSIQE 1dv1A 119 :AIAAMKKAGVPCVPGSDGPLGDDMDK T0319 89 :DMAILNDL 1dv1A 145 :NRAIAKRI Number of specific fragments extracted= 3 number of extra gaps= 0 total=866 Number of alignments=290 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 42 :FNPEFLLNIVDR 1dv1A 105 :PKAETIRLMGDK T0319 57 :PAVLTVAAELGNNALPPTKPSFPSSIQ 1dv1A 117 :VSAIAAMKKAGVPCVPGSDGPLGDDMD T0319 88 :DDMAILNDL 1dv1A 144 :KNRAIAKRI T0319 102 :QTSIAEG 1dv1A 153 :GYPVIIK Number of specific fragments extracted= 4 number of extra gaps= 0 total=870 Number of alignments=291 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set Warning: unaligning (T0319)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)M169 T0319 39 :SIEFNPEFLLNIVDRVDWPAVLTV 1dv1A 137 :PLGDDMDKNRAIAKRIGYPVIIKA Number of specific fragments extracted= 1 number of extra gaps= 0 total=871 Number of alignments=292 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set Warning: unaligning (T0319)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1dv1A)M169 Warning: unaligning (T0319)L71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1dv1A)M169 T0319 36 :QDESIEFNPEFLLNIVDRVDWPAVLTV 1dv1A 134 :SDGPLGDDMDKNRAIAKRIGYPVIIKA T0319 72 :PP 1dv1A 170 :RV Number of specific fragments extracted= 2 number of extra gaps= 0 total=873 Number of alignments=293 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 43 :NPEFLLNIVDRVD 1dv1A 106 :KAETIRLMGDKVS T0319 59 :VLTVAAELGNNALP 1dv1A 119 :AIAAMKKAGVPCVP T0319 77 :SFPSSIQELTDDDMAILNDL 1dv1A 133 :GSDGPLGDDMDKNRAIAKRI Number of specific fragments extracted= 3 number of extra gaps= 0 total=876 Number of alignments=294 # 1dv1A read from 1dv1A/merged-local-a2m # found chain 1dv1A in template set T0319 42 :FNPEFLLNIVDR 1dv1A 105 :PKAETIRLMGDK T0319 57 :PAVLTVAAELGNNALP 1dv1A 117 :VSAIAAMKKAGVPCVP T0319 77 :SFPSSIQELTDDDMAILNDL 1dv1A 133 :GSDGPLGDDMDKNRAIAKRI Number of specific fragments extracted= 3 number of extra gaps= 0 total=879 Number of alignments=295 # command:NUMB_ALIGNS: 295 evalue: 0 4.2670, weight 0.3384 evalue: 1 5.2924, weight 0.2812 evalue: 2 5.6973, weight 0.2636 evalue: 3 6.5623, weight 0.2326 evalue: 4 7.7190, weight 0.2010 evalue: 5 8.7243, weight 0.1798 evalue: 6 9.0932, weight 0.1731 evalue: 7 10.2350, weight 0.1552 evalue: 8 10.6420, weight 0.1497 evalue: 9 2.5629, weight 0.5131 evalue: 10 3.5991, weight 0.3903 evalue: 11 3.6538, weight 0.3854 evalue: 12 3.9050, weight 0.3647 evalue: 13 4.3337, weight 0.3340 evalue: 14 6.1106, weight 0.2478 evalue: 15 6.7643, weight 0.2264 evalue: 16 10.3670, weight 0.1534 evalue: 17 11.7800, weight 0.1362 evalue: 18 12.1080, weight 0.1327 evalue: 19 3.5867, weight 0.3914 evalue: 20 7.1908, weight 0.2143 evalue: 21 10.0790, weight 0.1574 evalue: 22 14.7880, weight 0.1099 evalue: 23 15.1900, weight 0.1072 evalue: 24 16.1500, weight 0.1011 evalue: 25 4.2399, weight 0.3402 evalue: 26 4.5812, weight 0.3185 evalue: 27 7.0368, weight 0.2185 evalue: 28 11.0430, weight 0.1446 evalue: 29 11.4280, weight 0.1401 evalue: 30 12.1200, weight 0.1326 evalue: 31 13.0040, weight 0.1241 evalue: 32 14.0940, weight 0.1150 evalue: 33 14.8540, weight 0.1095 evalue: 34 16.7300, weight 0.0978 evalue: 35 16.7300, weight 0.0978 evalue: 36 16.7300, weight 0.0978 evalue: 37 16.7300, weight 0.0978 evalue: 38 16.7300, weight 0.0978 evalue: 39 16.7300, weight 0.0978 evalue: 40 16.7300, weight 0.0978 evalue: 41 16.7300, weight 0.0978 evalue: 42 16.7300, weight 0.0978 evalue: 43 16.7300, weight 0.0978 evalue: 44 16.7300, weight 0.0978 evalue: 45 16.7300, weight 0.0978 evalue: 46 16.7300, weight 0.0978 evalue: 47 11.0430, weight 0.1446 evalue: 48 11.0430, weight 0.1446 evalue: 49 11.0430, weight 0.1446 evalue: 50 11.0430, weight 0.1446 evalue: 51 11.0430, weight 0.1446 evalue: 52 11.0430, weight 0.1446 evalue: 53 11.0430, weight 0.1446 evalue: 54 11.0430, weight 0.1446 evalue: 55 11.0430, weight 0.1446 evalue: 56 11.0430, weight 0.1446 evalue: 57 11.0430, weight 0.1446 evalue: 58 11.0430, weight 0.1446 evalue: 59 11.0430, weight 0.1446 evalue: 60 11.0430, weight 0.1446 evalue: 61 11.0430, weight 0.1446 evalue: 62 9.0998, weight 0.1730 evalue: 63 9.0998, weight 0.1730 evalue: 64 9.0998, weight 0.1730 evalue: 65 9.0998, weight 0.1730 evalue: 66 9.0998, weight 0.1730 evalue: 67 9.0998, weight 0.1730 evalue: 68 9.0998, weight 0.1730 evalue: 69 9.0998, weight 0.1730 evalue: 70 9.0998, weight 0.1730 evalue: 71 9.0998, weight 0.1730 evalue: 72 9.0998, weight 0.1730 evalue: 73 9.0998, weight 0.1730 evalue: 74 9.0998, weight 0.1730 evalue: 75 9.0998, weight 0.1730 evalue: 76 4.2399, weight 0.3402 evalue: 77 4.2399, weight 0.3402 evalue: 78 4.2399, weight 0.3402 evalue: 79 4.2399, weight 0.3402 evalue: 80 4.2399, weight 0.3402 evalue: 81 4.2399, weight 0.3402 evalue: 82 4.2399, weight 0.3402 evalue: 83 4.2399, weight 0.3402 evalue: 84 4.2399, weight 0.3402 evalue: 85 11.4280, weight 0.1401 evalue: 86 11.4280, weight 0.1401 evalue: 87 11.4280, weight 0.1401 evalue: 88 11.4280, weight 0.1401 evalue: 89 11.4280, weight 0.1401 evalue: 90 11.4280, weight 0.1401 evalue: 91 11.4280, weight 0.1401 evalue: 92 11.4280, weight 0.1401 evalue: 93 11.4280, weight 0.1401 evalue: 94 11.4280, weight 0.1401 evalue: 95 11.4280, weight 0.1401 evalue: 96 11.4280, weight 0.1401 evalue: 97 11.4280, weight 0.1401 evalue: 98 11.4280, weight 0.1401 evalue: 99 11.4280, weight 0.1401 evalue: 100 11.4280, weight 0.1401 evalue: 101 11.4280, weight 0.1401 evalue: 102 11.4280, weight 0.1401 evalue: 103 11.4280, weight 0.1401 evalue: 104 11.4280, weight 0.1401 evalue: 105 11.4280, weight 0.1401 evalue: 106 11.4280, weight 0.1401 evalue: 107 11.4280, weight 0.1401 evalue: 108 11.4280, weight 0.1401 evalue: 109 11.4280, weight 0.1401 evalue: 110 11.4280, weight 0.1401 evalue: 111 7.0368, weight 0.2185 evalue: 112 7.0368, weight 0.2185 evalue: 113 7.0368, weight 0.2185 evalue: 114 7.0368, weight 0.2185 evalue: 115 7.0368, weight 0.2185 evalue: 116 7.0368, weight 0.2185 evalue: 117 7.0368, weight 0.2185 evalue: 118 7.0368, weight 0.2185 evalue: 119 7.0368, weight 0.2185 evalue: 120 7.0368, weight 0.2185 evalue: 121 7.0368, weight 0.2185 evalue: 122 11.5700, weight 0.1385 evalue: 123 11.5700, weight 0.1385 evalue: 124 11.5700, weight 0.1385 evalue: 125 11.5700, weight 0.1385 evalue: 126 11.5700, weight 0.1385 evalue: 127 11.5700, weight 0.1385 evalue: 128 11.5700, weight 0.1385 evalue: 129 11.5700, weight 0.1385 evalue: 130 11.5700, weight 0.1385 evalue: 131 11.5700, weight 0.1385 evalue: 132 11.5700, weight 0.1385 evalue: 133 11.5700, weight 0.1385 evalue: 134 5.0600, weight 0.2924 evalue: 135 5.0600, weight 0.2924 evalue: 136 5.0600, weight 0.2924 evalue: 137 5.0600, weight 0.2924 evalue: 138 12.7730, weight 0.1262 evalue: 139 12.7730, weight 0.1262 evalue: 140 12.7730, weight 0.1262 evalue: 141 12.7730, weight 0.1262 evalue: 142 12.7730, weight 0.1262 evalue: 143 12.7730, weight 0.1262 evalue: 144 12.7730, weight 0.1262 evalue: 145 12.7730, weight 0.1262 evalue: 146 12.7730, weight 0.1262 evalue: 147 12.7730, weight 0.1262 evalue: 148 12.7730, weight 0.1262 evalue: 149 12.7730, weight 0.1262 evalue: 150 12.7730, weight 0.1262 evalue: 151 18.1660, weight 0.0904 evalue: 152 18.1660, weight 0.0904 evalue: 153 18.1660, weight 0.0904 evalue: 154 18.1660, weight 0.0904 evalue: 155 18.1660, weight 0.0904 evalue: 156 18.1660, weight 0.0904 evalue: 157 18.1660, weight 0.0904 evalue: 158 18.1660, weight 0.0904 evalue: 159 18.1660, weight 0.0904 evalue: 160 18.1660, weight 0.0904 evalue: 161 18.1660, weight 0.0904 evalue: 162 18.1660, weight 0.0904 evalue: 163 18.1660, weight 0.0904 evalue: 164 18.1660, weight 0.0904 evalue: 165 12.5590, weight 0.1282 evalue: 166 12.5590, weight 0.1282 evalue: 167 12.5590, weight 0.1282 evalue: 168 12.5590, weight 0.1282 evalue: 169 12.5590, weight 0.1282 evalue: 170 12.5590, weight 0.1282 evalue: 171 12.5590, weight 0.1282 evalue: 172 14.0940, weight 0.1150 evalue: 173 14.0940, weight 0.1150 evalue: 174 14.0940, weight 0.1150 evalue: 175 14.0940, weight 0.1150 evalue: 176 14.0940, weight 0.1150 evalue: 177 14.0940, weight 0.1150 evalue: 178 14.0940, weight 0.1150 evalue: 179 14.0940, weight 0.1150 evalue: 180 14.0940, weight 0.1150 evalue: 181 14.0940, weight 0.1150 evalue: 182 14.0940, weight 0.1150 evalue: 183 14.0940, weight 0.1150 evalue: 184 14.0940, weight 0.1150 evalue: 185 14.0940, weight 0.1150 evalue: 186 14.0940, weight 0.1150 evalue: 187 4.5812, weight 0.3185 evalue: 188 4.5812, weight 0.3185 evalue: 189 4.5812, weight 0.3185 evalue: 190 4.5812, weight 0.3185 evalue: 191 4.5812, weight 0.3185 evalue: 192 4.5812, weight 0.3185 evalue: 193 4.5812, weight 0.3185 evalue: 194 4.5812, weight 0.3185 evalue: 195 4.5812, weight 0.3185 evalue: 196 4.5812, weight 0.3185 evalue: 197 4.5812, weight 0.3185 evalue: 198 4.5812, weight 0.3185 evalue: 199 4.5812, weight 0.3185 evalue: 200 14.8540, weight 0.1095 evalue: 201 14.8540, weight 0.1095 evalue: 202 14.8540, weight 0.1095 evalue: 203 14.8540, weight 0.1095 evalue: 204 14.8540, weight 0.1095 evalue: 205 14.8540, weight 0.1095 evalue: 206 14.8540, weight 0.1095 evalue: 207 14.8540, weight 0.1095 evalue: 208 14.8540, weight 0.1095 evalue: 209 14.8540, weight 0.1095 evalue: 210 14.8540, weight 0.1095 evalue: 211 14.8540, weight 0.1095 evalue: 212 12.1090, weight 0.1327 evalue: 213 12.1090, weight 0.1327 evalue: 214 12.1090, weight 0.1327 evalue: 215 12.1090, weight 0.1327 evalue: 216 12.1090, weight 0.1327 evalue: 217 12.1090, weight 0.1327 evalue: 218 12.1090, weight 0.1327 evalue: 219 12.1090, weight 0.1327 evalue: 220 12.1090, weight 0.1327 evalue: 221 12.1090, weight 0.1327 evalue: 222 12.1090, weight 0.1327 evalue: 223 12.1090, weight 0.1327 evalue: 224 12.1200, weight 0.1326 evalue: 225 12.1200, weight 0.1326 evalue: 226 12.1200, weight 0.1326 evalue: 227 12.1200, weight 0.1326 evalue: 228 12.1200, weight 0.1326 evalue: 229 12.1200, weight 0.1326 evalue: 230 12.1200, weight 0.1326 evalue: 231 12.1200, weight 0.1326 evalue: 232 12.1200, weight 0.1326 evalue: 233 12.1200, weight 0.1326 evalue: 234 12.1200, weight 0.1326 evalue: 235 12.1200, weight 0.1326 evalue: 236 12.1200, weight 0.1326 evalue: 237 12.1200, weight 0.1326 evalue: 238 12.1200, weight 0.1326 evalue: 239 12.1200, weight 0.1326 evalue: 240 12.1200, weight 0.1326 evalue: 241 12.1200, weight 0.1326 evalue: 242 13.0040, weight 0.1241 evalue: 243 13.0040, weight 0.1241 evalue: 244 13.0040, weight 0.1241 evalue: 245 13.0040, weight 0.1241 evalue: 246 13.0040, weight 0.1241 evalue: 247 13.0040, weight 0.1241 evalue: 248 13.0040, weight 0.1241 evalue: 249 13.0040, weight 0.1241 evalue: 250 13.0040, weight 0.1241 evalue: 251 13.0040, weight 0.1241 evalue: 252 13.0040, weight 0.1241 evalue: 253 13.0040, weight 0.1241 evalue: 254 15.9630, weight 0.1022 evalue: 255 15.9630, weight 0.1022 evalue: 256 15.9630, weight 0.1022 evalue: 257 15.9630, weight 0.1022 evalue: 258 15.9630, weight 0.1022 evalue: 259 15.9630, weight 0.1022 evalue: 260 15.9630, weight 0.1022 evalue: 261 15.9630, weight 0.1022 evalue: 262 15.9630, weight 0.1022 evalue: 263 15.9630, weight 0.1022 evalue: 264 15.9630, weight 0.1022 evalue: 265 15.9630, weight 0.1022 evalue: 266 19.3440, weight 0.0851 evalue: 267 19.3440, weight 0.0851 evalue: 268 19.3440, weight 0.0851 evalue: 269 19.3440, weight 0.0851 evalue: 270 19.3440, weight 0.0851 evalue: 271 19.3440, weight 0.0851 evalue: 272 19.3440, weight 0.0851 evalue: 273 19.3440, weight 0.0851 evalue: 274 19.3440, weight 0.0851 evalue: 275 19.3440, weight 0.0851 evalue: 276 19.3440, weight 0.0851 evalue: 277 19.3440, weight 0.0851 evalue: 278 19.3440, weight 0.0851 evalue: 279 19.3440, weight 0.0851 evalue: 280 19.3440, weight 0.0851 evalue: 281 17.0370, weight 0.0961 evalue: 282 17.0370, weight 0.0961 evalue: 283 17.0370, weight 0.0961 evalue: 284 17.0370, weight 0.0961 evalue: 285 17.0370, weight 0.0961 evalue: 286 17.0370, weight 0.0961 evalue: 287 17.0370, weight 0.0961 evalue: 288 17.0370, weight 0.0961 evalue: 289 17.0370, weight 0.0961 evalue: 290 17.0370, weight 0.0961 evalue: 291 17.0370, weight 0.0961 evalue: 292 17.0370, weight 0.0961 evalue: 293 17.0370, weight 0.0961 evalue: 294 17.0370, weight 0.0961 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 30 RES2ATOM 4 38 RES2ATOM 5 45 RES2ATOM 6 52 RES2ATOM 7 60 RES2ATOM 8 71 RES2ATOM 9 79 RES2ATOM 10 88 RES2ATOM 11 94 RES2ATOM 12 100 RES2ATOM 13 107 RES2ATOM 14 116 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 142 RES2ATOM 19 148 RES2ATOM 20 156 RES2ATOM 21 164 RES2ATOM 22 172 RES2ATOM 23 183 RES2ATOM 24 190 RES2ATOM 25 198 RES2ATOM 26 207 RES2ATOM 27 219 RES2ATOM 29 231 RES2ATOM 30 237 RES2ATOM 31 246 RES2ATOM 32 252 RES2ATOM 33 261 RES2ATOM 34 269 RES2ATOM 35 276 RES2ATOM 36 285 RES2ATOM 37 293 RES2ATOM 38 302 RES2ATOM 39 308 RES2ATOM 40 316 RES2ATOM 41 325 RES2ATOM 42 336 RES2ATOM 43 344 RES2ATOM 44 351 RES2ATOM 45 360 RES2ATOM 46 371 RES2ATOM 47 379 RES2ATOM 48 387 RES2ATOM 49 395 RES2ATOM 50 403 RES2ATOM 51 410 RES2ATOM 52 418 RES2ATOM 53 429 RES2ATOM 54 436 RES2ATOM 55 444 RES2ATOM 56 458 RES2ATOM 57 465 RES2ATOM 58 470 RES2ATOM 59 477 RES2ATOM 60 485 RES2ATOM 61 492 RES2ATOM 62 499 RES2ATOM 63 504 RES2ATOM 64 509 RES2ATOM 65 518 RES2ATOM 67 530 RES2ATOM 68 538 RES2ATOM 69 546 RES2ATOM 70 551 RES2ATOM 71 559 RES2ATOM 72 566 RES2ATOM 73 573 RES2ATOM 74 580 RES2ATOM 75 589 RES2ATOM 76 596 RES2ATOM 77 602 RES2ATOM 78 613 RES2ATOM 79 620 RES2ATOM 80 626 RES2ATOM 81 632 RES2ATOM 82 640 RES2ATOM 83 649 RES2ATOM 84 658 RES2ATOM 85 666 RES2ATOM 86 673 RES2ATOM 87 681 RES2ATOM 88 689 RES2ATOM 89 697 RES2ATOM 90 705 RES2ATOM 91 710 RES2ATOM 92 718 RES2ATOM 93 726 RES2ATOM 94 734 RES2ATOM 95 742 RES2ATOM 96 750 RES2ATOM 97 760 RES2ATOM 98 767 RES2ATOM 99 775 RES2ATOM 100 783 RES2ATOM 101 791 RES2ATOM 102 800 RES2ATOM 103 807 RES2ATOM 104 813 RES2ATOM 105 821 RES2ATOM 106 826 RES2ATOM 108 839 RES2ATOM 109 848 RES2ATOM 110 856 RES2ATOM 111 865 RES2ATOM 112 871 RES2ATOM 113 882 RES2ATOM 114 890 RES2ATOM 116 900 RES2ATOM 117 910 RES2ATOM 118 918 RES2ATOM 119 930 RES2ATOM 120 942 RES2ATOM 121 950 RES2ATOM 122 959 RES2ATOM 124 971 RES2ATOM 125 979 RES2ATOM 126 986 RES2ATOM 127 994 RES2ATOM 128 1002 RES2ATOM 129 1010 RES2ATOM 130 1018 RES2ATOM 131 1025 RES2ATOM 132 1032 RES2ATOM 133 1042 RES2ATOM 134 1050 Constraint 849 919 3.8174 4.7717 9.5434 0.8142 Constraint 840 911 4.4448 5.5561 11.1121 0.7293 Constraint 840 919 5.4061 6.7576 13.5152 0.5916 Constraint 840 931 4.4288 5.5360 11.0719 0.5546 Constraint 840 943 5.6762 7.0953 14.1905 0.5046 Constraint 960 1026 4.5865 5.7332 11.4663 0.3589 Constraint 951 1026 5.1993 6.4991 12.9982 0.3589 Constraint 849 943 5.6082 7.0103 14.0206 0.3216 Constraint 827 931 5.4596 6.8245 13.6491 0.2007 Constraint 951 1033 5.3801 6.7251 13.4502 0.1948 Constraint 943 1033 5.1276 6.4095 12.8190 0.1948 Constraint 849 931 5.5858 6.9823 13.9645 0.1481 Constraint 827 943 5.4267 6.7834 13.5667 0.1481 Constraint 943 1043 5.0434 6.3042 12.6084 0.1461 Constraint 827 951 4.9928 6.2410 12.4820 0.1394 Constraint 943 1051 4.5089 5.6361 11.2723 0.1359 Constraint 659 849 5.0681 6.3351 12.6702 0.1314 Constraint 633 866 5.1151 6.3938 12.7877 0.1312 Constraint 597 891 4.3947 5.4934 10.9867 0.1203 Constraint 597 883 5.0289 6.2861 12.5722 0.1203 Constraint 581 901 5.6047 7.0058 14.0117 0.1203 Constraint 633 872 5.5939 6.9923 13.9846 0.1141 Constraint 581 891 5.0652 6.3315 12.6630 0.1103 Constraint 641 849 5.0985 6.3731 12.7462 0.1071 Constraint 641 872 5.1468 6.4336 12.8671 0.1069 Constraint 597 866 5.1823 6.4779 12.9558 0.1052 Constraint 972 1043 6.0419 7.5523 15.1046 0.1030 Constraint 633 849 4.2747 5.3434 10.6869 0.1027 Constraint 650 849 5.2038 6.5047 13.0094 0.1025 Constraint 659 857 4.6042 5.7553 11.5106 0.1015 Constraint 590 901 5.6999 7.1248 14.2497 0.1015 Constraint 590 891 5.2860 6.6074 13.2149 0.1015 Constraint 590 866 5.7726 7.2157 14.4314 0.1015 Constraint 603 891 4.9156 6.1446 12.2891 0.0974 Constraint 603 883 3.9981 4.9976 9.9952 0.0974 Constraint 603 866 5.1627 6.4534 12.9068 0.0974 Constraint 380 659 5.5290 6.9112 13.8225 0.0945 Constraint 641 866 5.2056 6.5070 13.0140 0.0926 Constraint 667 857 3.7558 4.6947 9.3894 0.0914 Constraint 667 849 5.3094 6.6368 13.2736 0.0906 Constraint 581 883 4.9908 6.2385 12.4769 0.0887 Constraint 581 866 3.6480 4.5600 9.1199 0.0887 Constraint 396 471 4.9756 6.2195 12.4390 0.0883 Constraint 943 1026 6.1787 7.7234 15.4468 0.0847 Constraint 633 857 4.3996 5.4995 10.9990 0.0847 Constraint 597 901 5.6569 7.0712 14.1423 0.0836 Constraint 641 857 4.4464 5.5579 11.1159 0.0795 Constraint 814 919 4.5388 5.6736 11.3471 0.0773 Constraint 627 872 4.7596 5.9495 11.8989 0.0751 Constraint 822 972 6.2615 7.8269 15.6538 0.0742 Constraint 919 1019 5.0208 6.2760 12.5520 0.0731 Constraint 191 262 5.5932 6.9914 13.9829 0.0721 Constraint 650 857 5.7537 7.1921 14.3841 0.0711 Constraint 814 972 4.6689 5.8361 11.6723 0.0663 Constraint 849 1019 5.5019 6.8774 13.7548 0.0648 Constraint 784 951 5.5425 6.9281 13.8561 0.0642 Constraint 682 857 4.9501 6.1876 12.3752 0.0636 Constraint 552 633 5.4990 6.8737 13.7474 0.0631 Constraint 345 659 5.5144 6.8930 13.7860 0.0628 Constraint 849 995 4.5261 5.6576 11.3152 0.0621 Constraint 471 743 5.5665 6.9581 13.9162 0.0611 Constraint 784 919 5.6819 7.1024 14.2049 0.0602 Constraint 519 633 5.6726 7.0907 14.1814 0.0594 Constraint 822 995 5.4459 6.8074 13.6148 0.0587 Constraint 743 827 5.3289 6.6612 13.3224 0.0584 Constraint 404 478 5.4864 6.8580 13.7159 0.0581 Constraint 919 1011 5.9382 7.4228 14.8455 0.0577 Constraint 372 919 4.0079 5.0099 10.0198 0.0574 Constraint 345 919 5.2119 6.5149 13.0298 0.0574 Constraint 500 743 4.5401 5.6751 11.3503 0.0557 Constraint 943 1019 5.5760 6.9700 13.9401 0.0556 Constraint 659 840 5.6212 7.0265 14.0530 0.0555 Constraint 698 891 6.1701 7.7127 15.4253 0.0552 Constraint 471 711 4.5190 5.6488 11.2975 0.0542 Constraint 519 603 3.7431 4.6788 9.3576 0.0538 Constraint 690 911 3.4288 4.2860 8.5719 0.0536 Constraint 690 857 4.4507 5.5634 11.1268 0.0536 Constraint 690 849 4.5336 5.6669 11.3339 0.0536 Constraint 627 883 3.7045 4.6307 9.2614 0.0535 Constraint 627 866 4.7694 5.9617 11.9235 0.0535 Constraint 674 857 5.7532 7.1915 14.3830 0.0530 Constraint 262 372 4.2929 5.3662 10.7323 0.0530 Constraint 751 849 4.8080 6.0100 12.0200 0.0529 Constraint 751 919 5.3654 6.7068 13.4136 0.0518 Constraint 751 827 4.9275 6.1594 12.3188 0.0517 Constraint 478 698 4.7094 5.8868 11.7736 0.0516 Constraint 682 849 6.0429 7.5536 15.1072 0.0515 Constraint 478 711 4.3107 5.3883 10.7767 0.0513 Constraint 814 995 3.6082 4.5103 9.0206 0.0508 Constraint 633 901 5.6542 7.0678 14.1356 0.0492 Constraint 552 849 5.5131 6.8913 13.7826 0.0485 Constraint 822 951 5.0987 6.3734 12.7467 0.0484 Constraint 380 493 4.9857 6.2321 12.4641 0.0479 Constraint 784 849 3.3031 4.1289 8.2577 0.0474 Constraint 682 911 3.4951 4.3688 8.7376 0.0470 Constraint 372 659 4.8080 6.0100 12.0200 0.0466 Constraint 814 960 5.8633 7.3292 14.6583 0.0458 Constraint 667 840 4.2261 5.2826 10.5652 0.0454 Constraint 500 659 5.1659 6.4573 12.9147 0.0450 Constraint 505 659 5.2228 6.5285 13.0570 0.0448 Constraint 682 827 5.0918 6.3648 12.7295 0.0443 Constraint 567 633 5.5962 6.9953 13.9905 0.0442 Constraint 621 883 4.1913 5.2391 10.4782 0.0440 Constraint 621 866 4.3615 5.4518 10.9037 0.0440 Constraint 603 690 5.0488 6.3109 12.6219 0.0440 Constraint 500 633 4.4659 5.5824 11.1647 0.0438 Constraint 411 603 5.1312 6.4140 12.8280 0.0435 Constraint 478 547 5.5607 6.9509 13.9017 0.0431 Constraint 500 719 5.0767 6.3458 12.6917 0.0430 Constraint 808 872 5.5073 6.8842 13.7684 0.0428 Constraint 650 872 5.9705 7.4631 14.9262 0.0425 Constraint 493 633 5.8892 7.3615 14.7230 0.0421 Constraint 840 960 5.2912 6.6140 13.2281 0.0421 Constraint 840 951 3.6391 4.5488 9.0977 0.0421 Constraint 184 262 4.9771 6.2213 12.4426 0.0420 Constraint 667 911 3.4376 4.2970 8.5941 0.0417 Constraint 590 883 5.1771 6.4714 12.9427 0.0417 Constraint 743 931 6.0231 7.5289 15.0578 0.0416 Constraint 372 493 5.2092 6.5115 13.0230 0.0415 Constraint 849 951 3.9810 4.9763 9.9525 0.0415 Constraint 404 943 5.3654 6.7067 13.4134 0.0414 Constraint 372 943 6.2383 7.7978 15.5957 0.0414 Constraint 690 827 5.0358 6.2947 12.5894 0.0407 Constraint 471 719 5.5282 6.9103 13.8205 0.0407 Constraint 262 337 5.7936 7.2420 14.4839 0.0404 Constraint 404 659 5.4681 6.8352 13.6704 0.0399 Constraint 500 776 5.4561 6.8201 13.6402 0.0397 Constraint 270 372 6.1853 7.7316 15.4632 0.0396 Constraint 822 960 5.3263 6.6579 13.3157 0.0394 Constraint 751 943 3.9650 4.9563 9.9125 0.0394 Constraint 727 919 5.6752 7.0941 14.1881 0.0394 Constraint 719 866 6.2606 7.8257 15.6514 0.0394 Constraint 719 849 4.5145 5.6432 11.2863 0.0394 Constraint 380 466 5.7926 7.2408 14.4815 0.0393 Constraint 372 471 5.5818 6.9773 13.9546 0.0393 Constraint 814 943 4.7897 5.9871 11.9741 0.0392 Constraint 931 1019 5.9643 7.4554 14.9109 0.0391 Constraint 911 1026 5.5654 6.9567 13.9135 0.0391 Constraint 849 1011 3.7306 4.6632 9.3264 0.0391 Constraint 840 1011 6.0328 7.5409 15.0819 0.0391 Constraint 659 872 5.8510 7.3137 14.6274 0.0390 Constraint 659 866 4.4045 5.5057 11.0113 0.0390 Constraint 404 633 5.6945 7.1182 14.2363 0.0389 Constraint 404 849 5.0956 6.3695 12.7390 0.0385 Constraint 396 849 4.1087 5.1358 10.2717 0.0385 Constraint 380 943 5.9807 7.4759 14.9518 0.0385 Constraint 380 919 6.3316 7.9145 15.8289 0.0385 Constraint 372 866 6.0539 7.5674 15.1349 0.0385 Constraint 372 849 3.3098 4.1372 8.2744 0.0385 Constraint 326 901 4.7736 5.9670 11.9340 0.0385 Constraint 326 891 5.1127 6.3909 12.7818 0.0385 Constraint 326 883 5.5734 6.9668 13.9335 0.0385 Constraint 326 866 3.3126 4.1408 8.2816 0.0385 Constraint 309 901 5.6750 7.0938 14.1876 0.0385 Constraint 309 891 3.1835 3.9794 7.9588 0.0385 Constraint 309 883 4.1676 5.2095 10.4189 0.0385 Constraint 309 866 5.0784 6.3480 12.6959 0.0385 Constraint 122 262 5.7829 7.2287 14.4573 0.0385 Constraint 411 486 4.8034 6.0042 12.0084 0.0382 Constraint 372 552 5.8107 7.2633 14.5267 0.0379 Constraint 500 711 5.3237 6.6546 13.3092 0.0377 Constraint 814 911 4.0006 5.0008 10.0016 0.0377 Constraint 784 866 3.6220 4.5274 9.0549 0.0376 Constraint 849 980 5.6689 7.0862 14.1724 0.0375 Constraint 857 943 4.7352 5.9190 11.8379 0.0374 Constraint 404 603 3.8062 4.7578 9.5155 0.0372 Constraint 191 345 4.8876 6.1095 12.2190 0.0372 Constraint 659 891 5.4145 6.7682 13.5363 0.0372 Constraint 743 840 5.1458 6.4322 12.8644 0.0371 Constraint 122 326 5.9585 7.4482 14.8963 0.0368 Constraint 641 883 4.4236 5.5295 11.0590 0.0361 Constraint 262 404 4.6723 5.8404 11.6809 0.0358 Constraint 581 650 5.8723 7.3403 14.6806 0.0357 Constraint 262 361 5.2899 6.6124 13.2248 0.0356 Constraint 505 698 5.4046 6.7557 13.5114 0.0355 Constraint 122 191 4.0892 5.1115 10.2230 0.0354 Constraint 814 1019 6.0864 7.6080 15.2160 0.0352 Constraint 814 1011 6.0994 7.6242 15.2485 0.0352 Constraint 808 919 6.0260 7.5325 15.0650 0.0352 Constraint 478 735 4.2728 5.3410 10.6821 0.0352 Constraint 404 493 5.0776 6.3470 12.6940 0.0350 Constraint 380 698 4.5340 5.6675 11.3350 0.0350 Constraint 574 650 4.7167 5.8959 11.7918 0.0348 Constraint 478 552 4.5400 5.6750 11.3499 0.0347 Constraint 128 337 5.5606 6.9508 13.9015 0.0346 Constraint 128 277 5.9549 7.4436 14.8872 0.0346 Constraint 128 270 4.1051 5.1313 10.2627 0.0346 Constraint 122 277 3.6732 4.5915 9.1830 0.0346 Constraint 122 270 5.7656 7.2070 14.4140 0.0346 Constraint 510 641 5.7056 7.1320 14.2641 0.0340 Constraint 505 641 4.5949 5.7436 11.4873 0.0340 Constraint 505 633 5.3945 6.7431 13.4862 0.0340 Constraint 792 872 4.9506 6.1883 12.3766 0.0339 Constraint 792 866 6.0591 7.5738 15.1476 0.0339 Constraint 792 857 4.1017 5.1272 10.2544 0.0339 Constraint 784 901 5.7450 7.1813 14.3625 0.0339 Constraint 784 872 6.1378 7.6722 15.3444 0.0339 Constraint 784 857 4.9098 6.1373 12.2745 0.0339 Constraint 776 872 6.2078 7.7597 15.5194 0.0339 Constraint 603 711 4.8795 6.0994 12.1988 0.0338 Constraint 478 743 5.2036 6.5045 13.0091 0.0333 Constraint 931 1011 6.0640 7.5800 15.1599 0.0329 Constraint 931 1003 6.3888 7.9860 15.9720 0.0329 Constraint 919 1003 3.6323 4.5404 9.0809 0.0329 Constraint 919 995 5.3227 6.6534 13.3068 0.0329 Constraint 911 1011 3.9688 4.9610 9.9220 0.0329 Constraint 911 1003 5.7918 7.2398 14.4795 0.0329 Constraint 901 1011 5.2961 6.6201 13.2401 0.0329 Constraint 901 1003 4.8907 6.1133 12.2267 0.0329 Constraint 792 960 6.3202 7.9003 15.8005 0.0329 Constraint 784 960 3.6366 4.5457 9.0914 0.0329 Constraint 784 943 4.6051 5.7564 11.5127 0.0329 Constraint 776 943 5.9166 7.3957 14.7914 0.0329 Constraint 761 943 6.1327 7.6659 15.3318 0.0329 Constraint 751 987 6.0224 7.5281 15.0561 0.0329 Constraint 727 987 6.1018 7.6272 15.2544 0.0329 Constraint 727 849 5.1741 6.4677 12.9354 0.0329 Constraint 262 560 6.1275 7.6593 15.3186 0.0329 Constraint 404 519 5.4300 6.7875 13.5750 0.0328 Constraint 822 943 5.8066 7.2582 14.5165 0.0327 Constraint 743 943 6.0018 7.5023 15.0046 0.0326 Constraint 560 633 5.3308 6.6635 13.3271 0.0325 Constraint 667 866 5.6573 7.0716 14.1431 0.0318 Constraint 396 603 4.5745 5.7182 11.4364 0.0317 Constraint 621 872 4.4483 5.5603 11.1207 0.0316 Constraint 574 901 5.3734 6.7167 13.4335 0.0316 Constraint 574 891 4.9864 6.2331 12.4661 0.0316 Constraint 574 883 5.0390 6.2987 12.5975 0.0316 Constraint 574 866 3.3330 4.1663 8.3326 0.0316 Constraint 682 840 4.9312 6.1640 12.3279 0.0314 Constraint 682 822 5.2873 6.6091 13.2182 0.0314 Constraint 674 849 5.3614 6.7018 13.4036 0.0314 Constraint 792 980 6.0648 7.5810 15.1619 0.0313 Constraint 792 972 3.1621 3.9527 7.9053 0.0313 Constraint 792 951 5.4610 6.8263 13.6525 0.0313 Constraint 784 972 4.8570 6.0712 12.1424 0.0313 Constraint 149 574 5.2923 6.6154 13.2308 0.0311 Constraint 768 866 4.6629 5.8286 11.6573 0.0311 Constraint 614 690 5.6019 7.0024 14.0047 0.0311 Constraint 519 621 6.0961 7.6201 15.2403 0.0310 Constraint 519 614 5.6655 7.0818 14.1636 0.0310 Constraint 493 603 5.8768 7.3460 14.6920 0.0310 Constraint 191 337 5.5563 6.9454 13.8908 0.0308 Constraint 128 345 5.7314 7.1643 14.3286 0.0308 Constraint 117 337 6.1583 7.6979 15.3959 0.0308 Constraint 108 337 4.0597 5.0746 10.1492 0.0308 Constraint 388 493 4.5706 5.7133 11.4265 0.0305 Constraint 404 581 5.0805 6.3507 12.7013 0.0301 Constraint 519 590 5.9012 7.3766 14.7531 0.0301 Constraint 471 552 5.9030 7.3787 14.7574 0.0300 Constraint 849 1026 5.4768 6.8460 13.6920 0.0300 Constraint 419 493 4.9268 6.1585 12.3171 0.0300 Constraint 574 659 5.2004 6.5005 13.0010 0.0297 Constraint 751 891 5.4079 6.7599 13.5197 0.0296 Constraint 751 883 3.9767 4.9708 9.9417 0.0296 Constraint 727 891 6.1769 7.7211 15.4422 0.0296 Constraint 727 883 6.0014 7.5017 15.0034 0.0296 Constraint 719 891 3.3727 4.2158 8.4316 0.0296 Constraint 719 883 5.8122 7.2653 14.5306 0.0296 Constraint 361 493 4.8486 6.0608 12.1215 0.0296 Constraint 345 931 6.0922 7.6152 15.2304 0.0296 Constraint 500 727 6.1506 7.6882 15.3764 0.0296 Constraint 372 581 4.9378 6.1722 12.3445 0.0295 Constraint 471 751 4.7699 5.9624 11.9247 0.0295 Constraint 184 372 2.4558 3.0697 6.1394 0.0293 Constraint 191 552 4.9749 6.2187 12.4374 0.0293 Constraint 262 380 4.8232 6.0290 12.0581 0.0291 Constraint 574 641 5.2697 6.5871 13.1742 0.0291 Constraint 388 659 5.1246 6.4057 12.8114 0.0291 Constraint 478 768 4.8441 6.0552 12.1103 0.0290 Constraint 352 627 5.6641 7.0802 14.1603 0.0290 Constraint 286 539 4.1140 5.1425 10.2850 0.0290 Constraint 270 539 5.2161 6.5201 13.0402 0.0290 Constraint 531 603 5.3983 6.7479 13.4959 0.0290 Constraint 500 567 4.3826 5.4783 10.9566 0.0290 Constraint 459 552 5.3117 6.6397 13.2794 0.0290 Constraint 404 667 5.7322 7.1653 14.3306 0.0286 Constraint 751 840 4.7175 5.8969 11.7939 0.0286 Constraint 659 911 3.2942 4.1178 8.2355 0.0284 Constraint 500 698 4.6932 5.8665 11.7329 0.0280 Constraint 560 627 5.8555 7.3193 14.6387 0.0277 Constraint 567 943 6.2717 7.8396 15.6792 0.0274 Constraint 445 711 4.1593 5.1991 10.3981 0.0273 Constraint 199 277 4.3491 5.4364 10.8727 0.0272 Constraint 547 641 5.4007 6.7508 13.5017 0.0271 Constraint 751 822 5.4895 6.8619 13.7237 0.0269 Constraint 404 627 6.0941 7.6176 15.2352 0.0269 Constraint 396 552 5.9805 7.4757 14.9513 0.0269 Constraint 380 590 6.2000 7.7501 15.5001 0.0269 Constraint 380 581 3.5277 4.4096 8.8193 0.0269 Constraint 380 574 5.1463 6.4329 12.8659 0.0269 Constraint 380 560 5.5870 6.9837 13.9675 0.0269 Constraint 372 560 4.9135 6.1418 12.2836 0.0269 Constraint 345 574 4.4290 5.5363 11.0726 0.0269 Constraint 157 567 5.9712 7.4641 14.9281 0.0269 Constraint 149 567 3.8124 4.7655 9.5310 0.0269 Constraint 143 567 4.3831 5.4789 10.9577 0.0269 Constraint 122 345 6.0307 7.5383 15.0766 0.0269 Constraint 122 337 3.7796 4.7245 9.4491 0.0269 Constraint 122 317 4.8180 6.0225 12.0450 0.0269 Constraint 108 352 6.1838 7.7297 15.4595 0.0269 Constraint 95 361 4.8984 6.1230 12.2459 0.0269 Constraint 95 352 6.1612 7.7016 15.4031 0.0269 Constraint 95 337 5.3240 6.6550 13.3100 0.0269 Constraint 547 911 5.1854 6.4818 12.9635 0.0265 Constraint 547 901 5.8214 7.2768 14.5536 0.0265 Constraint 539 911 4.1511 5.1889 10.3779 0.0265 Constraint 539 901 2.9980 3.7475 7.4950 0.0265 Constraint 539 891 6.2571 7.8214 15.6429 0.0265 Constraint 531 911 5.9426 7.4283 14.8566 0.0265 Constraint 531 814 5.7055 7.1319 14.2638 0.0265 Constraint 519 814 5.6496 7.0620 14.1239 0.0265 Constraint 505 801 6.1822 7.7277 15.4554 0.0265 Constraint 505 768 4.1484 5.1855 10.3710 0.0265 Constraint 500 768 4.1765 5.2206 10.4412 0.0265 Constraint 471 690 4.8411 6.0514 12.1027 0.0265 Constraint 471 682 4.7249 5.9061 11.8123 0.0265 Constraint 352 650 4.6358 5.7947 11.5894 0.0263 Constraint 478 719 5.1090 6.3863 12.7726 0.0263 Constraint 633 919 3.7323 4.6653 9.3307 0.0261 Constraint 486 552 5.4191 6.7739 13.5477 0.0261 Constraint 486 547 3.8742 4.8427 9.6854 0.0261 Constraint 459 547 6.0279 7.5348 15.0697 0.0261 Constraint 270 500 4.9545 6.1931 12.3862 0.0261 Constraint 262 411 5.6625 7.0781 14.1563 0.0261 Constraint 199 380 3.6476 4.5595 9.1191 0.0261 Constraint 191 380 6.1215 7.6519 15.3038 0.0261 Constraint 184 404 5.3910 6.7387 13.4775 0.0261 Constraint 184 396 6.1256 7.6569 15.3139 0.0261 Constraint 184 380 3.5962 4.4952 8.9904 0.0261 Constraint 173 372 4.9099 6.1373 12.2747 0.0261 Constraint 143 372 4.5926 5.7407 11.4814 0.0261 Constraint 122 286 5.8565 7.3206 14.6412 0.0261 Constraint 117 309 5.5575 6.9469 13.8938 0.0261 Constraint 117 286 3.3212 4.1515 8.3030 0.0261 Constraint 117 277 5.5447 6.9309 13.8618 0.0261 Constraint 108 294 4.7085 5.8856 11.7713 0.0261 Constraint 108 286 4.9757 6.2196 12.4393 0.0261 Constraint 108 277 4.0638 5.0798 10.1595 0.0261 Constraint 61 277 5.1634 6.4543 12.9086 0.0261 Constraint 614 776 4.3576 5.4470 10.8940 0.0261 Constraint 122 199 5.7958 7.2448 14.4896 0.0260 Constraint 478 727 5.3559 6.6949 13.3898 0.0260 Constraint 567 960 3.8049 4.7561 9.5122 0.0259 Constraint 326 581 5.2938 6.6172 13.2344 0.0259 Constraint 317 581 2.2427 2.8033 5.6067 0.0259 Constraint 317 574 6.2721 7.8402 15.6803 0.0259 Constraint 309 581 6.1163 7.6453 15.2907 0.0259 Constraint 294 581 6.0890 7.6112 15.2224 0.0259 Constraint 614 814 4.5244 5.6555 11.3110 0.0259 Constraint 404 552 4.7196 5.8995 11.7990 0.0258 Constraint 727 827 3.8353 4.7941 9.5882 0.0258 Constraint 919 1043 3.6357 4.5446 9.0893 0.0257 Constraint 919 1026 6.3253 7.9066 15.8131 0.0257 Constraint 911 1019 5.9874 7.4842 14.9685 0.0257 Constraint 581 659 4.7561 5.9451 11.8902 0.0257 Constraint 901 1026 5.9588 7.4485 14.8969 0.0256 Constraint 901 1019 3.8944 4.8680 9.7360 0.0256 Constraint 891 1019 5.8297 7.2872 14.5744 0.0256 Constraint 698 866 5.1105 6.3881 12.7763 0.0256 Constraint 270 466 4.5463 5.6829 11.3658 0.0256 Constraint 262 466 4.5445 5.6806 11.3612 0.0256 Constraint 404 560 5.3450 6.6812 13.3624 0.0254 Constraint 814 931 5.4412 6.8014 13.6029 0.0253 Constraint 667 872 5.1026 6.3782 12.7565 0.0253 Constraint 659 943 5.7101 7.1376 14.2752 0.0253 Constraint 531 633 5.2368 6.5460 13.0919 0.0252 Constraint 690 840 4.3822 5.4777 10.9555 0.0252 Constraint 262 396 5.3863 6.7329 13.4657 0.0251 Constraint 614 698 4.8576 6.0720 12.1439 0.0251 Constraint 326 471 5.2775 6.5969 13.1938 0.0250 Constraint 659 743 5.9083 7.3854 14.7708 0.0248 Constraint 411 597 4.3889 5.4861 10.9722 0.0248 Constraint 404 597 5.3416 6.6770 13.3539 0.0248 Constraint 396 597 4.7511 5.9389 11.8777 0.0248 Constraint 411 690 5.3634 6.7043 13.4085 0.0247 Constraint 345 627 3.9853 4.9816 9.9632 0.0247 Constraint 388 603 5.8365 7.2956 14.5912 0.0246 Constraint 633 840 5.9511 7.4388 14.8776 0.0243 Constraint 633 711 5.2623 6.5779 13.1558 0.0243 Constraint 761 840 5.7993 7.2492 14.4983 0.0243 Constraint 411 519 5.6037 7.0046 14.0092 0.0243 Constraint 404 500 5.9547 7.4434 14.8869 0.0243 Constraint 500 560 4.8675 6.0844 12.1687 0.0242 Constraint 184 253 5.7667 7.2083 14.4167 0.0241 Constraint 727 931 3.7557 4.6946 9.3893 0.0240 Constraint 404 690 5.5417 6.9271 13.8541 0.0240 Constraint 603 827 3.9990 4.9987 9.9974 0.0240 Constraint 471 560 5.2533 6.5667 13.1333 0.0240 Constraint 768 883 3.7131 4.6414 9.2827 0.0239 Constraint 768 872 4.2022 5.2528 10.5056 0.0239 Constraint 633 943 5.8483 7.3104 14.6207 0.0238 Constraint 388 471 5.3046 6.6308 13.2616 0.0235 Constraint 627 719 4.9472 6.1840 12.3681 0.0233 Constraint 539 919 5.9083 7.3854 14.7708 0.0233 Constraint 641 719 5.1703 6.4628 12.9257 0.0232 Constraint 430 603 4.5786 5.7232 11.4464 0.0231 Constraint 437 627 6.0446 7.5558 15.1115 0.0230 Constraint 294 539 5.4716 6.8394 13.6789 0.0230 Constraint 199 303 6.2356 7.7945 15.5889 0.0230 Constraint 199 270 5.5036 6.8795 13.7590 0.0230 Constraint 603 872 5.9602 7.4503 14.9006 0.0230 Constraint 659 827 5.1126 6.3908 12.7815 0.0229 Constraint 445 735 5.6774 7.0967 14.1935 0.0229 Constraint 682 866 4.8587 6.0734 12.1467 0.0226 Constraint 253 326 5.5419 6.9274 13.8547 0.0226 Constraint 493 659 5.5827 6.9784 13.9568 0.0226 Constraint 270 471 4.7638 5.9547 11.9095 0.0226 Constraint 614 840 5.4991 6.8739 13.7478 0.0226 Constraint 603 840 5.7772 7.2215 14.4429 0.0226 Constraint 603 822 5.4407 6.8009 13.6017 0.0226 Constraint 388 466 4.5677 5.7096 11.4193 0.0225 Constraint 603 901 5.8869 7.3587 14.7174 0.0224 Constraint 519 659 6.1803 7.7253 15.4507 0.0222 Constraint 627 751 5.3959 6.7449 13.4898 0.0222 Constraint 659 883 4.9876 6.2345 12.4690 0.0222 Constraint 493 827 5.3781 6.7226 13.4452 0.0220 Constraint 581 814 3.8558 4.8198 9.6396 0.0220 Constraint 581 776 5.4027 6.7534 13.5068 0.0220 Constraint 808 951 4.7676 5.9596 11.9191 0.0219 Constraint 380 719 4.5297 5.6621 11.3243 0.0219 Constraint 372 751 5.8684 7.3355 14.6711 0.0219 Constraint 345 751 5.0654 6.3318 12.6636 0.0219 Constraint 761 827 6.3249 7.9061 15.8122 0.0219 Constraint 471 768 4.4662 5.5828 11.1656 0.0218 Constraint 547 659 4.4138 5.5173 11.0346 0.0218 Constraint 827 919 4.4333 5.5416 11.0832 0.0217 Constraint 827 911 5.8164 7.2705 14.5411 0.0217 Constraint 827 901 5.0991 6.3739 12.7478 0.0217 Constraint 822 919 5.1213 6.4017 12.8033 0.0217 Constraint 471 776 5.2349 6.5437 13.0873 0.0217 Constraint 404 590 4.2531 5.3164 10.6328 0.0215 Constraint 719 827 3.8079 4.7599 9.5198 0.0215 Constraint 128 208 4.7448 5.9310 11.8620 0.0214 Constraint 690 822 4.0915 5.1144 10.2288 0.0214 Constraint 659 901 5.6616 7.0770 14.1541 0.0214 Constraint 262 345 4.5051 5.6314 11.2628 0.0214 Constraint 165 270 5.4514 6.8142 13.6285 0.0214 Constraint 667 883 4.6982 5.8727 11.7454 0.0213 Constraint 614 919 4.9027 6.1283 12.2567 0.0213 Constraint 326 466 4.6932 5.8665 11.7330 0.0213 Constraint 396 493 5.9143 7.3929 14.7859 0.0213 Constraint 650 866 3.8353 4.7942 9.5883 0.0211 Constraint 471 567 5.3987 6.7484 13.4968 0.0211 Constraint 539 603 4.4898 5.6122 11.2244 0.0208 Constraint 552 627 5.9195 7.3994 14.7987 0.0204 Constraint 667 943 5.5945 6.9932 13.9863 0.0202 Constraint 380 505 5.0453 6.3066 12.6132 0.0202 Constraint 445 690 6.2318 7.7897 15.5795 0.0202 Constraint 682 951 5.7840 7.2300 14.4599 0.0201 Constraint 667 951 6.3224 7.9029 15.8059 0.0201 Constraint 659 951 6.0930 7.6163 15.2325 0.0201 Constraint 567 849 5.6126 7.0157 14.0315 0.0201 Constraint 552 972 6.1870 7.7338 15.4676 0.0201 Constraint 581 690 6.2966 7.8707 15.7415 0.0201 Constraint 445 706 3.7299 4.6623 9.3247 0.0201 Constraint 445 682 3.6399 4.5499 9.0997 0.0201 Constraint 437 682 4.9118 6.1398 12.2796 0.0201 Constraint 430 682 5.1047 6.3809 12.7618 0.0201 Constraint 531 659 4.9086 6.1357 12.2715 0.0200 Constraint 531 650 4.7546 5.9432 11.8865 0.0200 Constraint 603 698 5.5692 6.9615 13.9230 0.0199 Constraint 849 987 3.8663 4.8329 9.6659 0.0199 Constraint 404 650 4.3324 5.4155 10.8309 0.0198 Constraint 337 471 5.5858 6.9823 13.9646 0.0197 Constraint 478 659 4.0380 5.0475 10.0949 0.0194 Constraint 294 590 5.5972 6.9965 13.9931 0.0194 Constraint 808 943 5.6535 7.0668 14.1337 0.0193 Constraint 510 827 4.8436 6.0545 12.1090 0.0192 Constraint 493 943 6.0029 7.5036 15.0072 0.0192 Constraint 286 891 6.0773 7.5966 15.1932 0.0192 Constraint 478 706 5.6891 7.1114 14.2228 0.0190 Constraint 471 706 3.8054 4.7568 9.5136 0.0190 Constraint 253 539 5.7716 7.2145 14.4289 0.0189 Constraint 253 466 4.8663 6.0829 12.1659 0.0189 Constraint 822 931 3.2225 4.0281 8.0563 0.0189 Constraint 776 919 6.2753 7.8442 15.6883 0.0189 Constraint 727 901 5.3818 6.7273 13.4546 0.0189 Constraint 380 690 3.5139 4.3924 8.7848 0.0189 Constraint 372 719 4.5229 5.6537 11.3074 0.0189 Constraint 372 698 6.1492 7.6866 15.3731 0.0189 Constraint 352 698 3.5203 4.4004 8.8008 0.0189 Constraint 345 901 5.6829 7.1036 14.2073 0.0189 Constraint 345 727 3.2001 4.0001 8.0003 0.0189 Constraint 345 719 3.7352 4.6690 9.3380 0.0189 Constraint 345 706 5.6740 7.0925 14.1850 0.0189 Constraint 345 698 3.2031 4.0038 8.0077 0.0189 Constraint 337 919 6.1140 7.6425 15.2851 0.0189 Constraint 337 911 3.9221 4.9026 9.8052 0.0189 Constraint 337 901 5.1652 6.4564 12.9129 0.0189 Constraint 337 849 6.0831 7.6039 15.2078 0.0189 Constraint 337 698 6.0200 7.5251 15.0501 0.0189 Constraint 326 931 6.0660 7.5825 15.1649 0.0189 Constraint 326 919 4.8315 6.0394 12.0788 0.0189 Constraint 326 911 4.7856 5.9820 11.9640 0.0189 Constraint 317 931 3.7639 4.7049 9.4097 0.0189 Constraint 317 919 4.8345 6.0432 12.0864 0.0189 Constraint 317 911 2.8425 3.5531 7.1063 0.0189 Constraint 317 849 5.3333 6.6666 13.3332 0.0189 Constraint 317 822 6.0956 7.6195 15.2389 0.0189 Constraint 303 931 5.8135 7.2669 14.5338 0.0189 Constraint 437 768 5.9295 7.4119 14.8237 0.0188 Constraint 352 486 5.2738 6.5923 13.1845 0.0188 Constraint 445 727 4.7442 5.9303 11.8606 0.0187 Constraint 352 471 5.3112 6.6390 13.2781 0.0187 Constraint 493 711 4.6872 5.8590 11.7179 0.0187 Constraint 317 466 4.8768 6.0960 12.1919 0.0186 Constraint 478 751 5.1080 6.3850 12.7700 0.0186 Constraint 191 466 5.6174 7.0217 14.0434 0.0186 Constraint 117 247 5.8630 7.3288 14.6575 0.0184 Constraint 117 232 2.9426 3.6782 7.3564 0.0184 Constraint 627 857 5.6661 7.0826 14.1653 0.0183 Constraint 627 849 4.0330 5.0412 10.0824 0.0183 Constraint 627 840 5.8653 7.3316 14.6633 0.0183 Constraint 627 743 5.2110 6.5137 13.0275 0.0183 Constraint 621 857 5.5949 6.9936 13.9873 0.0183 Constraint 621 849 6.2719 7.8399 15.6798 0.0183 Constraint 621 840 3.8711 4.8389 9.6778 0.0183 Constraint 614 827 5.7832 7.2290 14.4580 0.0183 Constraint 603 814 5.5044 6.8805 13.7609 0.0183 Constraint 597 827 5.3435 6.6793 13.3587 0.0183 Constraint 597 822 3.9843 4.9804 9.9608 0.0183 Constraint 597 814 5.4538 6.8172 13.6345 0.0183 Constraint 590 814 4.6824 5.8529 11.7059 0.0183 Constraint 581 808 3.0587 3.8234 7.6468 0.0183 Constraint 581 801 3.8262 4.7828 9.5655 0.0183 Constraint 471 574 5.5783 6.9729 13.9458 0.0183 Constraint 445 574 6.3155 7.8944 15.7887 0.0183 Constraint 445 560 6.2022 7.7528 15.5056 0.0183 Constraint 437 597 5.8274 7.2842 14.5685 0.0183 Constraint 437 574 4.6530 5.8163 11.6326 0.0183 Constraint 404 574 5.3035 6.6294 13.2588 0.0183 Constraint 396 614 6.3834 7.9793 15.9586 0.0183 Constraint 396 590 4.8485 6.0607 12.1213 0.0183 Constraint 128 199 6.1240 7.6550 15.3099 0.0183 Constraint 277 372 5.2822 6.6027 13.2054 0.0182 Constraint 493 743 4.9274 6.1593 12.3186 0.0182 Constraint 590 682 5.0873 6.3592 12.7184 0.0180 Constraint 493 719 5.5512 6.9389 13.8779 0.0179 Constraint 547 650 4.7218 5.9022 11.8044 0.0176 Constraint 493 735 4.5446 5.6807 11.3614 0.0176 Constraint 650 840 5.8476 7.3095 14.6191 0.0176 Constraint 633 883 4.5487 5.6859 11.3718 0.0176 Constraint 641 919 6.0322 7.5402 15.0804 0.0175 Constraint 698 931 5.4391 6.7988 13.5976 0.0172 Constraint 698 911 4.5992 5.7491 11.4981 0.0172 Constraint 698 849 4.1555 5.1944 10.3888 0.0172 Constraint 621 690 4.6330 5.7912 11.5825 0.0172 Constraint 380 500 4.6577 5.8221 11.6442 0.0172 Constraint 372 911 5.4378 6.7973 13.5946 0.0172 Constraint 372 500 5.1250 6.4062 12.8124 0.0172 Constraint 191 372 5.5943 6.9929 13.9857 0.0172 Constraint 603 719 4.8433 6.0541 12.1083 0.0171 Constraint 560 743 3.6010 4.5012 9.0025 0.0170 Constraint 560 735 6.0778 7.5973 15.1945 0.0170 Constraint 567 650 5.0752 6.3439 12.6879 0.0170 Constraint 539 641 6.2247 7.7809 15.5618 0.0169 Constraint 220 326 5.5702 6.9628 13.9255 0.0169 Constraint 117 199 4.5060 5.6325 11.2650 0.0169 Constraint 117 184 5.7640 7.2050 14.4100 0.0169 Constraint 552 911 4.8868 6.1085 12.2170 0.0168 Constraint 552 901 5.6573 7.0717 14.1433 0.0168 Constraint 547 627 4.5540 5.6924 11.3849 0.0168 Constraint 191 270 4.3016 5.3770 10.7539 0.0168 Constraint 184 270 5.9342 7.4177 14.8354 0.0168 Constraint 505 567 4.9580 6.1975 12.3949 0.0167 Constraint 253 337 4.0729 5.0911 10.1821 0.0166 Constraint 53 471 5.2555 6.5694 13.1389 0.0166 Constraint 388 510 4.8009 6.0012 12.0023 0.0165 Constraint 388 505 4.4411 5.5514 11.1028 0.0165 Constraint 943 1011 5.4227 6.7784 13.5568 0.0165 Constraint 667 827 5.6056 7.0069 14.0139 0.0165 Constraint 286 590 4.4372 5.5464 11.0929 0.0163 Constraint 122 361 6.2571 7.8214 15.6428 0.0163 Constraint 500 603 4.9102 6.1377 12.2754 0.0163 Constraint 531 614 5.8637 7.3296 14.6593 0.0161 Constraint 471 698 5.2778 6.5972 13.1944 0.0161 Constraint 466 706 6.0309 7.5386 15.0773 0.0161 Constraint 466 698 4.3781 5.4726 10.9451 0.0161 Constraint 459 706 6.0264 7.5330 15.0660 0.0161 Constraint 459 698 5.0135 6.2669 12.5338 0.0161 Constraint 459 690 3.9529 4.9411 9.8822 0.0161 Constraint 411 682 3.8696 4.8370 9.6741 0.0161 Constraint 404 698 5.9210 7.4012 14.8025 0.0161 Constraint 404 682 5.1217 6.4021 12.8042 0.0161 Constraint 388 682 6.0025 7.5031 15.0061 0.0161 Constraint 380 682 3.1729 3.9662 7.9323 0.0161 Constraint 380 650 4.7034 5.8793 11.7586 0.0161 Constraint 345 650 5.5305 6.9131 13.8261 0.0161 Constraint 303 500 6.0142 7.5177 15.0354 0.0161 Constraint 303 493 3.8345 4.7931 9.5863 0.0161 Constraint 361 486 4.5493 5.6866 11.3732 0.0161 Constraint 531 597 4.5187 5.6484 11.2968 0.0161 Constraint 471 727 3.9491 4.9364 9.8727 0.0159 Constraint 262 437 4.1370 5.1712 10.3425 0.0159 Constraint 238 539 6.2689 7.8361 15.6723 0.0159 Constraint 232 560 6.0635 7.5794 15.1587 0.0159 Constraint 220 560 4.1848 5.2310 10.4620 0.0159 Constraint 220 552 6.0270 7.5338 15.0676 0.0159 Constraint 220 547 3.8296 4.7870 9.5741 0.0159 Constraint 208 560 4.6926 5.8658 11.7315 0.0159 Constraint 208 552 5.3263 6.6579 13.3158 0.0159 Constraint 208 547 4.9869 6.2336 12.4672 0.0159 Constraint 208 539 4.2995 5.3743 10.7487 0.0159 Constraint 199 560 3.8543 4.8179 9.6358 0.0159 Constraint 199 552 5.7292 7.1615 14.3231 0.0159 Constraint 173 262 5.9397 7.4246 14.8492 0.0159 Constraint 165 437 5.9813 7.4766 14.9532 0.0159 Constraint 165 262 5.5701 6.9626 13.9252 0.0159 Constraint 157 751 4.5327 5.6658 11.3317 0.0159 Constraint 157 471 5.5544 6.9430 13.8861 0.0159 Constraint 157 437 6.1987 7.7484 15.4968 0.0159 Constraint 372 466 6.3590 7.9488 15.8976 0.0158 Constraint 478 776 5.5296 6.9120 13.8240 0.0157 Constraint 361 471 4.5769 5.7212 11.4424 0.0157 Constraint 761 972 6.1338 7.6673 15.3346 0.0156 Constraint 761 951 6.0383 7.5478 15.0957 0.0156 Constraint 337 466 4.4161 5.5202 11.0403 0.0156 Constraint 345 478 5.4752 6.8440 13.6880 0.0156 Constraint 814 951 4.9174 6.1468 12.2936 0.0155 Constraint 808 972 6.1395 7.6744 15.3489 0.0155 Constraint 776 972 6.1879 7.7349 15.4697 0.0155 Constraint 309 931 6.2365 7.7957 15.5913 0.0155 Constraint 574 690 6.0028 7.5036 15.0071 0.0155 Constraint 352 478 4.7736 5.9669 11.9339 0.0154 Constraint 345 471 4.7089 5.8862 11.7724 0.0154 Constraint 493 727 6.1325 7.6656 15.3312 0.0154 Constraint 486 727 4.9417 6.1771 12.3542 0.0154 Constraint 486 719 3.5281 4.4101 8.8202 0.0154 Constraint 404 641 4.9900 6.2375 12.4750 0.0152 Constraint 500 735 4.3299 5.4123 10.8247 0.0151 Constraint 372 633 5.5711 6.9639 13.9278 0.0151 Constraint 682 901 5.2912 6.6140 13.2280 0.0151 Constraint 372 531 6.1543 7.6928 15.3857 0.0150 Constraint 337 552 4.8627 6.0784 12.1568 0.0150 Constraint 603 743 5.7150 7.1438 14.2876 0.0150 Constraint 650 883 5.8390 7.2987 14.5975 0.0149 Constraint 380 459 5.1019 6.3774 12.7548 0.0148 Constraint 478 590 4.8908 6.1135 12.2270 0.0147 Constraint 262 430 5.4117 6.7646 13.5292 0.0145 Constraint 505 597 5.9213 7.4016 14.8032 0.0143 Constraint 500 751 5.5289 6.9112 13.8224 0.0143 Constraint 614 682 4.6588 5.8235 11.6470 0.0141 Constraint 682 883 4.5619 5.7024 11.4047 0.0140 Constraint 650 891 5.2099 6.5123 13.0246 0.0140 Constraint 547 667 6.2679 7.8348 15.6696 0.0140 Constraint 345 603 5.7228 7.1535 14.3070 0.0140 Constraint 690 960 4.7418 5.9272 11.8545 0.0138 Constraint 690 951 2.4968 3.1210 6.2420 0.0138 Constraint 674 840 5.7245 7.1556 14.3113 0.0138 Constraint 650 951 6.0032 7.5040 15.0080 0.0138 Constraint 560 943 6.0528 7.5660 15.1320 0.0138 Constraint 641 943 5.9772 7.4714 14.9429 0.0138 Constraint 388 614 4.4605 5.5757 11.1514 0.0136 Constraint 430 667 6.2221 7.7777 15.5554 0.0136 Constraint 277 352 6.3479 7.9348 15.8697 0.0136 Constraint 270 345 6.0231 7.5289 15.0577 0.0136 Constraint 253 345 5.8029 7.2536 14.5073 0.0136 Constraint 776 849 4.0897 5.1121 10.2242 0.0135 Constraint 751 857 6.3613 7.9517 15.9033 0.0135 Constraint 567 972 3.6293 4.5366 9.0732 0.0135 Constraint 560 972 4.6725 5.8406 11.6812 0.0135 Constraint 388 500 5.7303 7.1629 14.3258 0.0135 Constraint 372 776 5.8708 7.3385 14.6770 0.0134 Constraint 404 486 5.8185 7.2731 14.5462 0.0134 Constraint 309 560 5.7999 7.2499 14.4998 0.0134 Constraint 581 667 4.8286 6.0357 12.0715 0.0133 Constraint 101 309 6.2467 7.8084 15.6169 0.0132 Constraint 445 801 4.8893 6.1116 12.2232 0.0132 Constraint 445 768 5.2465 6.5582 13.1164 0.0132 Constraint 478 801 5.8749 7.3436 14.6872 0.0130 Constraint 294 567 5.5704 6.9630 13.9259 0.0130 Constraint 270 567 5.2129 6.5162 13.0323 0.0130 Constraint 270 552 4.5770 5.7212 11.4424 0.0130 Constraint 143 220 5.4852 6.8565 13.7129 0.0129 Constraint 128 220 3.5767 4.4708 8.9417 0.0129 Constraint 122 220 5.2570 6.5712 13.1424 0.0129 Constraint 122 208 4.4847 5.6059 11.2119 0.0129 Constraint 505 727 6.0037 7.5047 15.0094 0.0129 Constraint 486 711 6.2323 7.7904 15.5808 0.0129 Constraint 303 659 5.8912 7.3640 14.7279 0.0129 Constraint 303 627 5.8396 7.2995 14.5989 0.0129 Constraint 303 519 4.9863 6.2329 12.4657 0.0129 Constraint 303 486 6.3874 7.9843 15.9686 0.0129 Constraint 303 478 4.2348 5.2935 10.5869 0.0129 Constraint 270 437 4.8635 6.0794 12.1587 0.0129 Constraint 173 270 4.0969 5.1211 10.2422 0.0129 Constraint 157 270 4.5483 5.6854 11.3708 0.0129 Constraint 827 960 5.5627 6.9534 13.9068 0.0129 Constraint 614 719 5.6811 7.1013 14.2027 0.0129 Constraint 430 633 4.4981 5.6226 11.2452 0.0129 Constraint 430 627 3.3978 4.2472 8.4944 0.0129 Constraint 108 309 6.3814 7.9767 15.9535 0.0129 Constraint 388 633 4.6209 5.7761 11.5522 0.0128 Constraint 380 627 4.7557 5.9447 11.8893 0.0128 Constraint 735 960 6.0881 7.6101 15.2202 0.0128 Constraint 735 931 5.8268 7.2835 14.5670 0.0128 Constraint 735 840 5.4295 6.7869 13.5737 0.0128 Constraint 727 951 5.2711 6.5889 13.1777 0.0128 Constraint 539 633 4.9460 6.1825 12.3649 0.0128 Constraint 122 396 4.5395 5.6744 11.3488 0.0128 Constraint 719 792 5.7408 7.1760 14.3520 0.0126 Constraint 337 437 4.0114 5.0142 10.0285 0.0126 Constraint 326 493 6.2266 7.7832 15.5664 0.0126 Constraint 891 1026 5.1500 6.4375 12.8751 0.0125 Constraint 309 574 4.8222 6.0278 12.0556 0.0124 Constraint 286 574 5.3450 6.6812 13.3624 0.0124 Constraint 191 361 5.3526 6.6908 13.3816 0.0124 Constraint 191 326 4.5965 5.7456 11.4912 0.0124 Constraint 822 901 3.2487 4.0609 8.1218 0.0124 Constraint 814 883 6.2179 7.7724 15.5448 0.0124 Constraint 531 667 6.3548 7.9434 15.8869 0.0124 Constraint 471 911 5.4298 6.7873 13.5745 0.0124 Constraint 361 478 5.8372 7.2965 14.5930 0.0124 Constraint 326 590 5.8388 7.2985 14.5970 0.0124 Constraint 317 590 6.1260 7.6575 15.3149 0.0124 Constraint 931 1026 6.2384 7.7980 15.5960 0.0124 Constraint 621 901 4.7641 5.9551 11.9102 0.0124 Constraint 621 891 5.1345 6.4182 12.8363 0.0124 Constraint 459 574 5.7355 7.1694 14.3387 0.0124 Constraint 39 136 4.0495 5.0619 10.1238 0.0124 Constraint 39 128 4.7170 5.8962 11.7925 0.0124 Constraint 39 122 3.5302 4.4128 8.8255 0.0124 Constraint 31 136 4.2097 5.2621 10.5242 0.0124 Constraint 31 122 6.0048 7.5060 15.0121 0.0124 Constraint 309 627 5.9241 7.4052 14.8103 0.0122 Constraint 80 220 5.5141 6.8926 13.7852 0.0122 Constraint 80 208 5.6455 7.0569 14.1137 0.0122 Constraint 419 659 4.6819 5.8523 11.7046 0.0121 Constraint 419 650 5.8592 7.3240 14.6481 0.0121 Constraint 419 641 4.1878 5.2348 10.4696 0.0121 Constraint 411 659 6.0986 7.6232 15.2464 0.0121 Constraint 411 650 3.8207 4.7759 9.5519 0.0121 Constraint 411 641 3.9256 4.9070 9.8140 0.0121 Constraint 621 698 4.7679 5.9598 11.9196 0.0119 Constraint 519 581 5.2322 6.5403 13.0806 0.0118 Constraint 396 560 5.5049 6.8811 13.7623 0.0118 Constraint 247 337 5.0702 6.3377 12.6754 0.0118 Constraint 238 337 5.1542 6.4427 12.8854 0.0118 Constraint 89 208 4.8879 6.1099 12.2198 0.0118 Constraint 108 361 6.3190 7.8987 15.7974 0.0117 Constraint 117 262 5.8995 7.3743 14.7486 0.0117 Constraint 478 603 5.0959 6.3699 12.7397 0.0115 Constraint 247 430 4.6122 5.7652 11.5304 0.0115 Constraint 117 208 3.7946 4.7433 9.4865 0.0115 Constraint 682 872 4.4396 5.5494 11.0989 0.0115 Constraint 682 808 5.1153 6.3942 12.7883 0.0115 Constraint 519 627 5.6383 7.0479 14.0957 0.0115 Constraint 597 719 5.7708 7.2135 14.4270 0.0114 Constraint 238 326 3.9886 4.9857 9.9714 0.0114 Constraint 232 326 5.7038 7.1298 14.2595 0.0114 Constraint 574 743 6.2712 7.8390 15.6780 0.0113 Constraint 574 711 4.0301 5.0377 10.0754 0.0113 Constraint 567 743 5.6167 7.0209 14.0418 0.0113 Constraint 277 396 4.5398 5.6747 11.3495 0.0113 Constraint 590 667 4.5921 5.7401 11.4802 0.0111 Constraint 567 659 5.7389 7.1736 14.3473 0.0111 Constraint 388 621 5.6275 7.0343 14.0686 0.0110 Constraint 388 590 3.1158 3.8947 7.7894 0.0110 Constraint 751 866 5.2418 6.5523 13.1045 0.0109 Constraint 396 539 5.7664 7.2080 14.4160 0.0108 Constraint 108 603 5.6319 7.0399 14.0798 0.0108 Constraint 108 597 5.4097 6.7621 13.5241 0.0108 Constraint 500 682 5.2395 6.5494 13.0987 0.0108 Constraint 808 960 5.7673 7.2091 14.4183 0.0107 Constraint 808 931 5.2657 6.5821 13.1643 0.0107 Constraint 478 581 5.8527 7.3158 14.6317 0.0107 Constraint 404 539 4.7237 5.9046 11.8093 0.0107 Constraint 531 743 6.1219 7.6524 15.3048 0.0106 Constraint 547 614 5.3285 6.6606 13.3213 0.0106 Constraint 445 784 4.6535 5.8168 11.6337 0.0105 Constraint 404 751 4.1775 5.2219 10.4438 0.0105 Constraint 345 560 6.1664 7.7081 15.4161 0.0105 Constraint 590 857 5.3818 6.7273 13.4546 0.0104 Constraint 590 840 4.5412 5.6765 11.3529 0.0104 Constraint 500 674 4.5617 5.7021 11.4042 0.0104 Constraint 396 690 3.7346 4.6682 9.3364 0.0104 Constraint 396 682 4.9613 6.2016 12.4032 0.0104 Constraint 396 667 3.4997 4.3746 8.7492 0.0104 Constraint 667 891 3.9584 4.9480 9.8960 0.0104 Constraint 309 567 4.9761 6.2202 12.4403 0.0104 Constraint 309 552 4.7996 5.9995 11.9989 0.0104 Constraint 191 309 5.0999 6.3748 12.7496 0.0104 Constraint 108 184 4.4280 5.5350 11.0700 0.0103 Constraint 500 597 5.0209 6.2761 12.5522 0.0103 Constraint 445 776 4.6448 5.8061 11.6121 0.0103 Constraint 478 814 5.9995 7.4994 14.9988 0.0102 Constraint 437 603 6.3565 7.9456 15.8912 0.0102 Constraint 430 581 5.9755 7.4694 14.9388 0.0102 Constraint 411 633 6.2994 7.8742 15.7485 0.0102 Constraint 411 627 4.8937 6.1172 12.2343 0.0102 Constraint 388 627 4.1589 5.1986 10.3973 0.0102 Constraint 361 690 4.4107 5.5133 11.0267 0.0102 Constraint 361 682 5.6631 7.0789 14.1578 0.0102 Constraint 361 659 3.2440 4.0550 8.1100 0.0102 Constraint 352 690 6.1816 7.7271 15.4541 0.0102 Constraint 352 682 3.7043 4.6304 9.2608 0.0102 Constraint 352 659 3.5067 4.3834 8.7668 0.0102 Constraint 345 682 6.1573 7.6966 15.3931 0.0102 Constraint 337 711 4.6340 5.7925 11.5850 0.0102 Constraint 337 690 4.7450 5.9313 11.8625 0.0102 Constraint 337 682 5.2710 6.5887 13.1775 0.0102 Constraint 326 711 5.3934 6.7417 13.4835 0.0102 Constraint 326 706 6.0819 7.6024 15.2049 0.0102 Constraint 326 682 3.5598 4.4497 8.8995 0.0102 Constraint 317 743 6.1295 7.6618 15.3237 0.0102 Constraint 317 735 4.6776 5.8470 11.6940 0.0102 Constraint 317 719 6.1993 7.7492 15.4984 0.0102 Constraint 317 711 2.2163 2.7704 5.5407 0.0102 Constraint 317 706 4.7132 5.8915 11.7830 0.0102 Constraint 317 690 6.2545 7.8181 15.6363 0.0102 Constraint 317 682 5.6528 7.0660 14.1321 0.0102 Constraint 309 735 5.5463 6.9329 13.8658 0.0102 Constraint 309 711 5.7782 7.2228 14.4456 0.0102 Constraint 253 711 5.9477 7.4346 14.8691 0.0102 Constraint 471 531 4.8921 6.1151 12.2303 0.0101 Constraint 500 590 4.3150 5.3937 10.7874 0.0100 Constraint 784 911 6.2220 7.7775 15.5550 0.0100 Constraint 690 943 4.2652 5.3315 10.6630 0.0100 Constraint 674 951 6.2523 7.8154 15.6307 0.0100 Constraint 674 827 4.9296 6.1620 12.3240 0.0100 Constraint 674 822 5.8843 7.3554 14.7107 0.0100 Constraint 667 822 4.0873 5.1091 10.2183 0.0100 Constraint 659 822 5.9266 7.4083 14.8165 0.0100 Constraint 650 943 5.3305 6.6631 13.3263 0.0100 Constraint 650 901 5.7085 7.1357 14.2713 0.0100 Constraint 614 891 5.7259 7.1574 14.3148 0.0100 Constraint 614 883 4.1436 5.1795 10.3589 0.0100 Constraint 614 866 5.7548 7.1935 14.3870 0.0100 Constraint 560 849 5.6126 7.0157 14.0315 0.0100 Constraint 531 1003 4.5474 5.6843 11.3686 0.0100 Constraint 531 972 5.0329 6.2912 12.5823 0.0100 Constraint 232 303 4.1100 5.1375 10.2750 0.0099 Constraint 208 471 5.0402 6.3003 12.6006 0.0099 Constraint 136 208 3.9107 4.8884 9.7768 0.0099 Constraint 122 232 5.3913 6.7391 13.4781 0.0099 Constraint 117 303 5.8162 7.2703 14.5405 0.0099 Constraint 388 597 5.0148 6.2686 12.5371 0.0098 Constraint 743 814 4.8813 6.1017 12.2033 0.0098 Constraint 719 814 4.9797 6.2246 12.4492 0.0098 Constraint 505 581 5.0678 6.3348 12.6695 0.0097 Constraint 500 581 3.7781 4.7227 9.4453 0.0097 Constraint 590 698 5.8870 7.3587 14.7174 0.0097 Constraint 590 690 3.3466 4.1833 8.3665 0.0097 Constraint 590 674 4.6035 5.7544 11.5087 0.0097 Constraint 419 682 6.3189 7.8986 15.7973 0.0097 Constraint 277 486 5.8623 7.3279 14.6557 0.0097 Constraint 277 478 4.2312 5.2890 10.5781 0.0097 Constraint 277 471 6.2563 7.8204 15.6408 0.0097 Constraint 277 466 4.8257 6.0321 12.0642 0.0097 Constraint 270 719 6.3919 7.9899 15.9798 0.0097 Constraint 270 486 5.1070 6.3838 12.7676 0.0097 Constraint 270 478 6.1510 7.6887 15.3774 0.0097 Constraint 262 471 5.8105 7.2631 14.5262 0.0097 Constraint 262 459 5.8572 7.3216 14.6431 0.0097 Constraint 262 445 5.0696 6.3370 12.6739 0.0097 Constraint 621 706 4.8330 6.0413 12.0825 0.0094 Constraint 614 706 4.2461 5.3076 10.6153 0.0094 Constraint 597 743 5.4820 6.8525 13.7051 0.0093 Constraint 108 191 4.9340 6.1675 12.3350 0.0092 Constraint 277 567 4.8447 6.0558 12.1117 0.0090 Constraint 277 560 5.2998 6.6247 13.2494 0.0090 Constraint 277 552 4.5938 5.7423 11.4845 0.0090 Constraint 247 326 5.4357 6.7946 13.5892 0.0090 Constraint 220 590 6.0625 7.5782 15.1563 0.0090 Constraint 199 567 6.3959 7.9949 15.9899 0.0090 Constraint 486 735 3.9193 4.8991 9.7982 0.0090 Constraint 500 621 5.2044 6.5055 13.0111 0.0089 Constraint 411 539 6.1050 7.6313 15.2626 0.0089 Constraint 309 396 6.0094 7.5118 15.0235 0.0088 Constraint 919 1051 4.6808 5.8510 11.7019 0.0088 Constraint 849 1051 5.5023 6.8778 13.7557 0.0088 Constraint 500 627 6.2442 7.8053 15.6106 0.0088 Constraint 478 627 5.4321 6.7901 13.5803 0.0088 Constraint 471 627 6.3505 7.9381 15.8763 0.0088 Constraint 372 641 5.8200 7.2750 14.5500 0.0088 Constraint 309 388 5.9659 7.4574 14.9147 0.0088 Constraint 270 361 2.9904 3.7380 7.4759 0.0088 Constraint 238 372 5.3034 6.6292 13.2584 0.0088 Constraint 238 361 5.9061 7.3826 14.7652 0.0088 Constraint 208 659 5.9720 7.4650 14.9300 0.0088 Constraint 208 650 4.4404 5.5505 11.1010 0.0088 Constraint 89 659 3.7438 4.6797 9.3594 0.0088 Constraint 89 650 3.6701 4.5877 9.1753 0.0088 Constraint 89 641 4.6282 5.7853 11.5706 0.0088 Constraint 89 404 5.4620 6.8275 13.6550 0.0088 Constraint 89 372 3.4354 4.2942 8.5884 0.0088 Constraint 89 238 5.0061 6.2576 12.5153 0.0088 Constraint 80 650 4.5968 5.7461 11.4921 0.0088 Constraint 72 650 5.6220 7.0275 14.0550 0.0088 Constraint 72 641 4.3445 5.4306 10.8612 0.0088 Constraint 72 633 6.2443 7.8054 15.6107 0.0088 Constraint 72 627 6.1581 7.6976 15.3952 0.0088 Constraint 72 471 4.7059 5.8824 11.7649 0.0088 Constraint 72 404 3.8330 4.7912 9.5825 0.0088 Constraint 72 372 5.8873 7.3591 14.7183 0.0088 Constraint 61 650 5.8649 7.3311 14.6622 0.0088 Constraint 61 641 4.7949 5.9936 11.9873 0.0088 Constraint 61 633 2.7768 3.4711 6.9421 0.0088 Constraint 61 627 4.4504 5.5630 11.1260 0.0088 Constraint 53 633 5.9095 7.3868 14.7736 0.0088 Constraint 53 627 4.3780 5.4725 10.9450 0.0088 Constraint 53 621 6.1118 7.6398 15.2796 0.0088 Constraint 53 603 3.6586 4.5732 9.1465 0.0088 Constraint 53 531 5.8113 7.2641 14.5281 0.0088 Constraint 53 500 5.6178 7.0222 14.0445 0.0088 Constraint 46 633 4.8823 6.1029 12.2058 0.0088 Constraint 46 627 6.2432 7.8040 15.6079 0.0088 Constraint 46 621 4.3418 5.4273 10.8545 0.0088 Constraint 46 614 5.2601 6.5751 13.1502 0.0088 Constraint 46 603 5.3693 6.7117 13.4233 0.0088 Constraint 39 614 3.8393 4.7992 9.5983 0.0088 Constraint 39 603 4.0256 5.0320 10.0640 0.0088 Constraint 39 597 5.6902 7.1127 14.2254 0.0088 Constraint 31 621 5.9385 7.4231 14.8462 0.0088 Constraint 31 614 4.0084 5.0105 10.0209 0.0088 Constraint 471 581 5.6318 7.0397 14.0794 0.0087 Constraint 361 911 6.3807 7.9759 15.9518 0.0087 Constraint 505 706 6.1998 7.7498 15.4996 0.0087 Constraint 500 706 3.1610 3.9512 7.9025 0.0087 Constraint 471 735 3.4723 4.3404 8.6808 0.0087 Constraint 430 768 6.1263 7.6579 15.3159 0.0087 Constraint 430 743 6.1809 7.7262 15.4524 0.0087 Constraint 419 808 5.6591 7.0738 14.1477 0.0087 Constraint 682 931 6.2665 7.8331 15.6662 0.0086 Constraint 682 919 6.1418 7.6773 15.3546 0.0086 Constraint 735 827 6.2933 7.8666 15.7332 0.0085 Constraint 633 719 6.1945 7.7431 15.4862 0.0085 Constraint 430 500 5.2221 6.5276 13.0553 0.0085 Constraint 345 590 5.9776 7.4720 14.9439 0.0085 Constraint 309 590 3.6404 4.5505 9.1011 0.0085 Constraint 286 567 5.5645 6.9557 13.9113 0.0085 Constraint 220 294 5.8905 7.3631 14.7263 0.0085 Constraint 143 232 4.1280 5.1600 10.3201 0.0085 Constraint 286 361 4.6590 5.8237 11.6475 0.0085 Constraint 277 361 3.4666 4.3332 8.6664 0.0085 Constraint 262 419 5.9781 7.4726 14.9452 0.0085 Constraint 157 303 6.2897 7.8621 15.7242 0.0085 Constraint 149 303 2.7848 3.4810 6.9621 0.0085 Constraint 149 294 6.0031 7.5039 15.0078 0.0085 Constraint 143 303 5.0448 6.3060 12.6120 0.0085 Constraint 143 294 4.5385 5.6731 11.3463 0.0085 Constraint 143 286 5.4867 6.8584 13.7167 0.0085 Constraint 143 270 4.3570 5.4462 10.8925 0.0085 Constraint 136 309 6.1843 7.7303 15.4606 0.0085 Constraint 136 303 4.1121 5.1402 10.2804 0.0085 Constraint 136 294 5.1877 6.4846 12.9692 0.0085 Constraint 136 286 4.1727 5.2159 10.4318 0.0085 Constraint 136 277 5.2776 6.5969 13.1939 0.0085 Constraint 136 270 5.7094 7.1368 14.2736 0.0085 Constraint 128 262 6.1631 7.7039 15.4078 0.0085 Constraint 128 253 5.6526 7.0657 14.1314 0.0085 Constraint 122 372 4.7807 5.9758 11.9517 0.0085 Constraint 117 253 4.0848 5.1060 10.2121 0.0085 Constraint 136 220 5.7083 7.1353 14.2707 0.0083 Constraint 117 191 5.4049 6.7561 13.5123 0.0083 Constraint 500 690 6.3324 7.9155 15.8309 0.0083 Constraint 891 1033 5.5379 6.9223 13.8447 0.0083 Constraint 891 1011 4.9097 6.1371 12.2741 0.0083 Constraint 883 1033 3.8007 4.7508 9.5017 0.0083 Constraint 883 1026 5.9777 7.4721 14.9442 0.0083 Constraint 883 1011 5.5199 6.8998 13.7996 0.0083 Constraint 866 1033 5.2935 6.6168 13.2336 0.0083 Constraint 866 1026 5.9064 7.3830 14.7659 0.0083 Constraint 866 1011 3.4319 4.2898 8.5796 0.0083 Constraint 286 849 5.4632 6.8290 13.6580 0.0083 Constraint 430 547 5.9137 7.3921 14.7843 0.0082 Constraint 445 510 6.3852 7.9815 15.9630 0.0080 Constraint 437 505 6.0956 7.6195 15.2389 0.0080 Constraint 396 581 5.3437 6.6797 13.3593 0.0079 Constraint 380 486 5.2440 6.5550 13.1101 0.0079 Constraint 519 674 4.4316 5.5395 11.0789 0.0079 Constraint 459 727 5.4099 6.7624 13.5249 0.0079 Constraint 682 960 6.1675 7.7094 15.4188 0.0078 Constraint 674 960 3.6440 4.5550 9.1101 0.0078 Constraint 667 960 4.5077 5.6346 11.2692 0.0078 Constraint 667 761 6.3140 7.8925 15.7850 0.0078 Constraint 650 761 5.1873 6.4841 12.9683 0.0078 Constraint 641 776 6.3978 7.9973 15.9945 0.0078 Constraint 641 761 5.9574 7.4467 14.8934 0.0078 Constraint 627 768 6.0054 7.5068 15.0135 0.0078 Constraint 614 768 6.1620 7.7025 15.4050 0.0078 Constraint 603 776 3.8181 4.7727 9.5453 0.0078 Constraint 345 581 6.2829 7.8536 15.7072 0.0078 Constraint 478 539 4.7179 5.8974 11.7948 0.0078 Constraint 136 337 4.4481 5.5601 11.1203 0.0078 Constraint 117 743 5.5899 6.9874 13.9748 0.0078 Constraint 117 711 3.9208 4.9009 9.8019 0.0078 Constraint 117 603 5.3212 6.6515 13.3030 0.0078 Constraint 101 597 4.5684 5.7106 11.4211 0.0078 Constraint 89 337 5.7871 7.2339 14.4679 0.0078 Constraint 80 372 5.4176 6.7720 13.5439 0.0078 Constraint 80 361 3.3829 4.2286 8.4571 0.0078 Constraint 80 352 5.1522 6.4403 12.8805 0.0078 Constraint 80 345 4.7178 5.8972 11.7945 0.0078 Constraint 80 337 2.4129 3.0161 6.0322 0.0078 Constraint 72 361 6.1776 7.7220 15.4439 0.0078 Constraint 72 136 4.5877 5.7347 11.4694 0.0078 Constraint 61 396 5.9575 7.4468 14.8937 0.0078 Constraint 61 372 3.3060 4.1325 8.2649 0.0078 Constraint 61 361 3.3765 4.2207 8.4413 0.0078 Constraint 53 493 6.1007 7.6258 15.2517 0.0078 Constraint 53 372 5.1913 6.4891 12.9782 0.0078 Constraint 46 430 5.8810 7.3513 14.7025 0.0078 Constraint 46 404 4.4206 5.5258 11.0516 0.0078 Constraint 46 396 3.8724 4.8404 9.6809 0.0078 Constraint 46 372 4.2211 5.2763 10.5527 0.0078 Constraint 39 519 6.0091 7.5114 15.0229 0.0078 Constraint 39 500 3.8846 4.8557 9.7114 0.0078 Constraint 39 493 4.2229 5.2786 10.5572 0.0078 Constraint 39 471 5.3547 6.6934 13.3867 0.0078 Constraint 31 430 5.2137 6.5171 13.0342 0.0078 Constraint 20 519 3.7788 4.7235 9.4470 0.0078 Constraint 560 659 6.1106 7.6383 15.2765 0.0077 Constraint 437 547 4.2579 5.3223 10.6447 0.0076 Constraint 814 901 5.2096 6.5120 13.0239 0.0076 Constraint 682 814 6.1803 7.7253 15.4507 0.0076 Constraint 674 972 5.2693 6.5866 13.1732 0.0076 Constraint 667 972 6.1388 7.6735 15.3470 0.0076 Constraint 659 814 6.3229 7.9036 15.8073 0.0076 Constraint 659 808 6.0617 7.5771 15.1543 0.0076 Constraint 633 891 5.2073 6.5091 13.0181 0.0076 Constraint 633 814 4.1675 5.2094 10.4187 0.0076 Constraint 633 808 5.2951 6.6189 13.2378 0.0076 Constraint 627 814 5.8057 7.2571 14.5142 0.0076 Constraint 627 808 3.8447 4.8059 9.6119 0.0076 Constraint 621 808 6.3662 7.9578 15.9156 0.0076 Constraint 560 919 5.2500 6.5625 13.1251 0.0076 Constraint 614 711 5.6850 7.1063 14.2125 0.0075 Constraint 531 641 3.8146 4.7683 9.5366 0.0075 Constraint 404 784 4.1563 5.1954 10.3908 0.0075 Constraint 404 776 5.7320 7.1650 14.3300 0.0075 Constraint 404 761 5.9116 7.3895 14.7791 0.0075 Constraint 404 727 6.2845 7.8556 15.7111 0.0075 Constraint 380 784 4.2618 5.3273 10.6546 0.0075 Constraint 372 784 3.5668 4.4586 8.9171 0.0075 Constraint 345 784 6.3806 7.9757 15.9514 0.0075 Constraint 471 603 6.1563 7.6954 15.3908 0.0075 Constraint 776 866 5.2135 6.5168 13.0337 0.0074 Constraint 690 891 6.1115 7.6394 15.2787 0.0073 Constraint 690 866 4.9949 6.2436 12.4873 0.0073 Constraint 650 719 4.4492 5.5614 11.1229 0.0073 Constraint 404 621 6.2214 7.7768 15.5536 0.0073 Constraint 372 603 6.0936 7.6170 15.2339 0.0073 Constraint 345 466 5.2784 6.5980 13.1960 0.0073 Constraint 337 493 5.9481 7.4351 14.8703 0.0073 Constraint 247 388 4.9206 6.1508 12.3016 0.0073 Constraint 761 866 6.1835 7.7293 15.4587 0.0073 Constraint 743 866 4.6038 5.7548 11.5095 0.0073 Constraint 560 641 4.9410 6.1763 12.3525 0.0072 Constraint 590 659 4.1480 5.1850 10.3700 0.0072 Constraint 396 711 6.3819 7.9773 15.9546 0.0071 Constraint 396 547 5.9455 7.4319 14.8637 0.0069 Constraint 294 552 5.6674 7.0843 14.1686 0.0069 Constraint 294 519 5.1727 6.4658 12.9316 0.0069 Constraint 286 552 5.7534 7.1917 14.3834 0.0069 Constraint 270 519 5.8205 7.2756 14.5513 0.0069 Constraint 108 173 3.8076 4.7594 9.5189 0.0069 Constraint 621 711 5.9719 7.4649 14.9298 0.0069 Constraint 404 567 4.5766 5.7207 11.4415 0.0069 Constraint 519 641 5.4456 6.8070 13.6139 0.0069 Constraint 590 943 2.8726 3.5908 7.1815 0.0068 Constraint 590 827 5.9291 7.4113 14.8227 0.0068 Constraint 706 792 4.9291 6.1614 12.3228 0.0067 Constraint 486 590 5.5420 6.9275 13.8550 0.0067 Constraint 478 597 4.8667 6.0834 12.1668 0.0067 Constraint 471 590 6.0877 7.6096 15.2192 0.0067 Constraint 380 633 4.7882 5.9853 11.9705 0.0066 Constraint 603 706 4.3773 5.4716 10.9432 0.0065 Constraint 547 633 5.2968 6.6210 13.2420 0.0065 Constraint 547 621 5.0804 6.3505 12.7010 0.0065 Constraint 539 614 6.3845 7.9806 15.9612 0.0065 Constraint 345 547 6.0380 7.5475 15.0949 0.0065 Constraint 801 960 4.9548 6.1935 12.3871 0.0064 Constraint 776 960 4.7094 5.8868 11.7736 0.0064 Constraint 768 943 5.9911 7.4888 14.9777 0.0064 Constraint 751 960 4.7882 5.9853 11.9706 0.0064 Constraint 743 849 4.1202 5.1502 10.3004 0.0064 Constraint 727 972 6.2670 7.8338 15.6676 0.0064 Constraint 727 943 5.9148 7.3935 14.7869 0.0064 Constraint 719 943 6.2570 7.8213 15.6426 0.0064 Constraint 719 919 2.9472 3.6840 7.3680 0.0064 Constraint 698 919 4.7308 5.9136 11.8271 0.0064 Constraint 698 827 3.9547 4.9434 9.8867 0.0064 Constraint 682 891 5.0745 6.3431 12.6862 0.0064 Constraint 667 901 5.7890 7.2363 14.4726 0.0064 Constraint 667 743 6.3894 7.9868 15.9735 0.0064 Constraint 519 650 5.2322 6.5403 13.0806 0.0064 Constraint 510 650 6.3134 7.8917 15.7835 0.0064 Constraint 493 674 4.9070 6.1337 12.2674 0.0064 Constraint 493 667 5.7778 7.2223 14.4445 0.0064 Constraint 493 650 4.8687 6.0859 12.1717 0.0064 Constraint 478 574 6.3372 7.9215 15.8430 0.0064 Constraint 471 667 5.4821 6.8526 13.7052 0.0064 Constraint 471 659 5.0871 6.3588 12.7177 0.0064 Constraint 466 674 4.5519 5.6899 11.3799 0.0064 Constraint 396 478 4.3029 5.3786 10.7571 0.0064 Constraint 380 471 3.2734 4.0917 8.1834 0.0064 Constraint 345 552 4.4643 5.5804 11.1608 0.0064 Constraint 337 567 4.9170 6.1463 12.2925 0.0064 Constraint 337 560 5.7551 7.1938 14.3877 0.0064 Constraint 303 567 4.3140 5.3925 10.7850 0.0064 Constraint 294 891 6.0069 7.5086 15.0172 0.0064 Constraint 262 891 5.9929 7.4912 14.9823 0.0064 Constraint 208 286 5.5980 6.9975 13.9951 0.0064 Constraint 173 552 6.0085 7.5106 15.0212 0.0064 Constraint 173 539 5.9380 7.4225 14.8450 0.0064 Constraint 173 531 5.3944 6.7430 13.4860 0.0064 Constraint 173 510 6.2592 7.8240 15.6480 0.0064 Constraint 173 396 6.3647 7.9558 15.9117 0.0064 Constraint 165 396 4.5141 5.6426 11.2852 0.0064 Constraint 157 510 6.3496 7.9370 15.8740 0.0064 Constraint 157 478 3.9794 4.9743 9.9486 0.0064 Constraint 157 396 4.5530 5.6913 11.3825 0.0064 Constraint 101 173 5.0371 6.2964 12.5927 0.0064 Constraint 101 165 5.6519 7.0648 14.1296 0.0064 Constraint 531 776 6.3829 7.9786 15.9573 0.0064 Constraint 531 751 6.0578 7.5723 15.1446 0.0064 Constraint 531 719 5.8537 7.3171 14.6342 0.0064 Constraint 493 581 5.2226 6.5283 13.0566 0.0063 Constraint 352 466 4.5355 5.6694 11.3388 0.0062 Constraint 352 459 4.6305 5.7882 11.5764 0.0062 Constraint 309 493 4.5510 5.6887 11.3775 0.0061 Constraint 309 471 5.3026 6.6283 13.2566 0.0061 Constraint 309 466 5.5165 6.8957 13.7914 0.0061 Constraint 505 719 5.2566 6.5708 13.1415 0.0060 Constraint 500 614 4.4106 5.5133 11.0265 0.0060 Constraint 493 621 5.6099 7.0124 14.0248 0.0060 Constraint 486 633 5.3113 6.6391 13.2782 0.0060 Constraint 486 621 4.5570 5.6962 11.3924 0.0060 Constraint 486 614 5.4328 6.7910 13.5820 0.0060 Constraint 478 633 5.1388 6.4236 12.8471 0.0060 Constraint 478 614 4.1488 5.1860 10.3719 0.0060 Constraint 388 519 5.9718 7.4648 14.9295 0.0060 Constraint 317 539 6.0339 7.5423 15.0846 0.0060 Constraint 277 597 6.3619 7.9523 15.9047 0.0060 Constraint 270 560 5.3414 6.6768 13.3535 0.0060 Constraint 270 493 6.3848 7.9810 15.9620 0.0060 Constraint 262 567 3.8384 4.7980 9.5961 0.0060 Constraint 253 560 4.7028 5.8786 11.7571 0.0060 Constraint 253 430 4.9623 6.2029 12.4057 0.0060 Constraint 247 437 5.8986 7.3733 14.7466 0.0060 Constraint 247 317 6.0771 7.5963 15.1927 0.0060 Constraint 232 337 5.7280 7.1600 14.3200 0.0060 Constraint 220 776 4.8678 6.0848 12.1696 0.0060 Constraint 173 776 4.1237 5.1546 10.3092 0.0060 Constraint 157 727 6.3814 7.9768 15.9536 0.0060 Constraint 157 581 5.2408 6.5509 13.1019 0.0060 Constraint 157 560 4.7608 5.9510 11.9019 0.0060 Constraint 493 560 5.5094 6.8868 13.7735 0.0059 Constraint 404 743 5.4755 6.8444 13.6888 0.0059 Constraint 404 719 5.2069 6.5086 13.0171 0.0059 Constraint 866 943 4.4438 5.5548 11.1096 0.0058 Constraint 719 801 4.9724 6.2155 12.4311 0.0057 Constraint 309 478 6.0918 7.6148 15.2295 0.0057 Constraint 136 317 6.0478 7.5597 15.1194 0.0057 Constraint 108 445 4.4015 5.5019 11.0038 0.0057 Constraint 108 430 3.7654 4.7068 9.4135 0.0057 Constraint 108 404 5.6832 7.1040 14.2080 0.0057 Constraint 108 396 5.4339 6.7924 13.5847 0.0057 Constraint 108 262 5.3638 6.7047 13.4095 0.0057 Constraint 108 253 6.0125 7.5157 15.0314 0.0057 Constraint 108 247 3.4033 4.2542 8.5084 0.0057 Constraint 108 238 5.7597 7.1997 14.3993 0.0057 Constraint 108 232 5.2812 6.6015 13.2030 0.0057 Constraint 101 247 5.2194 6.5242 13.0484 0.0057 Constraint 101 238 3.8749 4.8437 9.6874 0.0057 Constraint 101 232 3.3338 4.1673 8.3346 0.0057 Constraint 95 247 5.7913 7.2391 14.4783 0.0057 Constraint 95 238 4.3761 5.4702 10.9404 0.0057 Constraint 445 751 4.5624 5.7030 11.4060 0.0055 Constraint 478 792 4.8668 6.0835 12.1671 0.0053 Constraint 459 719 5.5604 6.9505 13.9009 0.0053 Constraint 727 808 5.6789 7.0986 14.1972 0.0053 Constraint 238 317 4.6578 5.8222 11.6445 0.0053 Constraint 238 309 4.6758 5.8448 11.6896 0.0053 Constraint 232 309 5.9567 7.4459 14.8917 0.0053 Constraint 208 326 3.0345 3.7932 7.5864 0.0053 Constraint 108 220 5.4672 6.8340 13.6680 0.0053 Constraint 108 208 4.4346 5.5432 11.0864 0.0053 Constraint 108 199 5.4445 6.8056 13.6112 0.0053 Constraint 627 698 5.2811 6.6014 13.2027 0.0050 Constraint 597 711 6.0045 7.5056 15.0111 0.0050 Constraint 590 711 6.0827 7.6034 15.2067 0.0050 Constraint 519 719 5.3191 6.6489 13.2978 0.0050 Constraint 500 650 6.2133 7.7666 15.5332 0.0050 Constraint 493 751 4.1538 5.1923 10.3846 0.0050 Constraint 486 776 5.6041 7.0051 14.0102 0.0050 Constraint 486 751 3.9025 4.8781 9.7562 0.0050 Constraint 471 784 4.7213 5.9016 11.8033 0.0050 Constraint 459 761 4.2926 5.3657 10.7315 0.0050 Constraint 445 792 4.5911 5.7389 11.4777 0.0050 Constraint 445 761 4.3198 5.3997 10.7995 0.0050 Constraint 430 784 5.6041 7.0051 14.0103 0.0050 Constraint 89 220 6.3905 7.9881 15.9762 0.0046 Constraint 61 621 6.2145 7.7682 15.5363 0.0046 Constraint 39 621 6.1976 7.7470 15.4940 0.0046 Constraint 827 1026 6.2658 7.8323 15.6645 0.0043 Constraint 822 1026 6.1438 7.6798 15.3596 0.0043 Constraint 801 951 5.1897 6.4871 12.9742 0.0043 Constraint 776 840 4.4992 5.6240 11.2479 0.0043 Constraint 768 840 5.4632 6.8290 13.6579 0.0043 Constraint 743 822 5.8752 7.3440 14.6879 0.0043 Constraint 719 822 6.1917 7.7396 15.4792 0.0043 Constraint 674 872 6.3365 7.9206 15.8412 0.0043 Constraint 633 706 5.9777 7.4722 14.9443 0.0043 Constraint 603 792 6.3871 7.9839 15.9678 0.0043 Constraint 603 682 5.7838 7.2298 14.4596 0.0043 Constraint 603 674 4.5096 5.6370 11.2739 0.0043 Constraint 597 698 4.1851 5.2313 10.4627 0.0043 Constraint 597 690 5.7473 7.1842 14.3683 0.0043 Constraint 567 698 5.2438 6.5548 13.1095 0.0043 Constraint 539 743 4.4756 5.5945 11.1890 0.0043 Constraint 437 519 6.0593 7.5742 15.1484 0.0043 Constraint 430 519 4.7533 5.9416 11.8832 0.0043 Constraint 419 519 6.1636 7.7045 15.4091 0.0043 Constraint 419 500 5.2285 6.5356 13.0712 0.0043 Constraint 411 493 6.2540 7.8175 15.6351 0.0043 Constraint 396 659 5.9334 7.4168 14.8335 0.0043 Constraint 352 603 5.5638 6.9548 13.9095 0.0043 Constraint 352 597 5.3777 6.7222 13.4443 0.0043 Constraint 345 597 4.8508 6.0635 12.1270 0.0043 Constraint 345 493 4.2532 5.3165 10.6331 0.0043 Constraint 337 603 5.1649 6.4562 12.9123 0.0043 Constraint 337 597 5.1676 6.4595 12.9190 0.0043 Constraint 309 603 4.4320 5.5400 11.0800 0.0043 Constraint 309 597 4.4187 5.5234 11.0468 0.0043 Constraint 199 309 5.9307 7.4134 14.8267 0.0043 Constraint 199 286 4.1252 5.1565 10.3130 0.0043 Constraint 191 277 4.9302 6.1628 12.3256 0.0043 Constraint 173 309 6.2403 7.8004 15.6008 0.0043 Constraint 165 309 4.9912 6.2391 12.4781 0.0043 Constraint 165 277 3.2964 4.1205 8.2409 0.0043 Constraint 165 253 5.5216 6.9019 13.8039 0.0043 Constraint 165 247 6.0018 7.5023 15.0046 0.0043 Constraint 157 419 5.6579 7.0723 14.1446 0.0043 Constraint 157 388 4.6016 5.7520 11.5039 0.0043 Constraint 143 574 4.0006 5.0008 10.0016 0.0043 Constraint 143 253 5.9412 7.4265 14.8529 0.0043 Constraint 143 247 5.9695 7.4619 14.9238 0.0043 Constraint 136 597 6.3537 7.9422 15.8843 0.0043 Constraint 136 581 3.5505 4.4381 8.8762 0.0043 Constraint 136 574 3.8507 4.8133 9.6266 0.0043 Constraint 136 396 5.3264 6.6580 13.3161 0.0043 Constraint 136 388 5.7142 7.1427 14.2854 0.0043 Constraint 128 581 6.2697 7.8371 15.6742 0.0043 Constraint 128 574 4.0315 5.0394 10.0787 0.0043 Constraint 128 567 3.8274 4.7842 9.5685 0.0043 Constraint 122 581 5.7998 7.2498 14.4996 0.0043 Constraint 122 567 5.3852 6.7315 13.4629 0.0043 Constraint 122 560 4.2034 5.2543 10.5086 0.0043 Constraint 122 552 5.3098 6.6372 13.2744 0.0043 Constraint 122 547 4.6308 5.7885 11.5769 0.0043 Constraint 122 430 6.0167 7.5208 15.0417 0.0043 Constraint 122 419 4.4866 5.6083 11.2166 0.0043 Constraint 117 567 5.1326 6.4157 12.8314 0.0043 Constraint 117 552 4.2920 5.3651 10.7301 0.0043 Constraint 117 547 6.3978 7.9972 15.9944 0.0043 Constraint 108 552 5.5160 6.8950 13.7901 0.0043 Constraint 108 547 3.8122 4.7653 9.5305 0.0043 Constraint 108 539 6.1657 7.7071 15.4142 0.0043 Constraint 108 519 4.7495 5.9369 11.8739 0.0043 Constraint 108 510 4.3377 5.4221 10.8442 0.0043 Constraint 101 552 4.7254 5.9068 11.8135 0.0043 Constraint 101 547 4.4479 5.5598 11.1197 0.0043 Constraint 101 539 3.2444 4.0554 8.1109 0.0043 Constraint 101 531 4.8011 6.0014 12.0028 0.0043 Constraint 95 531 6.0358 7.5448 15.0896 0.0043 Constraint 61 539 5.4185 6.7731 13.5461 0.0043 Constraint 39 552 4.6676 5.8345 11.6691 0.0043 Constraint 39 117 3.5938 4.4923 8.9845 0.0043 Constraint 39 108 5.7672 7.2090 14.4181 0.0043 Constraint 31 552 4.6659 5.8324 11.6647 0.0043 Constraint 31 101 6.3185 7.8981 15.7962 0.0043 Constraint 574 682 4.8176 6.0220 12.0440 0.0041 Constraint 574 674 5.8014 7.2518 14.5036 0.0041 Constraint 574 667 4.2237 5.2796 10.5592 0.0041 Constraint 567 682 5.6593 7.0741 14.1483 0.0041 Constraint 567 674 4.9230 6.1538 12.3076 0.0041 Constraint 567 667 6.0387 7.5484 15.0968 0.0041 Constraint 560 674 4.8612 6.0765 12.1531 0.0041 Constraint 560 667 4.3714 5.4642 10.9284 0.0041 Constraint 552 667 5.6248 7.0310 14.0620 0.0041 Constraint 539 690 6.3992 7.9991 15.9981 0.0041 Constraint 539 667 6.1136 7.6419 15.2839 0.0041 Constraint 445 519 6.3716 7.9645 15.9291 0.0041 Constraint 277 849 3.6212 4.5265 9.0529 0.0041 Constraint 270 352 6.3133 7.8916 15.7832 0.0041 Constraint 505 590 4.4013 5.5017 11.0034 0.0040 Constraint 486 597 6.2117 7.7647 15.5293 0.0040 Constraint 459 603 6.2530 7.8163 15.6326 0.0040 Constraint 445 603 5.0683 6.3354 12.6708 0.0040 Constraint 711 960 6.3213 7.9016 15.8032 0.0039 Constraint 711 951 6.3942 7.9928 15.9856 0.0039 Constraint 706 801 5.6492 7.0615 14.1230 0.0039 Constraint 706 784 6.3454 7.9318 15.8636 0.0039 Constraint 706 776 4.3438 5.4297 10.8594 0.0039 Constraint 698 972 6.1893 7.7366 15.4732 0.0039 Constraint 698 951 6.0864 7.6080 15.2160 0.0039 Constraint 698 792 5.3631 6.7039 13.4079 0.0039 Constraint 698 784 4.9941 6.2426 12.4852 0.0039 Constraint 698 776 5.5357 6.9196 13.8392 0.0039 Constraint 690 784 5.7943 7.2428 14.4857 0.0039 Constraint 690 776 3.6014 4.5018 9.0036 0.0039 Constraint 682 784 4.0708 5.0885 10.1771 0.0039 Constraint 682 776 3.1964 3.9954 7.9909 0.0039 Constraint 650 751 5.7376 7.1721 14.3441 0.0039 Constraint 641 751 3.9418 4.9273 9.8545 0.0039 Constraint 641 711 4.5688 5.7110 11.4220 0.0039 Constraint 614 751 5.1211 6.4014 12.8028 0.0039 Constraint 603 751 5.7180 7.1475 14.2949 0.0039 Constraint 590 776 4.7371 5.9214 11.8428 0.0039 Constraint 574 706 5.2083 6.5104 13.0208 0.0039 Constraint 539 627 5.0576 6.3220 12.6441 0.0039 Constraint 531 627 6.3405 7.9256 15.8513 0.0039 Constraint 437 539 4.2920 5.3650 10.7300 0.0039 Constraint 430 539 4.3391 5.4239 10.8477 0.0039 Constraint 345 633 6.1398 7.6747 15.3494 0.0039 Constraint 309 519 3.0160 3.7701 7.5401 0.0039 Constraint 294 574 3.1607 3.9509 7.9018 0.0039 Constraint 270 590 5.4310 6.7887 13.5774 0.0039 Constraint 270 574 5.2340 6.5425 13.0851 0.0039 Constraint 199 317 6.3380 7.9225 15.8450 0.0039 Constraint 191 396 6.3740 7.9675 15.9349 0.0039 Constraint 191 317 5.8367 7.2959 14.5918 0.0039 Constraint 184 317 5.8191 7.2739 14.5479 0.0039 Constraint 184 303 6.1729 7.7162 15.4324 0.0039 Constraint 184 277 4.5609 5.7011 11.4023 0.0039 Constraint 173 345 4.6108 5.7635 11.5270 0.0039 Constraint 173 337 5.5708 6.9635 13.9269 0.0039 Constraint 143 641 6.0339 7.5423 15.0847 0.0039 Constraint 136 641 3.6332 4.5415 9.0830 0.0039 Constraint 128 641 4.5848 5.7310 11.4620 0.0039 Constraint 122 253 6.2417 7.8022 15.6043 0.0039 Constraint 117 345 5.1428 6.4285 12.8570 0.0039 Constraint 108 345 5.9085 7.3856 14.7712 0.0039 Constraint 108 326 5.6871 7.1088 14.2176 0.0039 Constraint 108 317 4.7243 5.9054 11.8107 0.0039 Constraint 101 337 6.2930 7.8662 15.7324 0.0039 Constraint 827 972 5.0580 6.3225 12.6451 0.0038 Constraint 690 919 5.1844 6.4805 12.9610 0.0038 Constraint 650 808 4.3282 5.4103 10.8206 0.0038 Constraint 641 951 6.0665 7.5831 15.1663 0.0038 Constraint 641 911 6.2528 7.8160 15.6320 0.0038 Constraint 641 901 5.1919 6.4898 12.9797 0.0038 Constraint 641 840 6.0793 7.5991 15.1982 0.0038 Constraint 911 1033 5.3325 6.6656 13.3312 0.0037 Constraint 751 872 6.3624 7.9530 15.9060 0.0037 Constraint 614 972 3.6484 4.5605 9.1211 0.0037 Constraint 614 960 3.8348 4.7935 9.5869 0.0037 Constraint 614 943 6.0517 7.5646 15.1292 0.0037 Constraint 603 972 4.7892 5.9865 11.9729 0.0037 Constraint 597 857 5.6408 7.0510 14.1021 0.0037 Constraint 597 849 4.0705 5.0881 10.1762 0.0037 Constraint 597 840 5.8990 7.3738 14.7476 0.0037 Constraint 597 751 5.6904 7.1130 14.2260 0.0037 Constraint 590 849 6.2405 7.8007 15.6013 0.0037 Constraint 581 840 5.8925 7.3656 14.7311 0.0037 Constraint 581 827 5.9788 7.4736 14.9471 0.0037 Constraint 574 840 5.7389 7.1736 14.3471 0.0037 Constraint 574 827 3.2709 4.0887 8.1774 0.0037 Constraint 574 822 5.3194 6.6493 13.2985 0.0037 Constraint 574 814 5.4783 6.8479 13.6958 0.0037 Constraint 567 827 5.3499 6.6874 13.3748 0.0037 Constraint 567 822 4.0908 5.1135 10.2270 0.0037 Constraint 567 814 5.5077 6.8847 13.7693 0.0037 Constraint 560 814 4.6824 5.8529 11.7059 0.0037 Constraint 552 814 3.8223 4.7779 9.5558 0.0037 Constraint 552 808 2.8755 3.5944 7.1887 0.0037 Constraint 552 801 3.9083 4.8854 9.7709 0.0037 Constraint 552 776 5.7636 7.2045 14.4089 0.0037 Constraint 547 808 6.2884 7.8605 15.7209 0.0037 Constraint 510 581 4.0676 5.0845 10.1689 0.0037 Constraint 471 547 5.5780 6.9725 13.9449 0.0037 Constraint 471 539 5.0870 6.3587 12.7175 0.0037 Constraint 445 531 6.0411 7.5514 15.1028 0.0037 Constraint 437 567 5.8361 7.2952 14.5903 0.0037 Constraint 411 567 4.4034 5.5042 11.0084 0.0037 Constraint 404 547 5.5772 6.9715 13.9430 0.0037 Constraint 404 531 5.8364 7.2955 14.5910 0.0037 Constraint 396 574 3.5550 4.4438 8.8876 0.0037 Constraint 396 567 4.5498 5.6873 11.3746 0.0037 Constraint 372 486 5.8393 7.2992 14.5984 0.0037 Constraint 326 627 5.2517 6.5646 13.1291 0.0037 Constraint 317 627 1.9798 2.4747 4.9495 0.0037 Constraint 317 621 6.1852 7.7315 15.4631 0.0037 Constraint 294 627 6.1138 7.6423 15.2846 0.0037 Constraint 840 995 6.0602 7.5753 15.1505 0.0034 Constraint 727 995 5.2716 6.5895 13.1790 0.0034 Constraint 597 943 4.8594 6.0742 12.1484 0.0034 Constraint 560 650 3.8328 4.7910 9.5820 0.0034 Constraint 380 603 4.4573 5.5717 11.1433 0.0034 Constraint 380 597 5.8033 7.2541 14.5081 0.0034 Constraint 372 597 4.6694 5.8367 11.6734 0.0034 Constraint 361 597 5.6042 7.0052 14.0104 0.0034 Constraint 101 184 5.1831 6.4789 12.9578 0.0034 Constraint 95 199 6.1158 7.6447 15.2895 0.0034 Constraint 95 184 4.5154 5.6443 11.2885 0.0034 Constraint 95 173 5.6992 7.1240 14.2479 0.0034 Constraint 89 199 5.9411 7.4264 14.8529 0.0034 Constraint 89 191 4.3676 5.4594 10.9189 0.0034 Constraint 89 184 5.6228 7.0284 14.0569 0.0034 Constraint 89 173 4.9542 6.1927 12.3854 0.0034 Constraint 80 238 5.8435 7.3043 14.6087 0.0034 Constraint 80 199 2.9800 3.7250 7.4499 0.0034 Constraint 80 191 5.1487 6.4358 12.8717 0.0034 Constraint 72 238 4.2823 5.3529 10.7058 0.0034 Constraint 72 220 4.9308 6.1635 12.3270 0.0034 Constraint 72 208 5.1718 6.4648 12.9296 0.0034 Constraint 72 199 5.1538 6.4422 12.8845 0.0034 Constraint 72 191 3.8332 4.7915 9.5830 0.0034 Constraint 61 262 5.1521 6.4401 12.8802 0.0034 Constraint 61 238 3.5289 4.4112 8.8223 0.0034 Constraint 61 232 4.8391 6.0489 12.0978 0.0034 Constraint 61 220 5.0976 6.3720 12.7441 0.0034 Constraint 61 208 6.3026 7.8782 15.7564 0.0034 Constraint 53 238 6.1119 7.6399 15.2797 0.0034 Constraint 53 232 4.5103 5.6379 11.2758 0.0034 Constraint 53 220 4.5365 5.6707 11.3413 0.0034 Constraint 539 659 5.7251 7.1563 14.3127 0.0032 Constraint 505 603 4.4999 5.6249 11.2498 0.0032 Constraint 486 659 6.2117 7.7647 15.5293 0.0032 Constraint 486 603 6.3448 7.9310 15.8620 0.0032 Constraint 478 667 5.1718 6.4647 12.9294 0.0032 Constraint 459 667 6.2664 7.8330 15.6661 0.0032 Constraint 445 667 5.0765 6.3457 12.6913 0.0032 Constraint 567 690 4.7644 5.9555 11.9110 0.0032 Constraint 510 743 4.5033 5.6292 11.2583 0.0032 Constraint 505 743 6.0890 7.6113 15.2226 0.0032 Constraint 430 590 6.1803 7.7254 15.4508 0.0032 Constraint 361 466 3.3772 4.2215 8.4430 0.0032 Constraint 361 459 3.4251 4.2814 8.5628 0.0032 Constraint 361 445 4.1734 5.2168 10.4335 0.0032 Constraint 352 493 5.8826 7.3532 14.7064 0.0032 Constraint 352 445 6.3327 7.9158 15.8316 0.0032 Constraint 317 471 4.2084 5.2605 10.5210 0.0032 Constraint 303 560 4.7053 5.8816 11.7632 0.0032 Constraint 303 471 3.8630 4.8288 9.6576 0.0032 Constraint 303 466 6.1905 7.7381 15.4762 0.0032 Constraint 380 478 5.2723 6.5903 13.1807 0.0032 Constraint 372 445 6.1256 7.6569 15.3139 0.0032 Constraint 294 396 4.4327 5.5409 11.0818 0.0032 Constraint 294 372 6.0329 7.5412 15.0824 0.0032 Constraint 199 404 5.3894 6.7367 13.4734 0.0032 Constraint 199 396 5.2163 6.5204 13.0408 0.0032 Constraint 199 294 5.2079 6.5099 13.0199 0.0032 Constraint 191 294 5.5835 6.9793 13.9587 0.0032 Constraint 184 326 6.0181 7.5227 15.0453 0.0032 Constraint 184 294 3.2852 4.1066 8.2131 0.0032 Constraint 165 326 5.4094 6.7617 13.5234 0.0032 Constraint 61 173 6.2122 7.7652 15.5304 0.0032 Constraint 61 157 5.6186 7.0232 14.0464 0.0032 Constraint 519 597 6.3113 7.8891 15.7781 0.0030 Constraint 404 510 6.3626 7.9532 15.9064 0.0030 Constraint 404 505 4.0865 5.1081 10.2162 0.0030 Constraint 396 510 6.0148 7.5185 15.0371 0.0030 Constraint 396 505 6.3355 7.9194 15.8388 0.0030 Constraint 388 547 5.7013 7.1266 14.2532 0.0030 Constraint 388 539 5.1117 6.3896 12.7792 0.0030 Constraint 380 751 5.4012 6.7515 13.5029 0.0030 Constraint 372 743 6.2924 7.8655 15.7310 0.0030 Constraint 352 751 4.9226 6.1532 12.3064 0.0030 Constraint 345 459 3.9553 4.9442 9.8883 0.0030 Constraint 326 437 4.2661 5.3326 10.6652 0.0030 Constraint 326 430 4.5696 5.7120 11.4241 0.0030 Constraint 317 547 5.9472 7.4340 14.8680 0.0030 Constraint 317 430 5.6829 7.1037 14.2074 0.0030 Constraint 303 547 6.1356 7.6695 15.3389 0.0030 Constraint 303 539 6.1526 7.6907 15.3815 0.0030 Constraint 294 560 4.0588 5.0735 10.1469 0.0030 Constraint 294 547 3.9398 4.9247 9.8495 0.0030 Constraint 294 388 5.5226 6.9032 13.8065 0.0030 Constraint 294 380 4.4224 5.5280 11.0561 0.0030 Constraint 286 560 4.7158 5.8948 11.7895 0.0030 Constraint 286 547 5.0339 6.2924 12.5848 0.0030 Constraint 286 380 6.2439 7.8049 15.6098 0.0030 Constraint 277 539 6.2686 7.8358 15.6715 0.0030 Constraint 270 547 4.1504 5.1880 10.3761 0.0030 Constraint 270 531 5.9766 7.4708 14.9415 0.0030 Constraint 270 430 4.3751 5.4689 10.9377 0.0030 Constraint 262 539 4.5948 5.7435 11.4870 0.0030 Constraint 262 531 4.8114 6.0143 12.0285 0.0030 Constraint 262 519 4.0902 5.1128 10.2256 0.0030 Constraint 262 388 5.8301 7.2876 14.5753 0.0030 Constraint 253 531 5.4622 6.8278 13.6556 0.0030 Constraint 253 380 4.0453 5.0566 10.1133 0.0030 Constraint 253 361 5.7611 7.2014 14.4027 0.0030 Constraint 247 784 6.3978 7.9973 15.9946 0.0030 Constraint 247 531 4.3884 5.4855 10.9709 0.0030 Constraint 247 404 4.3719 5.4648 10.9297 0.0030 Constraint 247 396 5.8886 7.3608 14.7215 0.0030 Constraint 247 380 4.9890 6.2362 12.4724 0.0030 Constraint 238 784 3.5901 4.4876 8.9752 0.0030 Constraint 238 776 4.4816 5.6021 11.2041 0.0030 Constraint 238 471 5.4778 6.8473 13.6946 0.0030 Constraint 238 437 6.1609 7.7011 15.4023 0.0030 Constraint 238 430 4.6077 5.7597 11.5193 0.0030 Constraint 238 404 6.0809 7.6011 15.2021 0.0030 Constraint 238 396 4.8613 6.0766 12.1532 0.0030 Constraint 238 388 5.8980 7.3726 14.7451 0.0030 Constraint 238 380 4.6328 5.7910 11.5820 0.0030 Constraint 232 776 4.9625 6.2031 12.4063 0.0030 Constraint 232 471 6.2440 7.8050 15.6101 0.0030 Constraint 232 430 4.2188 5.2735 10.5469 0.0030 Constraint 232 404 4.2575 5.3219 10.6439 0.0030 Constraint 232 396 6.0642 7.5802 15.1604 0.0030 Constraint 232 345 6.3084 7.8854 15.7709 0.0030 Constraint 220 801 5.6440 7.0551 14.1101 0.0030 Constraint 220 471 6.2589 7.8236 15.6471 0.0030 Constraint 220 372 6.2087 7.7609 15.5218 0.0030 Constraint 220 337 4.3576 5.4470 10.8940 0.0030 Constraint 208 801 5.6969 7.1211 14.2422 0.0030 Constraint 208 776 4.2557 5.3196 10.6393 0.0030 Constraint 199 801 4.2175 5.2719 10.5438 0.0030 Constraint 191 574 5.2045 6.5056 13.0113 0.0030 Constraint 191 430 4.3551 5.4439 10.8878 0.0030 Constraint 184 603 6.1313 7.6642 15.3283 0.0030 Constraint 184 597 6.3139 7.8924 15.7847 0.0030 Constraint 184 574 5.1721 6.4651 12.9302 0.0030 Constraint 184 430 6.0661 7.5826 15.1651 0.0030 Constraint 173 801 3.6838 4.6048 9.2095 0.0030 Constraint 173 597 5.1745 6.4682 12.9363 0.0030 Constraint 173 581 5.5223 6.9029 13.8058 0.0030 Constraint 173 574 5.9525 7.4406 14.8812 0.0030 Constraint 173 430 4.1692 5.2115 10.4230 0.0030 Constraint 165 430 5.3580 6.6975 13.3949 0.0030 Constraint 157 430 4.6542 5.8177 11.6354 0.0030 Constraint 149 751 4.8813 6.1016 12.2033 0.0030 Constraint 149 603 6.0654 7.5818 15.1636 0.0030 Constraint 149 581 5.1625 6.4531 12.9063 0.0030 Constraint 149 471 6.2358 7.7948 15.5896 0.0030 Constraint 149 430 4.2977 5.3722 10.7444 0.0030 Constraint 143 590 5.3656 6.7070 13.4140 0.0030 Constraint 143 581 6.1243 7.6554 15.3108 0.0030 Constraint 89 743 5.8594 7.3243 14.6485 0.0030 Constraint 581 674 5.4966 6.8708 13.7416 0.0029 Constraint 519 706 6.2001 7.7502 15.5003 0.0029 Constraint 505 621 6.1919 7.7399 15.4798 0.0029 Constraint 143 980 3.9994 4.9993 9.9985 0.0029 Constraint 136 987 5.8328 7.2910 14.5821 0.0029 Constraint 136 980 6.0281 7.5351 15.0702 0.0029 Constraint 128 1043 5.5040 6.8800 13.7600 0.0029 Constraint 128 1003 6.2514 7.8143 15.6285 0.0029 Constraint 128 995 3.8742 4.8428 9.6856 0.0029 Constraint 128 987 6.0212 7.5265 15.0531 0.0029 Constraint 128 980 3.3644 4.2055 8.4110 0.0029 Constraint 122 1011 6.2601 7.8251 15.6502 0.0029 Constraint 122 1003 4.2396 5.2995 10.5991 0.0029 Constraint 122 995 6.0781 7.5976 15.1952 0.0029 Constraint 80 1033 4.6485 5.8107 11.6213 0.0029 Constraint 72 1033 4.9538 6.1923 12.3846 0.0029 Constraint 53 1033 3.6130 4.5163 9.0326 0.0029 Constraint 801 919 4.8116 6.0145 12.0290 0.0028 Constraint 706 822 5.9417 7.4272 14.8543 0.0028 Constraint 706 814 5.7555 7.1943 14.3886 0.0028 Constraint 493 931 6.3751 7.9689 15.9379 0.0028 Constraint 493 919 4.3549 5.4436 10.8873 0.0028 Constraint 493 911 6.1126 7.6407 15.2814 0.0028 Constraint 493 901 6.2097 7.7622 15.5243 0.0028 Constraint 493 840 5.6333 7.0416 14.0833 0.0028 Constraint 493 822 4.5297 5.6621 11.3242 0.0028 Constraint 486 951 4.5656 5.7070 11.4139 0.0028 Constraint 486 943 6.0073 7.5092 15.0184 0.0028 Constraint 486 931 4.3298 5.4122 10.8245 0.0028 Constraint 486 919 5.3791 6.7239 13.4478 0.0028 Constraint 486 822 6.1515 7.6893 15.3787 0.0028 Constraint 478 951 6.3482 7.9352 15.8704 0.0028 Constraint 478 943 4.8841 6.1051 12.2102 0.0028 Constraint 478 931 6.0316 7.5395 15.0789 0.0028 Constraint 478 919 4.4989 5.6237 11.2474 0.0028 Constraint 478 822 3.6684 4.5855 9.1710 0.0028 Constraint 478 560 5.4643 6.8304 13.6607 0.0028 Constraint 471 960 6.2346 7.7932 15.5865 0.0028 Constraint 471 951 4.0790 5.0988 10.1975 0.0028 Constraint 471 943 6.0141 7.5176 15.0353 0.0028 Constraint 466 960 4.7086 5.8858 11.7715 0.0028 Constraint 466 951 4.9514 6.1893 12.3785 0.0028 Constraint 466 943 4.4068 5.5085 11.0170 0.0028 Constraint 466 719 4.0124 5.0154 10.0309 0.0028 Constraint 466 711 6.3427 7.9284 15.8568 0.0028 Constraint 466 560 3.2372 4.0465 8.0930 0.0028 Constraint 466 552 4.6407 5.8008 11.6016 0.0028 Constraint 459 980 5.1562 6.4452 12.8904 0.0028 Constraint 459 960 6.3314 7.9142 15.8284 0.0028 Constraint 459 711 4.2324 5.2905 10.5810 0.0028 Constraint 459 567 4.3674 5.4593 10.9186 0.0028 Constraint 459 560 4.9309 6.1637 12.3273 0.0028 Constraint 445 719 5.4190 6.7738 13.5476 0.0028 Constraint 445 552 5.2328 6.5410 13.0820 0.0028 Constraint 437 960 5.6215 7.0268 14.0537 0.0028 Constraint 430 960 3.7394 4.6742 9.3484 0.0028 Constraint 430 951 6.0677 7.5846 15.1692 0.0028 Constraint 430 943 5.2511 6.5639 13.1278 0.0028 Constraint 411 547 6.1235 7.6544 15.3088 0.0028 Constraint 404 768 4.6107 5.7634 11.5268 0.0028 Constraint 396 943 4.5374 5.6718 11.3435 0.0028 Constraint 380 768 4.6763 5.8454 11.6908 0.0028 Constraint 380 743 4.3602 5.4502 10.9005 0.0028 Constraint 380 552 5.8560 7.3200 14.6400 0.0028 Constraint 380 539 4.1389 5.1736 10.3471 0.0028 Constraint 380 519 5.4457 6.8071 13.6143 0.0028 Constraint 380 510 5.2982 6.6228 13.2456 0.0028 Constraint 372 801 5.2187 6.5234 13.0468 0.0028 Constraint 372 768 5.0155 6.2694 12.5387 0.0028 Constraint 372 519 6.0664 7.5830 15.1660 0.0028 Constraint 345 776 4.3708 5.4635 10.9270 0.0028 Constraint 345 768 6.0159 7.5199 15.0398 0.0028 Constraint 345 519 5.5975 6.9968 13.9937 0.0028 Constraint 345 510 4.7553 5.9441 11.8882 0.0028 Constraint 326 519 5.1768 6.4710 12.9420 0.0028 Constraint 326 510 4.4861 5.6076 11.2152 0.0028 Constraint 317 510 5.1095 6.3868 12.7737 0.0028 Constraint 317 404 4.2716 5.3395 10.6790 0.0028 Constraint 277 430 6.2064 7.7581 15.5161 0.0028 Constraint 567 641 6.1175 7.6469 15.2939 0.0027 Constraint 505 650 6.2993 7.8741 15.7483 0.0027 Constraint 493 590 4.1047 5.1309 10.2618 0.0027 Constraint 493 574 3.2121 4.0152 8.0304 0.0027 Constraint 493 567 3.9148 4.8935 9.7869 0.0027 Constraint 486 581 4.9868 6.2336 12.4671 0.0027 Constraint 486 574 5.5092 6.8866 13.7731 0.0027 Constraint 486 567 6.0390 7.5488 15.0976 0.0027 Constraint 486 560 3.9601 4.9501 9.9002 0.0027 Constraint 437 560 5.4549 6.8187 13.6373 0.0027 Constraint 396 633 4.9489 6.1862 12.3723 0.0027 Constraint 380 621 3.8999 4.8749 9.7498 0.0027 Constraint 380 614 4.2980 5.3725 10.7450 0.0027 Constraint 372 627 4.9949 6.2436 12.4872 0.0027 Constraint 372 621 6.0596 7.5745 15.1491 0.0027 Constraint 372 614 4.3122 5.3902 10.7805 0.0027 Constraint 361 641 5.2493 6.5616 13.1233 0.0027 Constraint 361 633 3.9828 4.9785 9.9570 0.0027 Constraint 361 627 5.1556 6.4445 12.8889 0.0027 Constraint 352 581 5.4795 6.8493 13.6987 0.0027 Constraint 352 574 6.1973 7.7466 15.4932 0.0027 Constraint 352 567 6.3870 7.9838 15.9675 0.0027 Constraint 352 560 3.5367 4.4209 8.8417 0.0027 Constraint 352 437 5.1711 6.4639 12.9277 0.0027 Constraint 345 437 5.8161 7.2702 14.5404 0.0027 Constraint 345 430 4.6188 5.7735 11.5470 0.0027 Constraint 345 419 5.8708 7.3385 14.6771 0.0027 Constraint 326 486 6.3182 7.8977 15.7954 0.0027 Constraint 326 459 4.2028 5.2535 10.5070 0.0027 Constraint 326 419 4.7429 5.9286 11.8571 0.0027 Constraint 317 459 4.9576 6.1970 12.3940 0.0027 Constraint 317 419 6.0179 7.5224 15.0447 0.0027 Constraint 191 471 5.2040 6.5050 13.0099 0.0027 Constraint 614 735 6.1248 7.6560 15.3121 0.0025 Constraint 590 743 6.1801 7.7251 15.4503 0.0025 Constraint 590 735 5.4487 6.8109 13.6219 0.0025 Constraint 590 719 5.8656 7.3320 14.6640 0.0025 Constraint 590 706 5.8187 7.2734 14.5468 0.0025 Constraint 581 743 5.9865 7.4832 14.9663 0.0025 Constraint 581 719 5.7450 7.1813 14.3626 0.0025 Constraint 581 711 6.1056 7.6319 15.2639 0.0025 Constraint 519 711 5.1586 6.4482 12.8965 0.0025 Constraint 519 667 4.0743 5.0929 10.1858 0.0025 Constraint 500 667 4.0253 5.0316 10.0632 0.0025 Constraint 493 776 5.1426 6.4283 12.8565 0.0025 Constraint 493 768 5.1426 6.4283 12.8565 0.0025 Constraint 486 784 5.3978 6.7472 13.4945 0.0025 Constraint 486 768 5.8103 7.2629 14.5258 0.0025 Constraint 486 761 5.0381 6.2976 12.5952 0.0025 Constraint 486 743 4.4848 5.6060 11.2121 0.0025 Constraint 478 784 2.8650 3.5812 7.1625 0.0025 Constraint 478 761 3.1046 3.8807 7.7615 0.0025 Constraint 459 751 4.2900 5.3625 10.7250 0.0025 Constraint 430 776 5.6041 7.0051 14.0103 0.0025 Constraint 1043 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1026 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1026 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1019 0.8000 1.0000 2.0000 0.0000 Constraint 1003 1051 0.8000 1.0000 2.0000 0.0000 Constraint 1003 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1003 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1003 1026 0.8000 1.0000 2.0000 0.0000 Constraint 1003 1019 0.8000 1.0000 2.0000 0.0000 Constraint 1003 1011 0.8000 1.0000 2.0000 0.0000 Constraint 995 1051 0.8000 1.0000 2.0000 0.0000 Constraint 995 1043 0.8000 1.0000 2.0000 0.0000 Constraint 995 1033 0.8000 1.0000 2.0000 0.0000 Constraint 995 1026 0.8000 1.0000 2.0000 0.0000 Constraint 995 1019 0.8000 1.0000 2.0000 0.0000 Constraint 995 1011 0.8000 1.0000 2.0000 0.0000 Constraint 995 1003 0.8000 1.0000 2.0000 0.0000 Constraint 987 1051 0.8000 1.0000 2.0000 0.0000 Constraint 987 1043 0.8000 1.0000 2.0000 0.0000 Constraint 987 1033 0.8000 1.0000 2.0000 0.0000 Constraint 987 1026 0.8000 1.0000 2.0000 0.0000 Constraint 987 1019 0.8000 1.0000 2.0000 0.0000 Constraint 987 1011 0.8000 1.0000 2.0000 0.0000 Constraint 987 1003 0.8000 1.0000 2.0000 0.0000 Constraint 987 995 0.8000 1.0000 2.0000 0.0000 Constraint 980 1051 0.8000 1.0000 2.0000 0.0000 Constraint 980 1043 0.8000 1.0000 2.0000 0.0000 Constraint 980 1033 0.8000 1.0000 2.0000 0.0000 Constraint 980 1026 0.8000 1.0000 2.0000 0.0000 Constraint 980 1019 0.8000 1.0000 2.0000 0.0000 Constraint 980 1011 0.8000 1.0000 2.0000 0.0000 Constraint 980 1003 0.8000 1.0000 2.0000 0.0000 Constraint 980 995 0.8000 1.0000 2.0000 0.0000 Constraint 980 987 0.8000 1.0000 2.0000 0.0000 Constraint 972 1051 0.8000 1.0000 2.0000 0.0000 Constraint 972 1033 0.8000 1.0000 2.0000 0.0000 Constraint 972 1026 0.8000 1.0000 2.0000 0.0000 Constraint 972 1019 0.8000 1.0000 2.0000 0.0000 Constraint 972 1011 0.8000 1.0000 2.0000 0.0000 Constraint 972 1003 0.8000 1.0000 2.0000 0.0000 Constraint 972 995 0.8000 1.0000 2.0000 0.0000 Constraint 972 987 0.8000 1.0000 2.0000 0.0000 Constraint 972 980 0.8000 1.0000 2.0000 0.0000 Constraint 960 1051 0.8000 1.0000 2.0000 0.0000 Constraint 960 1043 0.8000 1.0000 2.0000 0.0000 Constraint 960 1033 0.8000 1.0000 2.0000 0.0000 Constraint 960 1019 0.8000 1.0000 2.0000 0.0000 Constraint 960 1011 0.8000 1.0000 2.0000 0.0000 Constraint 960 1003 0.8000 1.0000 2.0000 0.0000 Constraint 960 995 0.8000 1.0000 2.0000 0.0000 Constraint 960 987 0.8000 1.0000 2.0000 0.0000 Constraint 960 980 0.8000 1.0000 2.0000 0.0000 Constraint 960 972 0.8000 1.0000 2.0000 0.0000 Constraint 951 1051 0.8000 1.0000 2.0000 0.0000 Constraint 951 1043 0.8000 1.0000 2.0000 0.0000 Constraint 951 1019 0.8000 1.0000 2.0000 0.0000 Constraint 951 1011 0.8000 1.0000 2.0000 0.0000 Constraint 951 1003 0.8000 1.0000 2.0000 0.0000 Constraint 951 995 0.8000 1.0000 2.0000 0.0000 Constraint 951 987 0.8000 1.0000 2.0000 0.0000 Constraint 951 980 0.8000 1.0000 2.0000 0.0000 Constraint 951 972 0.8000 1.0000 2.0000 0.0000 Constraint 951 960 0.8000 1.0000 2.0000 0.0000 Constraint 943 1003 0.8000 1.0000 2.0000 0.0000 Constraint 943 995 0.8000 1.0000 2.0000 0.0000 Constraint 943 987 0.8000 1.0000 2.0000 0.0000 Constraint 943 980 0.8000 1.0000 2.0000 0.0000 Constraint 943 972 0.8000 1.0000 2.0000 0.0000 Constraint 943 960 0.8000 1.0000 2.0000 0.0000 Constraint 943 951 0.8000 1.0000 2.0000 0.0000 Constraint 931 1051 0.8000 1.0000 2.0000 0.0000 Constraint 931 1043 0.8000 1.0000 2.0000 0.0000 Constraint 931 1033 0.8000 1.0000 2.0000 0.0000 Constraint 931 995 0.8000 1.0000 2.0000 0.0000 Constraint 931 987 0.8000 1.0000 2.0000 0.0000 Constraint 931 980 0.8000 1.0000 2.0000 0.0000 Constraint 931 972 0.8000 1.0000 2.0000 0.0000 Constraint 931 960 0.8000 1.0000 2.0000 0.0000 Constraint 931 951 0.8000 1.0000 2.0000 0.0000 Constraint 931 943 0.8000 1.0000 2.0000 0.0000 Constraint 919 1033 0.8000 1.0000 2.0000 0.0000 Constraint 919 987 0.8000 1.0000 2.0000 0.0000 Constraint 919 980 0.8000 1.0000 2.0000 0.0000 Constraint 919 972 0.8000 1.0000 2.0000 0.0000 Constraint 919 960 0.8000 1.0000 2.0000 0.0000 Constraint 919 951 0.8000 1.0000 2.0000 0.0000 Constraint 919 943 0.8000 1.0000 2.0000 0.0000 Constraint 919 931 0.8000 1.0000 2.0000 0.0000 Constraint 911 1051 0.8000 1.0000 2.0000 0.0000 Constraint 911 1043 0.8000 1.0000 2.0000 0.0000 Constraint 911 995 0.8000 1.0000 2.0000 0.0000 Constraint 911 987 0.8000 1.0000 2.0000 0.0000 Constraint 911 980 0.8000 1.0000 2.0000 0.0000 Constraint 911 972 0.8000 1.0000 2.0000 0.0000 Constraint 911 960 0.8000 1.0000 2.0000 0.0000 Constraint 911 951 0.8000 1.0000 2.0000 0.0000 Constraint 911 943 0.8000 1.0000 2.0000 0.0000 Constraint 911 931 0.8000 1.0000 2.0000 0.0000 Constraint 911 919 0.8000 1.0000 2.0000 0.0000 Constraint 901 1051 0.8000 1.0000 2.0000 0.0000 Constraint 901 1043 0.8000 1.0000 2.0000 0.0000 Constraint 901 1033 0.8000 1.0000 2.0000 0.0000 Constraint 901 995 0.8000 1.0000 2.0000 0.0000 Constraint 901 987 0.8000 1.0000 2.0000 0.0000 Constraint 901 980 0.8000 1.0000 2.0000 0.0000 Constraint 901 972 0.8000 1.0000 2.0000 0.0000 Constraint 901 960 0.8000 1.0000 2.0000 0.0000 Constraint 901 951 0.8000 1.0000 2.0000 0.0000 Constraint 901 943 0.8000 1.0000 2.0000 0.0000 Constraint 901 931 0.8000 1.0000 2.0000 0.0000 Constraint 901 919 0.8000 1.0000 2.0000 0.0000 Constraint 901 911 0.8000 1.0000 2.0000 0.0000 Constraint 891 1051 0.8000 1.0000 2.0000 0.0000 Constraint 891 1043 0.8000 1.0000 2.0000 0.0000 Constraint 891 1003 0.8000 1.0000 2.0000 0.0000 Constraint 891 995 0.8000 1.0000 2.0000 0.0000 Constraint 891 987 0.8000 1.0000 2.0000 0.0000 Constraint 891 980 0.8000 1.0000 2.0000 0.0000 Constraint 891 972 0.8000 1.0000 2.0000 0.0000 Constraint 891 960 0.8000 1.0000 2.0000 0.0000 Constraint 891 951 0.8000 1.0000 2.0000 0.0000 Constraint 891 943 0.8000 1.0000 2.0000 0.0000 Constraint 891 931 0.8000 1.0000 2.0000 0.0000 Constraint 891 919 0.8000 1.0000 2.0000 0.0000 Constraint 891 911 0.8000 1.0000 2.0000 0.0000 Constraint 891 901 0.8000 1.0000 2.0000 0.0000 Constraint 883 1051 0.8000 1.0000 2.0000 0.0000 Constraint 883 1043 0.8000 1.0000 2.0000 0.0000 Constraint 883 1019 0.8000 1.0000 2.0000 0.0000 Constraint 883 1003 0.8000 1.0000 2.0000 0.0000 Constraint 883 995 0.8000 1.0000 2.0000 0.0000 Constraint 883 987 0.8000 1.0000 2.0000 0.0000 Constraint 883 980 0.8000 1.0000 2.0000 0.0000 Constraint 883 972 0.8000 1.0000 2.0000 0.0000 Constraint 883 960 0.8000 1.0000 2.0000 0.0000 Constraint 883 951 0.8000 1.0000 2.0000 0.0000 Constraint 883 943 0.8000 1.0000 2.0000 0.0000 Constraint 883 931 0.8000 1.0000 2.0000 0.0000 Constraint 883 919 0.8000 1.0000 2.0000 0.0000 Constraint 883 911 0.8000 1.0000 2.0000 0.0000 Constraint 883 901 0.8000 1.0000 2.0000 0.0000 Constraint 883 891 0.8000 1.0000 2.0000 0.0000 Constraint 872 1051 0.8000 1.0000 2.0000 0.0000 Constraint 872 1043 0.8000 1.0000 2.0000 0.0000 Constraint 872 1033 0.8000 1.0000 2.0000 0.0000 Constraint 872 1026 0.8000 1.0000 2.0000 0.0000 Constraint 872 1019 0.8000 1.0000 2.0000 0.0000 Constraint 872 1011 0.8000 1.0000 2.0000 0.0000 Constraint 872 1003 0.8000 1.0000 2.0000 0.0000 Constraint 872 995 0.8000 1.0000 2.0000 0.0000 Constraint 872 987 0.8000 1.0000 2.0000 0.0000 Constraint 872 980 0.8000 1.0000 2.0000 0.0000 Constraint 872 972 0.8000 1.0000 2.0000 0.0000 Constraint 872 960 0.8000 1.0000 2.0000 0.0000 Constraint 872 951 0.8000 1.0000 2.0000 0.0000 Constraint 872 943 0.8000 1.0000 2.0000 0.0000 Constraint 872 931 0.8000 1.0000 2.0000 0.0000 Constraint 872 919 0.8000 1.0000 2.0000 0.0000 Constraint 872 911 0.8000 1.0000 2.0000 0.0000 Constraint 872 901 0.8000 1.0000 2.0000 0.0000 Constraint 872 891 0.8000 1.0000 2.0000 0.0000 Constraint 872 883 0.8000 1.0000 2.0000 0.0000 Constraint 866 1051 0.8000 1.0000 2.0000 0.0000 Constraint 866 1043 0.8000 1.0000 2.0000 0.0000 Constraint 866 1019 0.8000 1.0000 2.0000 0.0000 Constraint 866 1003 0.8000 1.0000 2.0000 0.0000 Constraint 866 995 0.8000 1.0000 2.0000 0.0000 Constraint 866 987 0.8000 1.0000 2.0000 0.0000 Constraint 866 980 0.8000 1.0000 2.0000 0.0000 Constraint 866 972 0.8000 1.0000 2.0000 0.0000 Constraint 866 960 0.8000 1.0000 2.0000 0.0000 Constraint 866 951 0.8000 1.0000 2.0000 0.0000 Constraint 866 931 0.8000 1.0000 2.0000 0.0000 Constraint 866 919 0.8000 1.0000 2.0000 0.0000 Constraint 866 911 0.8000 1.0000 2.0000 0.0000 Constraint 866 901 0.8000 1.0000 2.0000 0.0000 Constraint 866 891 0.8000 1.0000 2.0000 0.0000 Constraint 866 883 0.8000 1.0000 2.0000 0.0000 Constraint 866 872 0.8000 1.0000 2.0000 0.0000 Constraint 857 1051 0.8000 1.0000 2.0000 0.0000 Constraint 857 1043 0.8000 1.0000 2.0000 0.0000 Constraint 857 1033 0.8000 1.0000 2.0000 0.0000 Constraint 857 1026 0.8000 1.0000 2.0000 0.0000 Constraint 857 1019 0.8000 1.0000 2.0000 0.0000 Constraint 857 1011 0.8000 1.0000 2.0000 0.0000 Constraint 857 1003 0.8000 1.0000 2.0000 0.0000 Constraint 857 995 0.8000 1.0000 2.0000 0.0000 Constraint 857 987 0.8000 1.0000 2.0000 0.0000 Constraint 857 980 0.8000 1.0000 2.0000 0.0000 Constraint 857 972 0.8000 1.0000 2.0000 0.0000 Constraint 857 960 0.8000 1.0000 2.0000 0.0000 Constraint 857 951 0.8000 1.0000 2.0000 0.0000 Constraint 857 931 0.8000 1.0000 2.0000 0.0000 Constraint 857 919 0.8000 1.0000 2.0000 0.0000 Constraint 857 911 0.8000 1.0000 2.0000 0.0000 Constraint 857 901 0.8000 1.0000 2.0000 0.0000 Constraint 857 891 0.8000 1.0000 2.0000 0.0000 Constraint 857 883 0.8000 1.0000 2.0000 0.0000 Constraint 857 872 0.8000 1.0000 2.0000 0.0000 Constraint 857 866 0.8000 1.0000 2.0000 0.0000 Constraint 849 1043 0.8000 1.0000 2.0000 0.0000 Constraint 849 1033 0.8000 1.0000 2.0000 0.0000 Constraint 849 1003 0.8000 1.0000 2.0000 0.0000 Constraint 849 972 0.8000 1.0000 2.0000 0.0000 Constraint 849 960 0.8000 1.0000 2.0000 0.0000 Constraint 849 911 0.8000 1.0000 2.0000 0.0000 Constraint 849 901 0.8000 1.0000 2.0000 0.0000 Constraint 849 891 0.8000 1.0000 2.0000 0.0000 Constraint 849 883 0.8000 1.0000 2.0000 0.0000 Constraint 849 872 0.8000 1.0000 2.0000 0.0000 Constraint 849 866 0.8000 1.0000 2.0000 0.0000 Constraint 849 857 0.8000 1.0000 2.0000 0.0000 Constraint 840 1051 0.8000 1.0000 2.0000 0.0000 Constraint 840 1043 0.8000 1.0000 2.0000 0.0000 Constraint 840 1033 0.8000 1.0000 2.0000 0.0000 Constraint 840 1026 0.8000 1.0000 2.0000 0.0000 Constraint 840 1019 0.8000 1.0000 2.0000 0.0000 Constraint 840 1003 0.8000 1.0000 2.0000 0.0000 Constraint 840 987 0.8000 1.0000 2.0000 0.0000 Constraint 840 980 0.8000 1.0000 2.0000 0.0000 Constraint 840 972 0.8000 1.0000 2.0000 0.0000 Constraint 840 901 0.8000 1.0000 2.0000 0.0000 Constraint 840 891 0.8000 1.0000 2.0000 0.0000 Constraint 840 883 0.8000 1.0000 2.0000 0.0000 Constraint 840 872 0.8000 1.0000 2.0000 0.0000 Constraint 840 866 0.8000 1.0000 2.0000 0.0000 Constraint 840 857 0.8000 1.0000 2.0000 0.0000 Constraint 840 849 0.8000 1.0000 2.0000 0.0000 Constraint 827 1051 0.8000 1.0000 2.0000 0.0000 Constraint 827 1043 0.8000 1.0000 2.0000 0.0000 Constraint 827 1033 0.8000 1.0000 2.0000 0.0000 Constraint 827 1019 0.8000 1.0000 2.0000 0.0000 Constraint 827 1011 0.8000 1.0000 2.0000 0.0000 Constraint 827 1003 0.8000 1.0000 2.0000 0.0000 Constraint 827 995 0.8000 1.0000 2.0000 0.0000 Constraint 827 987 0.8000 1.0000 2.0000 0.0000 Constraint 827 980 0.8000 1.0000 2.0000 0.0000 Constraint 827 891 0.8000 1.0000 2.0000 0.0000 Constraint 827 883 0.8000 1.0000 2.0000 0.0000 Constraint 827 872 0.8000 1.0000 2.0000 0.0000 Constraint 827 866 0.8000 1.0000 2.0000 0.0000 Constraint 827 857 0.8000 1.0000 2.0000 0.0000 Constraint 827 849 0.8000 1.0000 2.0000 0.0000 Constraint 827 840 0.8000 1.0000 2.0000 0.0000 Constraint 822 1051 0.8000 1.0000 2.0000 0.0000 Constraint 822 1043 0.8000 1.0000 2.0000 0.0000 Constraint 822 1033 0.8000 1.0000 2.0000 0.0000 Constraint 822 1019 0.8000 1.0000 2.0000 0.0000 Constraint 822 1011 0.8000 1.0000 2.0000 0.0000 Constraint 822 1003 0.8000 1.0000 2.0000 0.0000 Constraint 822 987 0.8000 1.0000 2.0000 0.0000 Constraint 822 980 0.8000 1.0000 2.0000 0.0000 Constraint 822 911 0.8000 1.0000 2.0000 0.0000 Constraint 822 891 0.8000 1.0000 2.0000 0.0000 Constraint 822 883 0.8000 1.0000 2.0000 0.0000 Constraint 822 872 0.8000 1.0000 2.0000 0.0000 Constraint 822 866 0.8000 1.0000 2.0000 0.0000 Constraint 822 857 0.8000 1.0000 2.0000 0.0000 Constraint 822 849 0.8000 1.0000 2.0000 0.0000 Constraint 822 840 0.8000 1.0000 2.0000 0.0000 Constraint 822 827 0.8000 1.0000 2.0000 0.0000 Constraint 814 1051 0.8000 1.0000 2.0000 0.0000 Constraint 814 1043 0.8000 1.0000 2.0000 0.0000 Constraint 814 1033 0.8000 1.0000 2.0000 0.0000 Constraint 814 1026 0.8000 1.0000 2.0000 0.0000 Constraint 814 1003 0.8000 1.0000 2.0000 0.0000 Constraint 814 987 0.8000 1.0000 2.0000 0.0000 Constraint 814 980 0.8000 1.0000 2.0000 0.0000 Constraint 814 891 0.8000 1.0000 2.0000 0.0000 Constraint 814 872 0.8000 1.0000 2.0000 0.0000 Constraint 814 866 0.8000 1.0000 2.0000 0.0000 Constraint 814 857 0.8000 1.0000 2.0000 0.0000 Constraint 814 849 0.8000 1.0000 2.0000 0.0000 Constraint 814 840 0.8000 1.0000 2.0000 0.0000 Constraint 814 827 0.8000 1.0000 2.0000 0.0000 Constraint 814 822 0.8000 1.0000 2.0000 0.0000 Constraint 808 1051 0.8000 1.0000 2.0000 0.0000 Constraint 808 1043 0.8000 1.0000 2.0000 0.0000 Constraint 808 1033 0.8000 1.0000 2.0000 0.0000 Constraint 808 1026 0.8000 1.0000 2.0000 0.0000 Constraint 808 1019 0.8000 1.0000 2.0000 0.0000 Constraint 808 1011 0.8000 1.0000 2.0000 0.0000 Constraint 808 1003 0.8000 1.0000 2.0000 0.0000 Constraint 808 995 0.8000 1.0000 2.0000 0.0000 Constraint 808 987 0.8000 1.0000 2.0000 0.0000 Constraint 808 980 0.8000 1.0000 2.0000 0.0000 Constraint 808 911 0.8000 1.0000 2.0000 0.0000 Constraint 808 901 0.8000 1.0000 2.0000 0.0000 Constraint 808 891 0.8000 1.0000 2.0000 0.0000 Constraint 808 883 0.8000 1.0000 2.0000 0.0000 Constraint 808 866 0.8000 1.0000 2.0000 0.0000 Constraint 808 857 0.8000 1.0000 2.0000 0.0000 Constraint 808 849 0.8000 1.0000 2.0000 0.0000 Constraint 808 840 0.8000 1.0000 2.0000 0.0000 Constraint 808 827 0.8000 1.0000 2.0000 0.0000 Constraint 808 822 0.8000 1.0000 2.0000 0.0000 Constraint 808 814 0.8000 1.0000 2.0000 0.0000 Constraint 801 1051 0.8000 1.0000 2.0000 0.0000 Constraint 801 1043 0.8000 1.0000 2.0000 0.0000 Constraint 801 1033 0.8000 1.0000 2.0000 0.0000 Constraint 801 1026 0.8000 1.0000 2.0000 0.0000 Constraint 801 1019 0.8000 1.0000 2.0000 0.0000 Constraint 801 1011 0.8000 1.0000 2.0000 0.0000 Constraint 801 1003 0.8000 1.0000 2.0000 0.0000 Constraint 801 995 0.8000 1.0000 2.0000 0.0000 Constraint 801 987 0.8000 1.0000 2.0000 0.0000 Constraint 801 980 0.8000 1.0000 2.0000 0.0000 Constraint 801 972 0.8000 1.0000 2.0000 0.0000 Constraint 801 943 0.8000 1.0000 2.0000 0.0000 Constraint 801 931 0.8000 1.0000 2.0000 0.0000 Constraint 801 911 0.8000 1.0000 2.0000 0.0000 Constraint 801 901 0.8000 1.0000 2.0000 0.0000 Constraint 801 891 0.8000 1.0000 2.0000 0.0000 Constraint 801 883 0.8000 1.0000 2.0000 0.0000 Constraint 801 872 0.8000 1.0000 2.0000 0.0000 Constraint 801 866 0.8000 1.0000 2.0000 0.0000 Constraint 801 857 0.8000 1.0000 2.0000 0.0000 Constraint 801 849 0.8000 1.0000 2.0000 0.0000 Constraint 801 840 0.8000 1.0000 2.0000 0.0000 Constraint 801 827 0.8000 1.0000 2.0000 0.0000 Constraint 801 822 0.8000 1.0000 2.0000 0.0000 Constraint 801 814 0.8000 1.0000 2.0000 0.0000 Constraint 801 808 0.8000 1.0000 2.0000 0.0000 Constraint 792 1051 0.8000 1.0000 2.0000 0.0000 Constraint 792 1043 0.8000 1.0000 2.0000 0.0000 Constraint 792 1033 0.8000 1.0000 2.0000 0.0000 Constraint 792 1026 0.8000 1.0000 2.0000 0.0000 Constraint 792 1019 0.8000 1.0000 2.0000 0.0000 Constraint 792 1011 0.8000 1.0000 2.0000 0.0000 Constraint 792 1003 0.8000 1.0000 2.0000 0.0000 Constraint 792 995 0.8000 1.0000 2.0000 0.0000 Constraint 792 987 0.8000 1.0000 2.0000 0.0000 Constraint 792 943 0.8000 1.0000 2.0000 0.0000 Constraint 792 931 0.8000 1.0000 2.0000 0.0000 Constraint 792 919 0.8000 1.0000 2.0000 0.0000 Constraint 792 911 0.8000 1.0000 2.0000 0.0000 Constraint 792 901 0.8000 1.0000 2.0000 0.0000 Constraint 792 891 0.8000 1.0000 2.0000 0.0000 Constraint 792 883 0.8000 1.0000 2.0000 0.0000 Constraint 792 849 0.8000 1.0000 2.0000 0.0000 Constraint 792 840 0.8000 1.0000 2.0000 0.0000 Constraint 792 827 0.8000 1.0000 2.0000 0.0000 Constraint 792 822 0.8000 1.0000 2.0000 0.0000 Constraint 792 814 0.8000 1.0000 2.0000 0.0000 Constraint 792 808 0.8000 1.0000 2.0000 0.0000 Constraint 792 801 0.8000 1.0000 2.0000 0.0000 Constraint 784 1051 0.8000 1.0000 2.0000 0.0000 Constraint 784 1043 0.8000 1.0000 2.0000 0.0000 Constraint 784 1033 0.8000 1.0000 2.0000 0.0000 Constraint 784 1026 0.8000 1.0000 2.0000 0.0000 Constraint 784 1019 0.8000 1.0000 2.0000 0.0000 Constraint 784 1011 0.8000 1.0000 2.0000 0.0000 Constraint 784 1003 0.8000 1.0000 2.0000 0.0000 Constraint 784 995 0.8000 1.0000 2.0000 0.0000 Constraint 784 987 0.8000 1.0000 2.0000 0.0000 Constraint 784 980 0.8000 1.0000 2.0000 0.0000 Constraint 784 931 0.8000 1.0000 2.0000 0.0000 Constraint 784 891 0.8000 1.0000 2.0000 0.0000 Constraint 784 883 0.8000 1.0000 2.0000 0.0000 Constraint 784 840 0.8000 1.0000 2.0000 0.0000 Constraint 784 827 0.8000 1.0000 2.0000 0.0000 Constraint 784 822 0.8000 1.0000 2.0000 0.0000 Constraint 784 814 0.8000 1.0000 2.0000 0.0000 Constraint 784 808 0.8000 1.0000 2.0000 0.0000 Constraint 784 801 0.8000 1.0000 2.0000 0.0000 Constraint 784 792 0.8000 1.0000 2.0000 0.0000 Constraint 776 1051 0.8000 1.0000 2.0000 0.0000 Constraint 776 1043 0.8000 1.0000 2.0000 0.0000 Constraint 776 1033 0.8000 1.0000 2.0000 0.0000 Constraint 776 1026 0.8000 1.0000 2.0000 0.0000 Constraint 776 1019 0.8000 1.0000 2.0000 0.0000 Constraint 776 1011 0.8000 1.0000 2.0000 0.0000 Constraint 776 1003 0.8000 1.0000 2.0000 0.0000 Constraint 776 995 0.8000 1.0000 2.0000 0.0000 Constraint 776 987 0.8000 1.0000 2.0000 0.0000 Constraint 776 980 0.8000 1.0000 2.0000 0.0000 Constraint 776 951 0.8000 1.0000 2.0000 0.0000 Constraint 776 931 0.8000 1.0000 2.0000 0.0000 Constraint 776 911 0.8000 1.0000 2.0000 0.0000 Constraint 776 901 0.8000 1.0000 2.0000 0.0000 Constraint 776 891 0.8000 1.0000 2.0000 0.0000 Constraint 776 883 0.8000 1.0000 2.0000 0.0000 Constraint 776 857 0.8000 1.0000 2.0000 0.0000 Constraint 776 827 0.8000 1.0000 2.0000 0.0000 Constraint 776 822 0.8000 1.0000 2.0000 0.0000 Constraint 776 814 0.8000 1.0000 2.0000 0.0000 Constraint 776 808 0.8000 1.0000 2.0000 0.0000 Constraint 776 801 0.8000 1.0000 2.0000 0.0000 Constraint 776 792 0.8000 1.0000 2.0000 0.0000 Constraint 776 784 0.8000 1.0000 2.0000 0.0000 Constraint 768 1051 0.8000 1.0000 2.0000 0.0000 Constraint 768 1043 0.8000 1.0000 2.0000 0.0000 Constraint 768 1033 0.8000 1.0000 2.0000 0.0000 Constraint 768 1026 0.8000 1.0000 2.0000 0.0000 Constraint 768 1019 0.8000 1.0000 2.0000 0.0000 Constraint 768 1011 0.8000 1.0000 2.0000 0.0000 Constraint 768 1003 0.8000 1.0000 2.0000 0.0000 Constraint 768 995 0.8000 1.0000 2.0000 0.0000 Constraint 768 987 0.8000 1.0000 2.0000 0.0000 Constraint 768 980 0.8000 1.0000 2.0000 0.0000 Constraint 768 972 0.8000 1.0000 2.0000 0.0000 Constraint 768 960 0.8000 1.0000 2.0000 0.0000 Constraint 768 951 0.8000 1.0000 2.0000 0.0000 Constraint 768 931 0.8000 1.0000 2.0000 0.0000 Constraint 768 919 0.8000 1.0000 2.0000 0.0000 Constraint 768 911 0.8000 1.0000 2.0000 0.0000 Constraint 768 901 0.8000 1.0000 2.0000 0.0000 Constraint 768 891 0.8000 1.0000 2.0000 0.0000 Constraint 768 857 0.8000 1.0000 2.0000 0.0000 Constraint 768 849 0.8000 1.0000 2.0000 0.0000 Constraint 768 827 0.8000 1.0000 2.0000 0.0000 Constraint 768 822 0.8000 1.0000 2.0000 0.0000 Constraint 768 814 0.8000 1.0000 2.0000 0.0000 Constraint 768 808 0.8000 1.0000 2.0000 0.0000 Constraint 768 801 0.8000 1.0000 2.0000 0.0000 Constraint 768 792 0.8000 1.0000 2.0000 0.0000 Constraint 768 784 0.8000 1.0000 2.0000 0.0000 Constraint 768 776 0.8000 1.0000 2.0000 0.0000 Constraint 761 1051 0.8000 1.0000 2.0000 0.0000 Constraint 761 1043 0.8000 1.0000 2.0000 0.0000 Constraint 761 1033 0.8000 1.0000 2.0000 0.0000 Constraint 761 1026 0.8000 1.0000 2.0000 0.0000 Constraint 761 1019 0.8000 1.0000 2.0000 0.0000 Constraint 761 1011 0.8000 1.0000 2.0000 0.0000 Constraint 761 1003 0.8000 1.0000 2.0000 0.0000 Constraint 761 995 0.8000 1.0000 2.0000 0.0000 Constraint 761 987 0.8000 1.0000 2.0000 0.0000 Constraint 761 980 0.8000 1.0000 2.0000 0.0000 Constraint 761 960 0.8000 1.0000 2.0000 0.0000 Constraint 761 931 0.8000 1.0000 2.0000 0.0000 Constraint 761 919 0.8000 1.0000 2.0000 0.0000 Constraint 761 911 0.8000 1.0000 2.0000 0.0000 Constraint 761 901 0.8000 1.0000 2.0000 0.0000 Constraint 761 891 0.8000 1.0000 2.0000 0.0000 Constraint 761 883 0.8000 1.0000 2.0000 0.0000 Constraint 761 872 0.8000 1.0000 2.0000 0.0000 Constraint 761 857 0.8000 1.0000 2.0000 0.0000 Constraint 761 849 0.8000 1.0000 2.0000 0.0000 Constraint 761 822 0.8000 1.0000 2.0000 0.0000 Constraint 761 814 0.8000 1.0000 2.0000 0.0000 Constraint 761 808 0.8000 1.0000 2.0000 0.0000 Constraint 761 801 0.8000 1.0000 2.0000 0.0000 Constraint 761 792 0.8000 1.0000 2.0000 0.0000 Constraint 761 784 0.8000 1.0000 2.0000 0.0000 Constraint 761 776 0.8000 1.0000 2.0000 0.0000 Constraint 761 768 0.8000 1.0000 2.0000 0.0000 Constraint 751 1051 0.8000 1.0000 2.0000 0.0000 Constraint 751 1043 0.8000 1.0000 2.0000 0.0000 Constraint 751 1033 0.8000 1.0000 2.0000 0.0000 Constraint 751 1026 0.8000 1.0000 2.0000 0.0000 Constraint 751 1019 0.8000 1.0000 2.0000 0.0000 Constraint 751 1011 0.8000 1.0000 2.0000 0.0000 Constraint 751 1003 0.8000 1.0000 2.0000 0.0000 Constraint 751 995 0.8000 1.0000 2.0000 0.0000 Constraint 751 980 0.8000 1.0000 2.0000 0.0000 Constraint 751 972 0.8000 1.0000 2.0000 0.0000 Constraint 751 951 0.8000 1.0000 2.0000 0.0000 Constraint 751 931 0.8000 1.0000 2.0000 0.0000 Constraint 751 911 0.8000 1.0000 2.0000 0.0000 Constraint 751 901 0.8000 1.0000 2.0000 0.0000 Constraint 751 814 0.8000 1.0000 2.0000 0.0000 Constraint 751 808 0.8000 1.0000 2.0000 0.0000 Constraint 751 801 0.8000 1.0000 2.0000 0.0000 Constraint 751 792 0.8000 1.0000 2.0000 0.0000 Constraint 751 784 0.8000 1.0000 2.0000 0.0000 Constraint 751 776 0.8000 1.0000 2.0000 0.0000 Constraint 751 768 0.8000 1.0000 2.0000 0.0000 Constraint 751 761 0.8000 1.0000 2.0000 0.0000 Constraint 743 1051 0.8000 1.0000 2.0000 0.0000 Constraint 743 1043 0.8000 1.0000 2.0000 0.0000 Constraint 743 1033 0.8000 1.0000 2.0000 0.0000 Constraint 743 1026 0.8000 1.0000 2.0000 0.0000 Constraint 743 1019 0.8000 1.0000 2.0000 0.0000 Constraint 743 1011 0.8000 1.0000 2.0000 0.0000 Constraint 743 1003 0.8000 1.0000 2.0000 0.0000 Constraint 743 995 0.8000 1.0000 2.0000 0.0000 Constraint 743 987 0.8000 1.0000 2.0000 0.0000 Constraint 743 980 0.8000 1.0000 2.0000 0.0000 Constraint 743 972 0.8000 1.0000 2.0000 0.0000 Constraint 743 960 0.8000 1.0000 2.0000 0.0000 Constraint 743 951 0.8000 1.0000 2.0000 0.0000 Constraint 743 919 0.8000 1.0000 2.0000 0.0000 Constraint 743 911 0.8000 1.0000 2.0000 0.0000 Constraint 743 901 0.8000 1.0000 2.0000 0.0000 Constraint 743 891 0.8000 1.0000 2.0000 0.0000 Constraint 743 883 0.8000 1.0000 2.0000 0.0000 Constraint 743 872 0.8000 1.0000 2.0000 0.0000 Constraint 743 857 0.8000 1.0000 2.0000 0.0000 Constraint 743 808 0.8000 1.0000 2.0000 0.0000 Constraint 743 801 0.8000 1.0000 2.0000 0.0000 Constraint 743 792 0.8000 1.0000 2.0000 0.0000 Constraint 743 784 0.8000 1.0000 2.0000 0.0000 Constraint 743 776 0.8000 1.0000 2.0000 0.0000 Constraint 743 768 0.8000 1.0000 2.0000 0.0000 Constraint 743 761 0.8000 1.0000 2.0000 0.0000 Constraint 743 751 0.8000 1.0000 2.0000 0.0000 Constraint 735 1051 0.8000 1.0000 2.0000 0.0000 Constraint 735 1043 0.8000 1.0000 2.0000 0.0000 Constraint 735 1033 0.8000 1.0000 2.0000 0.0000 Constraint 735 1026 0.8000 1.0000 2.0000 0.0000 Constraint 735 1019 0.8000 1.0000 2.0000 0.0000 Constraint 735 1011 0.8000 1.0000 2.0000 0.0000 Constraint 735 1003 0.8000 1.0000 2.0000 0.0000 Constraint 735 995 0.8000 1.0000 2.0000 0.0000 Constraint 735 987 0.8000 1.0000 2.0000 0.0000 Constraint 735 980 0.8000 1.0000 2.0000 0.0000 Constraint 735 972 0.8000 1.0000 2.0000 0.0000 Constraint 735 951 0.8000 1.0000 2.0000 0.0000 Constraint 735 943 0.8000 1.0000 2.0000 0.0000 Constraint 735 919 0.8000 1.0000 2.0000 0.0000 Constraint 735 911 0.8000 1.0000 2.0000 0.0000 Constraint 735 901 0.8000 1.0000 2.0000 0.0000 Constraint 735 891 0.8000 1.0000 2.0000 0.0000 Constraint 735 883 0.8000 1.0000 2.0000 0.0000 Constraint 735 872 0.8000 1.0000 2.0000 0.0000 Constraint 735 866 0.8000 1.0000 2.0000 0.0000 Constraint 735 857 0.8000 1.0000 2.0000 0.0000 Constraint 735 849 0.8000 1.0000 2.0000 0.0000 Constraint 735 822 0.8000 1.0000 2.0000 0.0000 Constraint 735 814 0.8000 1.0000 2.0000 0.0000 Constraint 735 808 0.8000 1.0000 2.0000 0.0000 Constraint 735 801 0.8000 1.0000 2.0000 0.0000 Constraint 735 792 0.8000 1.0000 2.0000 0.0000 Constraint 735 784 0.8000 1.0000 2.0000 0.0000 Constraint 735 776 0.8000 1.0000 2.0000 0.0000 Constraint 735 768 0.8000 1.0000 2.0000 0.0000 Constraint 735 761 0.8000 1.0000 2.0000 0.0000 Constraint 735 751 0.8000 1.0000 2.0000 0.0000 Constraint 735 743 0.8000 1.0000 2.0000 0.0000 Constraint 727 1051 0.8000 1.0000 2.0000 0.0000 Constraint 727 1043 0.8000 1.0000 2.0000 0.0000 Constraint 727 1033 0.8000 1.0000 2.0000 0.0000 Constraint 727 1026 0.8000 1.0000 2.0000 0.0000 Constraint 727 1019 0.8000 1.0000 2.0000 0.0000 Constraint 727 1011 0.8000 1.0000 2.0000 0.0000 Constraint 727 1003 0.8000 1.0000 2.0000 0.0000 Constraint 727 980 0.8000 1.0000 2.0000 0.0000 Constraint 727 960 0.8000 1.0000 2.0000 0.0000 Constraint 727 911 0.8000 1.0000 2.0000 0.0000 Constraint 727 872 0.8000 1.0000 2.0000 0.0000 Constraint 727 866 0.8000 1.0000 2.0000 0.0000 Constraint 727 857 0.8000 1.0000 2.0000 0.0000 Constraint 727 840 0.8000 1.0000 2.0000 0.0000 Constraint 727 822 0.8000 1.0000 2.0000 0.0000 Constraint 727 814 0.8000 1.0000 2.0000 0.0000 Constraint 727 801 0.8000 1.0000 2.0000 0.0000 Constraint 727 792 0.8000 1.0000 2.0000 0.0000 Constraint 727 784 0.8000 1.0000 2.0000 0.0000 Constraint 727 776 0.8000 1.0000 2.0000 0.0000 Constraint 727 768 0.8000 1.0000 2.0000 0.0000 Constraint 727 761 0.8000 1.0000 2.0000 0.0000 Constraint 727 751 0.8000 1.0000 2.0000 0.0000 Constraint 727 743 0.8000 1.0000 2.0000 0.0000 Constraint 727 735 0.8000 1.0000 2.0000 0.0000 Constraint 719 1051 0.8000 1.0000 2.0000 0.0000 Constraint 719 1043 0.8000 1.0000 2.0000 0.0000 Constraint 719 1033 0.8000 1.0000 2.0000 0.0000 Constraint 719 1026 0.8000 1.0000 2.0000 0.0000 Constraint 719 1019 0.8000 1.0000 2.0000 0.0000 Constraint 719 1011 0.8000 1.0000 2.0000 0.0000 Constraint 719 1003 0.8000 1.0000 2.0000 0.0000 Constraint 719 995 0.8000 1.0000 2.0000 0.0000 Constraint 719 987 0.8000 1.0000 2.0000 0.0000 Constraint 719 980 0.8000 1.0000 2.0000 0.0000 Constraint 719 972 0.8000 1.0000 2.0000 0.0000 Constraint 719 960 0.8000 1.0000 2.0000 0.0000 Constraint 719 951 0.8000 1.0000 2.0000 0.0000 Constraint 719 931 0.8000 1.0000 2.0000 0.0000 Constraint 719 911 0.8000 1.0000 2.0000 0.0000 Constraint 719 901 0.8000 1.0000 2.0000 0.0000 Constraint 719 872 0.8000 1.0000 2.0000 0.0000 Constraint 719 857 0.8000 1.0000 2.0000 0.0000 Constraint 719 840 0.8000 1.0000 2.0000 0.0000 Constraint 719 808 0.8000 1.0000 2.0000 0.0000 Constraint 719 784 0.8000 1.0000 2.0000 0.0000 Constraint 719 776 0.8000 1.0000 2.0000 0.0000 Constraint 719 768 0.8000 1.0000 2.0000 0.0000 Constraint 719 761 0.8000 1.0000 2.0000 0.0000 Constraint 719 751 0.8000 1.0000 2.0000 0.0000 Constraint 719 743 0.8000 1.0000 2.0000 0.0000 Constraint 719 735 0.8000 1.0000 2.0000 0.0000 Constraint 719 727 0.8000 1.0000 2.0000 0.0000 Constraint 711 1051 0.8000 1.0000 2.0000 0.0000 Constraint 711 1043 0.8000 1.0000 2.0000 0.0000 Constraint 711 1033 0.8000 1.0000 2.0000 0.0000 Constraint 711 1026 0.8000 1.0000 2.0000 0.0000 Constraint 711 1019 0.8000 1.0000 2.0000 0.0000 Constraint 711 1011 0.8000 1.0000 2.0000 0.0000 Constraint 711 1003 0.8000 1.0000 2.0000 0.0000 Constraint 711 995 0.8000 1.0000 2.0000 0.0000 Constraint 711 987 0.8000 1.0000 2.0000 0.0000 Constraint 711 980 0.8000 1.0000 2.0000 0.0000 Constraint 711 972 0.8000 1.0000 2.0000 0.0000 Constraint 711 943 0.8000 1.0000 2.0000 0.0000 Constraint 711 931 0.8000 1.0000 2.0000 0.0000 Constraint 711 919 0.8000 1.0000 2.0000 0.0000 Constraint 711 911 0.8000 1.0000 2.0000 0.0000 Constraint 711 901 0.8000 1.0000 2.0000 0.0000 Constraint 711 891 0.8000 1.0000 2.0000 0.0000 Constraint 711 883 0.8000 1.0000 2.0000 0.0000 Constraint 711 872 0.8000 1.0000 2.0000 0.0000 Constraint 711 866 0.8000 1.0000 2.0000 0.0000 Constraint 711 857 0.8000 1.0000 2.0000 0.0000 Constraint 711 849 0.8000 1.0000 2.0000 0.0000 Constraint 711 840 0.8000 1.0000 2.0000 0.0000 Constraint 711 827 0.8000 1.0000 2.0000 0.0000 Constraint 711 822 0.8000 1.0000 2.0000 0.0000 Constraint 711 814 0.8000 1.0000 2.0000 0.0000 Constraint 711 808 0.8000 1.0000 2.0000 0.0000 Constraint 711 801 0.8000 1.0000 2.0000 0.0000 Constraint 711 792 0.8000 1.0000 2.0000 0.0000 Constraint 711 784 0.8000 1.0000 2.0000 0.0000 Constraint 711 776 0.8000 1.0000 2.0000 0.0000 Constraint 711 768 0.8000 1.0000 2.0000 0.0000 Constraint 711 761 0.8000 1.0000 2.0000 0.0000 Constraint 711 751 0.8000 1.0000 2.0000 0.0000 Constraint 711 743 0.8000 1.0000 2.0000 0.0000 Constraint 711 735 0.8000 1.0000 2.0000 0.0000 Constraint 711 727 0.8000 1.0000 2.0000 0.0000 Constraint 711 719 0.8000 1.0000 2.0000 0.0000 Constraint 706 1051 0.8000 1.0000 2.0000 0.0000 Constraint 706 1043 0.8000 1.0000 2.0000 0.0000 Constraint 706 1033 0.8000 1.0000 2.0000 0.0000 Constraint 706 1026 0.8000 1.0000 2.0000 0.0000 Constraint 706 1019 0.8000 1.0000 2.0000 0.0000 Constraint 706 1011 0.8000 1.0000 2.0000 0.0000 Constraint 706 1003 0.8000 1.0000 2.0000 0.0000 Constraint 706 995 0.8000 1.0000 2.0000 0.0000 Constraint 706 987 0.8000 1.0000 2.0000 0.0000 Constraint 706 980 0.8000 1.0000 2.0000 0.0000 Constraint 706 972 0.8000 1.0000 2.0000 0.0000 Constraint 706 960 0.8000 1.0000 2.0000 0.0000 Constraint 706 951 0.8000 1.0000 2.0000 0.0000 Constraint 706 943 0.8000 1.0000 2.0000 0.0000 Constraint 706 931 0.8000 1.0000 2.0000 0.0000 Constraint 706 919 0.8000 1.0000 2.0000 0.0000 Constraint 706 911 0.8000 1.0000 2.0000 0.0000 Constraint 706 901 0.8000 1.0000 2.0000 0.0000 Constraint 706 891 0.8000 1.0000 2.0000 0.0000 Constraint 706 883 0.8000 1.0000 2.0000 0.0000 Constraint 706 872 0.8000 1.0000 2.0000 0.0000 Constraint 706 866 0.8000 1.0000 2.0000 0.0000 Constraint 706 857 0.8000 1.0000 2.0000 0.0000 Constraint 706 849 0.8000 1.0000 2.0000 0.0000 Constraint 706 840 0.8000 1.0000 2.0000 0.0000 Constraint 706 827 0.8000 1.0000 2.0000 0.0000 Constraint 706 808 0.8000 1.0000 2.0000 0.0000 Constraint 706 768 0.8000 1.0000 2.0000 0.0000 Constraint 706 761 0.8000 1.0000 2.0000 0.0000 Constraint 706 751 0.8000 1.0000 2.0000 0.0000 Constraint 706 743 0.8000 1.0000 2.0000 0.0000 Constraint 706 735 0.8000 1.0000 2.0000 0.0000 Constraint 706 727 0.8000 1.0000 2.0000 0.0000 Constraint 706 719 0.8000 1.0000 2.0000 0.0000 Constraint 706 711 0.8000 1.0000 2.0000 0.0000 Constraint 698 1051 0.8000 1.0000 2.0000 0.0000 Constraint 698 1043 0.8000 1.0000 2.0000 0.0000 Constraint 698 1033 0.8000 1.0000 2.0000 0.0000 Constraint 698 1026 0.8000 1.0000 2.0000 0.0000 Constraint 698 1019 0.8000 1.0000 2.0000 0.0000 Constraint 698 1011 0.8000 1.0000 2.0000 0.0000 Constraint 698 1003 0.8000 1.0000 2.0000 0.0000 Constraint 698 995 0.8000 1.0000 2.0000 0.0000 Constraint 698 987 0.8000 1.0000 2.0000 0.0000 Constraint 698 980 0.8000 1.0000 2.0000 0.0000 Constraint 698 960 0.8000 1.0000 2.0000 0.0000 Constraint 698 943 0.8000 1.0000 2.0000 0.0000 Constraint 698 901 0.8000 1.0000 2.0000 0.0000 Constraint 698 883 0.8000 1.0000 2.0000 0.0000 Constraint 698 872 0.8000 1.0000 2.0000 0.0000 Constraint 698 857 0.8000 1.0000 2.0000 0.0000 Constraint 698 840 0.8000 1.0000 2.0000 0.0000 Constraint 698 822 0.8000 1.0000 2.0000 0.0000 Constraint 698 814 0.8000 1.0000 2.0000 0.0000 Constraint 698 808 0.8000 1.0000 2.0000 0.0000 Constraint 698 801 0.8000 1.0000 2.0000 0.0000 Constraint 698 768 0.8000 1.0000 2.0000 0.0000 Constraint 698 761 0.8000 1.0000 2.0000 0.0000 Constraint 698 751 0.8000 1.0000 2.0000 0.0000 Constraint 698 743 0.8000 1.0000 2.0000 0.0000 Constraint 698 735 0.8000 1.0000 2.0000 0.0000 Constraint 698 727 0.8000 1.0000 2.0000 0.0000 Constraint 698 719 0.8000 1.0000 2.0000 0.0000 Constraint 698 711 0.8000 1.0000 2.0000 0.0000 Constraint 698 706 0.8000 1.0000 2.0000 0.0000 Constraint 690 1051 0.8000 1.0000 2.0000 0.0000 Constraint 690 1043 0.8000 1.0000 2.0000 0.0000 Constraint 690 1033 0.8000 1.0000 2.0000 0.0000 Constraint 690 1026 0.8000 1.0000 2.0000 0.0000 Constraint 690 1019 0.8000 1.0000 2.0000 0.0000 Constraint 690 1011 0.8000 1.0000 2.0000 0.0000 Constraint 690 1003 0.8000 1.0000 2.0000 0.0000 Constraint 690 995 0.8000 1.0000 2.0000 0.0000 Constraint 690 987 0.8000 1.0000 2.0000 0.0000 Constraint 690 980 0.8000 1.0000 2.0000 0.0000 Constraint 690 972 0.8000 1.0000 2.0000 0.0000 Constraint 690 931 0.8000 1.0000 2.0000 0.0000 Constraint 690 901 0.8000 1.0000 2.0000 0.0000 Constraint 690 883 0.8000 1.0000 2.0000 0.0000 Constraint 690 872 0.8000 1.0000 2.0000 0.0000 Constraint 690 814 0.8000 1.0000 2.0000 0.0000 Constraint 690 808 0.8000 1.0000 2.0000 0.0000 Constraint 690 801 0.8000 1.0000 2.0000 0.0000 Constraint 690 792 0.8000 1.0000 2.0000 0.0000 Constraint 690 768 0.8000 1.0000 2.0000 0.0000 Constraint 690 761 0.8000 1.0000 2.0000 0.0000 Constraint 690 751 0.8000 1.0000 2.0000 0.0000 Constraint 690 743 0.8000 1.0000 2.0000 0.0000 Constraint 690 735 0.8000 1.0000 2.0000 0.0000 Constraint 690 727 0.8000 1.0000 2.0000 0.0000 Constraint 690 719 0.8000 1.0000 2.0000 0.0000 Constraint 690 711 0.8000 1.0000 2.0000 0.0000 Constraint 690 706 0.8000 1.0000 2.0000 0.0000 Constraint 690 698 0.8000 1.0000 2.0000 0.0000 Constraint 682 1051 0.8000 1.0000 2.0000 0.0000 Constraint 682 1043 0.8000 1.0000 2.0000 0.0000 Constraint 682 1033 0.8000 1.0000 2.0000 0.0000 Constraint 682 1026 0.8000 1.0000 2.0000 0.0000 Constraint 682 1019 0.8000 1.0000 2.0000 0.0000 Constraint 682 1011 0.8000 1.0000 2.0000 0.0000 Constraint 682 1003 0.8000 1.0000 2.0000 0.0000 Constraint 682 995 0.8000 1.0000 2.0000 0.0000 Constraint 682 987 0.8000 1.0000 2.0000 0.0000 Constraint 682 980 0.8000 1.0000 2.0000 0.0000 Constraint 682 972 0.8000 1.0000 2.0000 0.0000 Constraint 682 943 0.8000 1.0000 2.0000 0.0000 Constraint 682 801 0.8000 1.0000 2.0000 0.0000 Constraint 682 792 0.8000 1.0000 2.0000 0.0000 Constraint 682 768 0.8000 1.0000 2.0000 0.0000 Constraint 682 761 0.8000 1.0000 2.0000 0.0000 Constraint 682 751 0.8000 1.0000 2.0000 0.0000 Constraint 682 743 0.8000 1.0000 2.0000 0.0000 Constraint 682 735 0.8000 1.0000 2.0000 0.0000 Constraint 682 727 0.8000 1.0000 2.0000 0.0000 Constraint 682 719 0.8000 1.0000 2.0000 0.0000 Constraint 682 711 0.8000 1.0000 2.0000 0.0000 Constraint 682 706 0.8000 1.0000 2.0000 0.0000 Constraint 682 698 0.8000 1.0000 2.0000 0.0000 Constraint 682 690 0.8000 1.0000 2.0000 0.0000 Constraint 674 1051 0.8000 1.0000 2.0000 0.0000 Constraint 674 1043 0.8000 1.0000 2.0000 0.0000 Constraint 674 1033 0.8000 1.0000 2.0000 0.0000 Constraint 674 1026 0.8000 1.0000 2.0000 0.0000 Constraint 674 1019 0.8000 1.0000 2.0000 0.0000 Constraint 674 1011 0.8000 1.0000 2.0000 0.0000 Constraint 674 1003 0.8000 1.0000 2.0000 0.0000 Constraint 674 995 0.8000 1.0000 2.0000 0.0000 Constraint 674 987 0.8000 1.0000 2.0000 0.0000 Constraint 674 980 0.8000 1.0000 2.0000 0.0000 Constraint 674 943 0.8000 1.0000 2.0000 0.0000 Constraint 674 931 0.8000 1.0000 2.0000 0.0000 Constraint 674 919 0.8000 1.0000 2.0000 0.0000 Constraint 674 911 0.8000 1.0000 2.0000 0.0000 Constraint 674 901 0.8000 1.0000 2.0000 0.0000 Constraint 674 891 0.8000 1.0000 2.0000 0.0000 Constraint 674 883 0.8000 1.0000 2.0000 0.0000 Constraint 674 866 0.8000 1.0000 2.0000 0.0000 Constraint 674 814 0.8000 1.0000 2.0000 0.0000 Constraint 674 808 0.8000 1.0000 2.0000 0.0000 Constraint 674 801 0.8000 1.0000 2.0000 0.0000 Constraint 674 792 0.8000 1.0000 2.0000 0.0000 Constraint 674 784 0.8000 1.0000 2.0000 0.0000 Constraint 674 776 0.8000 1.0000 2.0000 0.0000 Constraint 674 768 0.8000 1.0000 2.0000 0.0000 Constraint 674 761 0.8000 1.0000 2.0000 0.0000 Constraint 674 751 0.8000 1.0000 2.0000 0.0000 Constraint 674 743 0.8000 1.0000 2.0000 0.0000 Constraint 674 735 0.8000 1.0000 2.0000 0.0000 Constraint 674 727 0.8000 1.0000 2.0000 0.0000 Constraint 674 719 0.8000 1.0000 2.0000 0.0000 Constraint 674 711 0.8000 1.0000 2.0000 0.0000 Constraint 674 706 0.8000 1.0000 2.0000 0.0000 Constraint 674 698 0.8000 1.0000 2.0000 0.0000 Constraint 674 690 0.8000 1.0000 2.0000 0.0000 Constraint 674 682 0.8000 1.0000 2.0000 0.0000 Constraint 667 1051 0.8000 1.0000 2.0000 0.0000 Constraint 667 1043 0.8000 1.0000 2.0000 0.0000 Constraint 667 1033 0.8000 1.0000 2.0000 0.0000 Constraint 667 1026 0.8000 1.0000 2.0000 0.0000 Constraint 667 1019 0.8000 1.0000 2.0000 0.0000 Constraint 667 1011 0.8000 1.0000 2.0000 0.0000 Constraint 667 1003 0.8000 1.0000 2.0000 0.0000 Constraint 667 995 0.8000 1.0000 2.0000 0.0000 Constraint 667 987 0.8000 1.0000 2.0000 0.0000 Constraint 667 980 0.8000 1.0000 2.0000 0.0000 Constraint 667 931 0.8000 1.0000 2.0000 0.0000 Constraint 667 919 0.8000 1.0000 2.0000 0.0000 Constraint 667 814 0.8000 1.0000 2.0000 0.0000 Constraint 667 808 0.8000 1.0000 2.0000 0.0000 Constraint 667 801 0.8000 1.0000 2.0000 0.0000 Constraint 667 792 0.8000 1.0000 2.0000 0.0000 Constraint 667 784 0.8000 1.0000 2.0000 0.0000 Constraint 667 776 0.8000 1.0000 2.0000 0.0000 Constraint 667 768 0.8000 1.0000 2.0000 0.0000 Constraint 667 751 0.8000 1.0000 2.0000 0.0000 Constraint 667 735 0.8000 1.0000 2.0000 0.0000 Constraint 667 727 0.8000 1.0000 2.0000 0.0000 Constraint 667 719 0.8000 1.0000 2.0000 0.0000 Constraint 667 711 0.8000 1.0000 2.0000 0.0000 Constraint 667 706 0.8000 1.0000 2.0000 0.0000 Constraint 667 698 0.8000 1.0000 2.0000 0.0000 Constraint 667 690 0.8000 1.0000 2.0000 0.0000 Constraint 667 682 0.8000 1.0000 2.0000 0.0000 Constraint 667 674 0.8000 1.0000 2.0000 0.0000 Constraint 659 1051 0.8000 1.0000 2.0000 0.0000 Constraint 659 1043 0.8000 1.0000 2.0000 0.0000 Constraint 659 1033 0.8000 1.0000 2.0000 0.0000 Constraint 659 1026 0.8000 1.0000 2.0000 0.0000 Constraint 659 1019 0.8000 1.0000 2.0000 0.0000 Constraint 659 1011 0.8000 1.0000 2.0000 0.0000 Constraint 659 1003 0.8000 1.0000 2.0000 0.0000 Constraint 659 995 0.8000 1.0000 2.0000 0.0000 Constraint 659 987 0.8000 1.0000 2.0000 0.0000 Constraint 659 980 0.8000 1.0000 2.0000 0.0000 Constraint 659 972 0.8000 1.0000 2.0000 0.0000 Constraint 659 960 0.8000 1.0000 2.0000 0.0000 Constraint 659 931 0.8000 1.0000 2.0000 0.0000 Constraint 659 919 0.8000 1.0000 2.0000 0.0000 Constraint 659 801 0.8000 1.0000 2.0000 0.0000 Constraint 659 792 0.8000 1.0000 2.0000 0.0000 Constraint 659 784 0.8000 1.0000 2.0000 0.0000 Constraint 659 776 0.8000 1.0000 2.0000 0.0000 Constraint 659 768 0.8000 1.0000 2.0000 0.0000 Constraint 659 761 0.8000 1.0000 2.0000 0.0000 Constraint 659 751 0.8000 1.0000 2.0000 0.0000 Constraint 659 735 0.8000 1.0000 2.0000 0.0000 Constraint 659 727 0.8000 1.0000 2.0000 0.0000 Constraint 659 719 0.8000 1.0000 2.0000 0.0000 Constraint 659 711 0.8000 1.0000 2.0000 0.0000 Constraint 659 706 0.8000 1.0000 2.0000 0.0000 Constraint 659 698 0.8000 1.0000 2.0000 0.0000 Constraint 659 690 0.8000 1.0000 2.0000 0.0000 Constraint 659 682 0.8000 1.0000 2.0000 0.0000 Constraint 659 674 0.8000 1.0000 2.0000 0.0000 Constraint 659 667 0.8000 1.0000 2.0000 0.0000 Constraint 650 1051 0.8000 1.0000 2.0000 0.0000 Constraint 650 1043 0.8000 1.0000 2.0000 0.0000 Constraint 650 1033 0.8000 1.0000 2.0000 0.0000 Constraint 650 1026 0.8000 1.0000 2.0000 0.0000 Constraint 650 1019 0.8000 1.0000 2.0000 0.0000 Constraint 650 1011 0.8000 1.0000 2.0000 0.0000 Constraint 650 1003 0.8000 1.0000 2.0000 0.0000 Constraint 650 995 0.8000 1.0000 2.0000 0.0000 Constraint 650 987 0.8000 1.0000 2.0000 0.0000 Constraint 650 980 0.8000 1.0000 2.0000 0.0000 Constraint 650 972 0.8000 1.0000 2.0000 0.0000 Constraint 650 960 0.8000 1.0000 2.0000 0.0000 Constraint 650 931 0.8000 1.0000 2.0000 0.0000 Constraint 650 919 0.8000 1.0000 2.0000 0.0000 Constraint 650 911 0.8000 1.0000 2.0000 0.0000 Constraint 650 827 0.8000 1.0000 2.0000 0.0000 Constraint 650 822 0.8000 1.0000 2.0000 0.0000 Constraint 650 814 0.8000 1.0000 2.0000 0.0000 Constraint 650 801 0.8000 1.0000 2.0000 0.0000 Constraint 650 792 0.8000 1.0000 2.0000 0.0000 Constraint 650 784 0.8000 1.0000 2.0000 0.0000 Constraint 650 776 0.8000 1.0000 2.0000 0.0000 Constraint 650 768 0.8000 1.0000 2.0000 0.0000 Constraint 650 743 0.8000 1.0000 2.0000 0.0000 Constraint 650 735 0.8000 1.0000 2.0000 0.0000 Constraint 650 727 0.8000 1.0000 2.0000 0.0000 Constraint 650 711 0.8000 1.0000 2.0000 0.0000 Constraint 650 706 0.8000 1.0000 2.0000 0.0000 Constraint 650 698 0.8000 1.0000 2.0000 0.0000 Constraint 650 690 0.8000 1.0000 2.0000 0.0000 Constraint 650 682 0.8000 1.0000 2.0000 0.0000 Constraint 650 674 0.8000 1.0000 2.0000 0.0000 Constraint 650 667 0.8000 1.0000 2.0000 0.0000 Constraint 650 659 0.8000 1.0000 2.0000 0.0000 Constraint 641 1051 0.8000 1.0000 2.0000 0.0000 Constraint 641 1043 0.8000 1.0000 2.0000 0.0000 Constraint 641 1033 0.8000 1.0000 2.0000 0.0000 Constraint 641 1026 0.8000 1.0000 2.0000 0.0000 Constraint 641 1019 0.8000 1.0000 2.0000 0.0000 Constraint 641 1011 0.8000 1.0000 2.0000 0.0000 Constraint 641 1003 0.8000 1.0000 2.0000 0.0000 Constraint 641 995 0.8000 1.0000 2.0000 0.0000 Constraint 641 987 0.8000 1.0000 2.0000 0.0000 Constraint 641 980 0.8000 1.0000 2.0000 0.0000 Constraint 641 972 0.8000 1.0000 2.0000 0.0000 Constraint 641 960 0.8000 1.0000 2.0000 0.0000 Constraint 641 931 0.8000 1.0000 2.0000 0.0000 Constraint 641 891 0.8000 1.0000 2.0000 0.0000 Constraint 641 827 0.8000 1.0000 2.0000 0.0000 Constraint 641 822 0.8000 1.0000 2.0000 0.0000 Constraint 641 814 0.8000 1.0000 2.0000 0.0000 Constraint 641 808 0.8000 1.0000 2.0000 0.0000 Constraint 641 801 0.8000 1.0000 2.0000 0.0000 Constraint 641 792 0.8000 1.0000 2.0000 0.0000 Constraint 641 784 0.8000 1.0000 2.0000 0.0000 Constraint 641 768 0.8000 1.0000 2.0000 0.0000 Constraint 641 743 0.8000 1.0000 2.0000 0.0000 Constraint 641 735 0.8000 1.0000 2.0000 0.0000 Constraint 641 727 0.8000 1.0000 2.0000 0.0000 Constraint 641 706 0.8000 1.0000 2.0000 0.0000 Constraint 641 698 0.8000 1.0000 2.0000 0.0000 Constraint 641 690 0.8000 1.0000 2.0000 0.0000 Constraint 641 682 0.8000 1.0000 2.0000 0.0000 Constraint 641 674 0.8000 1.0000 2.0000 0.0000 Constraint 641 667 0.8000 1.0000 2.0000 0.0000 Constraint 641 659 0.8000 1.0000 2.0000 0.0000 Constraint 641 650 0.8000 1.0000 2.0000 0.0000 Constraint 633 1051 0.8000 1.0000 2.0000 0.0000 Constraint 633 1043 0.8000 1.0000 2.0000 0.0000 Constraint 633 1033 0.8000 1.0000 2.0000 0.0000 Constraint 633 1026 0.8000 1.0000 2.0000 0.0000 Constraint 633 1019 0.8000 1.0000 2.0000 0.0000 Constraint 633 1011 0.8000 1.0000 2.0000 0.0000 Constraint 633 1003 0.8000 1.0000 2.0000 0.0000 Constraint 633 995 0.8000 1.0000 2.0000 0.0000 Constraint 633 987 0.8000 1.0000 2.0000 0.0000 Constraint 633 980 0.8000 1.0000 2.0000 0.0000 Constraint 633 972 0.8000 1.0000 2.0000 0.0000 Constraint 633 960 0.8000 1.0000 2.0000 0.0000 Constraint 633 951 0.8000 1.0000 2.0000 0.0000 Constraint 633 931 0.8000 1.0000 2.0000 0.0000 Constraint 633 911 0.8000 1.0000 2.0000 0.0000 Constraint 633 827 0.8000 1.0000 2.0000 0.0000 Constraint 633 822 0.8000 1.0000 2.0000 0.0000 Constraint 633 801 0.8000 1.0000 2.0000 0.0000 Constraint 633 792 0.8000 1.0000 2.0000 0.0000 Constraint 633 784 0.8000 1.0000 2.0000 0.0000 Constraint 633 776 0.8000 1.0000 2.0000 0.0000 Constraint 633 768 0.8000 1.0000 2.0000 0.0000 Constraint 633 761 0.8000 1.0000 2.0000 0.0000 Constraint 633 751 0.8000 1.0000 2.0000 0.0000 Constraint 633 743 0.8000 1.0000 2.0000 0.0000 Constraint 633 735 0.8000 1.0000 2.0000 0.0000 Constraint 633 727 0.8000 1.0000 2.0000 0.0000 Constraint 633 698 0.8000 1.0000 2.0000 0.0000 Constraint 633 690 0.8000 1.0000 2.0000 0.0000 Constraint 633 682 0.8000 1.0000 2.0000 0.0000 Constraint 633 674 0.8000 1.0000 2.0000 0.0000 Constraint 633 667 0.8000 1.0000 2.0000 0.0000 Constraint 633 659 0.8000 1.0000 2.0000 0.0000 Constraint 633 650 0.8000 1.0000 2.0000 0.0000 Constraint 633 641 0.8000 1.0000 2.0000 0.0000 Constraint 627 1051 0.8000 1.0000 2.0000 0.0000 Constraint 627 1043 0.8000 1.0000 2.0000 0.0000 Constraint 627 1033 0.8000 1.0000 2.0000 0.0000 Constraint 627 1026 0.8000 1.0000 2.0000 0.0000 Constraint 627 1019 0.8000 1.0000 2.0000 0.0000 Constraint 627 1011 0.8000 1.0000 2.0000 0.0000 Constraint 627 1003 0.8000 1.0000 2.0000 0.0000 Constraint 627 995 0.8000 1.0000 2.0000 0.0000 Constraint 627 987 0.8000 1.0000 2.0000 0.0000 Constraint 627 980 0.8000 1.0000 2.0000 0.0000 Constraint 627 972 0.8000 1.0000 2.0000 0.0000 Constraint 627 960 0.8000 1.0000 2.0000 0.0000 Constraint 627 951 0.8000 1.0000 2.0000 0.0000 Constraint 627 943 0.8000 1.0000 2.0000 0.0000 Constraint 627 931 0.8000 1.0000 2.0000 0.0000 Constraint 627 919 0.8000 1.0000 2.0000 0.0000 Constraint 627 911 0.8000 1.0000 2.0000 0.0000 Constraint 627 901 0.8000 1.0000 2.0000 0.0000 Constraint 627 891 0.8000 1.0000 2.0000 0.0000 Constraint 627 827 0.8000 1.0000 2.0000 0.0000 Constraint 627 822 0.8000 1.0000 2.0000 0.0000 Constraint 627 801 0.8000 1.0000 2.0000 0.0000 Constraint 627 792 0.8000 1.0000 2.0000 0.0000 Constraint 627 784 0.8000 1.0000 2.0000 0.0000 Constraint 627 776 0.8000 1.0000 2.0000 0.0000 Constraint 627 761 0.8000 1.0000 2.0000 0.0000 Constraint 627 735 0.8000 1.0000 2.0000 0.0000 Constraint 627 727 0.8000 1.0000 2.0000 0.0000 Constraint 627 711 0.8000 1.0000 2.0000 0.0000 Constraint 627 706 0.8000 1.0000 2.0000 0.0000 Constraint 627 690 0.8000 1.0000 2.0000 0.0000 Constraint 627 682 0.8000 1.0000 2.0000 0.0000 Constraint 627 674 0.8000 1.0000 2.0000 0.0000 Constraint 627 667 0.8000 1.0000 2.0000 0.0000 Constraint 627 659 0.8000 1.0000 2.0000 0.0000 Constraint 627 650 0.8000 1.0000 2.0000 0.0000 Constraint 627 641 0.8000 1.0000 2.0000 0.0000 Constraint 627 633 0.8000 1.0000 2.0000 0.0000 Constraint 621 1051 0.8000 1.0000 2.0000 0.0000 Constraint 621 1043 0.8000 1.0000 2.0000 0.0000 Constraint 621 1033 0.8000 1.0000 2.0000 0.0000 Constraint 621 1026 0.8000 1.0000 2.0000 0.0000 Constraint 621 1019 0.8000 1.0000 2.0000 0.0000 Constraint 621 1011 0.8000 1.0000 2.0000 0.0000 Constraint 621 1003 0.8000 1.0000 2.0000 0.0000 Constraint 621 995 0.8000 1.0000 2.0000 0.0000 Constraint 621 987 0.8000 1.0000 2.0000 0.0000 Constraint 621 980 0.8000 1.0000 2.0000 0.0000 Constraint 621 972 0.8000 1.0000 2.0000 0.0000 Constraint 621 960 0.8000 1.0000 2.0000 0.0000 Constraint 621 951 0.8000 1.0000 2.0000 0.0000 Constraint 621 943 0.8000 1.0000 2.0000 0.0000 Constraint 621 931 0.8000 1.0000 2.0000 0.0000 Constraint 621 919 0.8000 1.0000 2.0000 0.0000 Constraint 621 911 0.8000 1.0000 2.0000 0.0000 Constraint 621 827 0.8000 1.0000 2.0000 0.0000 Constraint 621 822 0.8000 1.0000 2.0000 0.0000 Constraint 621 814 0.8000 1.0000 2.0000 0.0000 Constraint 621 801 0.8000 1.0000 2.0000 0.0000 Constraint 621 792 0.8000 1.0000 2.0000 0.0000 Constraint 621 784 0.8000 1.0000 2.0000 0.0000 Constraint 621 776 0.8000 1.0000 2.0000 0.0000 Constraint 621 768 0.8000 1.0000 2.0000 0.0000 Constraint 621 761 0.8000 1.0000 2.0000 0.0000 Constraint 621 751 0.8000 1.0000 2.0000 0.0000 Constraint 621 743 0.8000 1.0000 2.0000 0.0000 Constraint 621 735 0.8000 1.0000 2.0000 0.0000 Constraint 621 727 0.8000 1.0000 2.0000 0.0000 Constraint 621 719 0.8000 1.0000 2.0000 0.0000 Constraint 621 682 0.8000 1.0000 2.0000 0.0000 Constraint 621 674 0.8000 1.0000 2.0000 0.0000 Constraint 621 667 0.8000 1.0000 2.0000 0.0000 Constraint 621 659 0.8000 1.0000 2.0000 0.0000 Constraint 621 650 0.8000 1.0000 2.0000 0.0000 Constraint 621 641 0.8000 1.0000 2.0000 0.0000 Constraint 621 633 0.8000 1.0000 2.0000 0.0000 Constraint 621 627 0.8000 1.0000 2.0000 0.0000 Constraint 614 1051 0.8000 1.0000 2.0000 0.0000 Constraint 614 1043 0.8000 1.0000 2.0000 0.0000 Constraint 614 1033 0.8000 1.0000 2.0000 0.0000 Constraint 614 1026 0.8000 1.0000 2.0000 0.0000 Constraint 614 1019 0.8000 1.0000 2.0000 0.0000 Constraint 614 1011 0.8000 1.0000 2.0000 0.0000 Constraint 614 1003 0.8000 1.0000 2.0000 0.0000 Constraint 614 995 0.8000 1.0000 2.0000 0.0000 Constraint 614 987 0.8000 1.0000 2.0000 0.0000 Constraint 614 980 0.8000 1.0000 2.0000 0.0000 Constraint 614 951 0.8000 1.0000 2.0000 0.0000 Constraint 614 931 0.8000 1.0000 2.0000 0.0000 Constraint 614 911 0.8000 1.0000 2.0000 0.0000 Constraint 614 901 0.8000 1.0000 2.0000 0.0000 Constraint 614 872 0.8000 1.0000 2.0000 0.0000 Constraint 614 857 0.8000 1.0000 2.0000 0.0000 Constraint 614 849 0.8000 1.0000 2.0000 0.0000 Constraint 614 822 0.8000 1.0000 2.0000 0.0000 Constraint 614 808 0.8000 1.0000 2.0000 0.0000 Constraint 614 801 0.8000 1.0000 2.0000 0.0000 Constraint 614 792 0.8000 1.0000 2.0000 0.0000 Constraint 614 784 0.8000 1.0000 2.0000 0.0000 Constraint 614 761 0.8000 1.0000 2.0000 0.0000 Constraint 614 743 0.8000 1.0000 2.0000 0.0000 Constraint 614 727 0.8000 1.0000 2.0000 0.0000 Constraint 614 674 0.8000 1.0000 2.0000 0.0000 Constraint 614 667 0.8000 1.0000 2.0000 0.0000 Constraint 614 659 0.8000 1.0000 2.0000 0.0000 Constraint 614 650 0.8000 1.0000 2.0000 0.0000 Constraint 614 641 0.8000 1.0000 2.0000 0.0000 Constraint 614 633 0.8000 1.0000 2.0000 0.0000 Constraint 614 627 0.8000 1.0000 2.0000 0.0000 Constraint 614 621 0.8000 1.0000 2.0000 0.0000 Constraint 603 1051 0.8000 1.0000 2.0000 0.0000 Constraint 603 1043 0.8000 1.0000 2.0000 0.0000 Constraint 603 1033 0.8000 1.0000 2.0000 0.0000 Constraint 603 1026 0.8000 1.0000 2.0000 0.0000 Constraint 603 1019 0.8000 1.0000 2.0000 0.0000 Constraint 603 1011 0.8000 1.0000 2.0000 0.0000 Constraint 603 1003 0.8000 1.0000 2.0000 0.0000 Constraint 603 995 0.8000 1.0000 2.0000 0.0000 Constraint 603 987 0.8000 1.0000 2.0000 0.0000 Constraint 603 980 0.8000 1.0000 2.0000 0.0000 Constraint 603 960 0.8000 1.0000 2.0000 0.0000 Constraint 603 951 0.8000 1.0000 2.0000 0.0000 Constraint 603 943 0.8000 1.0000 2.0000 0.0000 Constraint 603 931 0.8000 1.0000 2.0000 0.0000 Constraint 603 919 0.8000 1.0000 2.0000 0.0000 Constraint 603 911 0.8000 1.0000 2.0000 0.0000 Constraint 603 857 0.8000 1.0000 2.0000 0.0000 Constraint 603 849 0.8000 1.0000 2.0000 0.0000 Constraint 603 808 0.8000 1.0000 2.0000 0.0000 Constraint 603 801 0.8000 1.0000 2.0000 0.0000 Constraint 603 784 0.8000 1.0000 2.0000 0.0000 Constraint 603 768 0.8000 1.0000 2.0000 0.0000 Constraint 603 761 0.8000 1.0000 2.0000 0.0000 Constraint 603 735 0.8000 1.0000 2.0000 0.0000 Constraint 603 727 0.8000 1.0000 2.0000 0.0000 Constraint 603 667 0.8000 1.0000 2.0000 0.0000 Constraint 603 659 0.8000 1.0000 2.0000 0.0000 Constraint 603 650 0.8000 1.0000 2.0000 0.0000 Constraint 603 641 0.8000 1.0000 2.0000 0.0000 Constraint 603 633 0.8000 1.0000 2.0000 0.0000 Constraint 603 627 0.8000 1.0000 2.0000 0.0000 Constraint 603 621 0.8000 1.0000 2.0000 0.0000 Constraint 603 614 0.8000 1.0000 2.0000 0.0000 Constraint 597 1051 0.8000 1.0000 2.0000 0.0000 Constraint 597 1043 0.8000 1.0000 2.0000 0.0000 Constraint 597 1033 0.8000 1.0000 2.0000 0.0000 Constraint 597 1026 0.8000 1.0000 2.0000 0.0000 Constraint 597 1019 0.8000 1.0000 2.0000 0.0000 Constraint 597 1011 0.8000 1.0000 2.0000 0.0000 Constraint 597 1003 0.8000 1.0000 2.0000 0.0000 Constraint 597 995 0.8000 1.0000 2.0000 0.0000 Constraint 597 987 0.8000 1.0000 2.0000 0.0000 Constraint 597 980 0.8000 1.0000 2.0000 0.0000 Constraint 597 972 0.8000 1.0000 2.0000 0.0000 Constraint 597 960 0.8000 1.0000 2.0000 0.0000 Constraint 597 951 0.8000 1.0000 2.0000 0.0000 Constraint 597 931 0.8000 1.0000 2.0000 0.0000 Constraint 597 919 0.8000 1.0000 2.0000 0.0000 Constraint 597 911 0.8000 1.0000 2.0000 0.0000 Constraint 597 872 0.8000 1.0000 2.0000 0.0000 Constraint 597 808 0.8000 1.0000 2.0000 0.0000 Constraint 597 801 0.8000 1.0000 2.0000 0.0000 Constraint 597 792 0.8000 1.0000 2.0000 0.0000 Constraint 597 784 0.8000 1.0000 2.0000 0.0000 Constraint 597 776 0.8000 1.0000 2.0000 0.0000 Constraint 597 768 0.8000 1.0000 2.0000 0.0000 Constraint 597 761 0.8000 1.0000 2.0000 0.0000 Constraint 597 735 0.8000 1.0000 2.0000 0.0000 Constraint 597 727 0.8000 1.0000 2.0000 0.0000 Constraint 597 706 0.8000 1.0000 2.0000 0.0000 Constraint 597 682 0.8000 1.0000 2.0000 0.0000 Constraint 597 674 0.8000 1.0000 2.0000 0.0000 Constraint 597 667 0.8000 1.0000 2.0000 0.0000 Constraint 597 659 0.8000 1.0000 2.0000 0.0000 Constraint 597 650 0.8000 1.0000 2.0000 0.0000 Constraint 597 641 0.8000 1.0000 2.0000 0.0000 Constraint 597 633 0.8000 1.0000 2.0000 0.0000 Constraint 597 627 0.8000 1.0000 2.0000 0.0000 Constraint 597 621 0.8000 1.0000 2.0000 0.0000 Constraint 597 614 0.8000 1.0000 2.0000 0.0000 Constraint 597 603 0.8000 1.0000 2.0000 0.0000 Constraint 590 1051 0.8000 1.0000 2.0000 0.0000 Constraint 590 1043 0.8000 1.0000 2.0000 0.0000 Constraint 590 1033 0.8000 1.0000 2.0000 0.0000 Constraint 590 1026 0.8000 1.0000 2.0000 0.0000 Constraint 590 1019 0.8000 1.0000 2.0000 0.0000 Constraint 590 1011 0.8000 1.0000 2.0000 0.0000 Constraint 590 1003 0.8000 1.0000 2.0000 0.0000 Constraint 590 995 0.8000 1.0000 2.0000 0.0000 Constraint 590 987 0.8000 1.0000 2.0000 0.0000 Constraint 590 980 0.8000 1.0000 2.0000 0.0000 Constraint 590 972 0.8000 1.0000 2.0000 0.0000 Constraint 590 960 0.8000 1.0000 2.0000 0.0000 Constraint 590 951 0.8000 1.0000 2.0000 0.0000 Constraint 590 931 0.8000 1.0000 2.0000 0.0000 Constraint 590 919 0.8000 1.0000 2.0000 0.0000 Constraint 590 911 0.8000 1.0000 2.0000 0.0000 Constraint 590 872 0.8000 1.0000 2.0000 0.0000 Constraint 590 822 0.8000 1.0000 2.0000 0.0000 Constraint 590 808 0.8000 1.0000 2.0000 0.0000 Constraint 590 801 0.8000 1.0000 2.0000 0.0000 Constraint 590 792 0.8000 1.0000 2.0000 0.0000 Constraint 590 784 0.8000 1.0000 2.0000 0.0000 Constraint 590 768 0.8000 1.0000 2.0000 0.0000 Constraint 590 761 0.8000 1.0000 2.0000 0.0000 Constraint 590 751 0.8000 1.0000 2.0000 0.0000 Constraint 590 727 0.8000 1.0000 2.0000 0.0000 Constraint 590 650 0.8000 1.0000 2.0000 0.0000 Constraint 590 641 0.8000 1.0000 2.0000 0.0000 Constraint 590 633 0.8000 1.0000 2.0000 0.0000 Constraint 590 627 0.8000 1.0000 2.0000 0.0000 Constraint 590 621 0.8000 1.0000 2.0000 0.0000 Constraint 590 614 0.8000 1.0000 2.0000 0.0000 Constraint 590 603 0.8000 1.0000 2.0000 0.0000 Constraint 590 597 0.8000 1.0000 2.0000 0.0000 Constraint 581 1051 0.8000 1.0000 2.0000 0.0000 Constraint 581 1043 0.8000 1.0000 2.0000 0.0000 Constraint 581 1033 0.8000 1.0000 2.0000 0.0000 Constraint 581 1026 0.8000 1.0000 2.0000 0.0000 Constraint 581 1019 0.8000 1.0000 2.0000 0.0000 Constraint 581 1011 0.8000 1.0000 2.0000 0.0000 Constraint 581 1003 0.8000 1.0000 2.0000 0.0000 Constraint 581 995 0.8000 1.0000 2.0000 0.0000 Constraint 581 987 0.8000 1.0000 2.0000 0.0000 Constraint 581 980 0.8000 1.0000 2.0000 0.0000 Constraint 581 972 0.8000 1.0000 2.0000 0.0000 Constraint 581 960 0.8000 1.0000 2.0000 0.0000 Constraint 581 951 0.8000 1.0000 2.0000 0.0000 Constraint 581 943 0.8000 1.0000 2.0000 0.0000 Constraint 581 931 0.8000 1.0000 2.0000 0.0000 Constraint 581 919 0.8000 1.0000 2.0000 0.0000 Constraint 581 911 0.8000 1.0000 2.0000 0.0000 Constraint 581 872 0.8000 1.0000 2.0000 0.0000 Constraint 581 857 0.8000 1.0000 2.0000 0.0000 Constraint 581 849 0.8000 1.0000 2.0000 0.0000 Constraint 581 822 0.8000 1.0000 2.0000 0.0000 Constraint 581 792 0.8000 1.0000 2.0000 0.0000 Constraint 581 784 0.8000 1.0000 2.0000 0.0000 Constraint 581 768 0.8000 1.0000 2.0000 0.0000 Constraint 581 761 0.8000 1.0000 2.0000 0.0000 Constraint 581 751 0.8000 1.0000 2.0000 0.0000 Constraint 581 735 0.8000 1.0000 2.0000 0.0000 Constraint 581 727 0.8000 1.0000 2.0000 0.0000 Constraint 581 706 0.8000 1.0000 2.0000 0.0000 Constraint 581 698 0.8000 1.0000 2.0000 0.0000 Constraint 581 682 0.8000 1.0000 2.0000 0.0000 Constraint 581 641 0.8000 1.0000 2.0000 0.0000 Constraint 581 633 0.8000 1.0000 2.0000 0.0000 Constraint 581 627 0.8000 1.0000 2.0000 0.0000 Constraint 581 621 0.8000 1.0000 2.0000 0.0000 Constraint 581 614 0.8000 1.0000 2.0000 0.0000 Constraint 581 603 0.8000 1.0000 2.0000 0.0000 Constraint 581 597 0.8000 1.0000 2.0000 0.0000 Constraint 581 590 0.8000 1.0000 2.0000 0.0000 Constraint 574 1051 0.8000 1.0000 2.0000 0.0000 Constraint 574 1043 0.8000 1.0000 2.0000 0.0000 Constraint 574 1033 0.8000 1.0000 2.0000 0.0000 Constraint 574 1026 0.8000 1.0000 2.0000 0.0000 Constraint 574 1019 0.8000 1.0000 2.0000 0.0000 Constraint 574 1011 0.8000 1.0000 2.0000 0.0000 Constraint 574 1003 0.8000 1.0000 2.0000 0.0000 Constraint 574 995 0.8000 1.0000 2.0000 0.0000 Constraint 574 987 0.8000 1.0000 2.0000 0.0000 Constraint 574 980 0.8000 1.0000 2.0000 0.0000 Constraint 574 972 0.8000 1.0000 2.0000 0.0000 Constraint 574 960 0.8000 1.0000 2.0000 0.0000 Constraint 574 951 0.8000 1.0000 2.0000 0.0000 Constraint 574 943 0.8000 1.0000 2.0000 0.0000 Constraint 574 931 0.8000 1.0000 2.0000 0.0000 Constraint 574 919 0.8000 1.0000 2.0000 0.0000 Constraint 574 911 0.8000 1.0000 2.0000 0.0000 Constraint 574 872 0.8000 1.0000 2.0000 0.0000 Constraint 574 857 0.8000 1.0000 2.0000 0.0000 Constraint 574 849 0.8000 1.0000 2.0000 0.0000 Constraint 574 808 0.8000 1.0000 2.0000 0.0000 Constraint 574 801 0.8000 1.0000 2.0000 0.0000 Constraint 574 792 0.8000 1.0000 2.0000 0.0000 Constraint 574 784 0.8000 1.0000 2.0000 0.0000 Constraint 574 776 0.8000 1.0000 2.0000 0.0000 Constraint 574 768 0.8000 1.0000 2.0000 0.0000 Constraint 574 761 0.8000 1.0000 2.0000 0.0000 Constraint 574 751 0.8000 1.0000 2.0000 0.0000 Constraint 574 735 0.8000 1.0000 2.0000 0.0000 Constraint 574 727 0.8000 1.0000 2.0000 0.0000 Constraint 574 719 0.8000 1.0000 2.0000 0.0000 Constraint 574 698 0.8000 1.0000 2.0000 0.0000 Constraint 574 633 0.8000 1.0000 2.0000 0.0000 Constraint 574 627 0.8000 1.0000 2.0000 0.0000 Constraint 574 621 0.8000 1.0000 2.0000 0.0000 Constraint 574 614 0.8000 1.0000 2.0000 0.0000 Constraint 574 603 0.8000 1.0000 2.0000 0.0000 Constraint 574 597 0.8000 1.0000 2.0000 0.0000 Constraint 574 590 0.8000 1.0000 2.0000 0.0000 Constraint 574 581 0.8000 1.0000 2.0000 0.0000 Constraint 567 1051 0.8000 1.0000 2.0000 0.0000 Constraint 567 1043 0.8000 1.0000 2.0000 0.0000 Constraint 567 1033 0.8000 1.0000 2.0000 0.0000 Constraint 567 1026 0.8000 1.0000 2.0000 0.0000 Constraint 567 1019 0.8000 1.0000 2.0000 0.0000 Constraint 567 1011 0.8000 1.0000 2.0000 0.0000 Constraint 567 1003 0.8000 1.0000 2.0000 0.0000 Constraint 567 995 0.8000 1.0000 2.0000 0.0000 Constraint 567 987 0.8000 1.0000 2.0000 0.0000 Constraint 567 980 0.8000 1.0000 2.0000 0.0000 Constraint 567 951 0.8000 1.0000 2.0000 0.0000 Constraint 567 931 0.8000 1.0000 2.0000 0.0000 Constraint 567 919 0.8000 1.0000 2.0000 0.0000 Constraint 567 911 0.8000 1.0000 2.0000 0.0000 Constraint 567 901 0.8000 1.0000 2.0000 0.0000 Constraint 567 891 0.8000 1.0000 2.0000 0.0000 Constraint 567 883 0.8000 1.0000 2.0000 0.0000 Constraint 567 872 0.8000 1.0000 2.0000 0.0000 Constraint 567 866 0.8000 1.0000 2.0000 0.0000 Constraint 567 857 0.8000 1.0000 2.0000 0.0000 Constraint 567 840 0.8000 1.0000 2.0000 0.0000 Constraint 567 808 0.8000 1.0000 2.0000 0.0000 Constraint 567 801 0.8000 1.0000 2.0000 0.0000 Constraint 567 792 0.8000 1.0000 2.0000 0.0000 Constraint 567 784 0.8000 1.0000 2.0000 0.0000 Constraint 567 776 0.8000 1.0000 2.0000 0.0000 Constraint 567 768 0.8000 1.0000 2.0000 0.0000 Constraint 567 761 0.8000 1.0000 2.0000 0.0000 Constraint 567 751 0.8000 1.0000 2.0000 0.0000 Constraint 567 735 0.8000 1.0000 2.0000 0.0000 Constraint 567 727 0.8000 1.0000 2.0000 0.0000 Constraint 567 719 0.8000 1.0000 2.0000 0.0000 Constraint 567 711 0.8000 1.0000 2.0000 0.0000 Constraint 567 706 0.8000 1.0000 2.0000 0.0000 Constraint 567 627 0.8000 1.0000 2.0000 0.0000 Constraint 567 621 0.8000 1.0000 2.0000 0.0000 Constraint 567 614 0.8000 1.0000 2.0000 0.0000 Constraint 567 603 0.8000 1.0000 2.0000 0.0000 Constraint 567 597 0.8000 1.0000 2.0000 0.0000 Constraint 567 590 0.8000 1.0000 2.0000 0.0000 Constraint 567 581 0.8000 1.0000 2.0000 0.0000 Constraint 567 574 0.8000 1.0000 2.0000 0.0000 Constraint 560 1051 0.8000 1.0000 2.0000 0.0000 Constraint 560 1043 0.8000 1.0000 2.0000 0.0000 Constraint 560 1033 0.8000 1.0000 2.0000 0.0000 Constraint 560 1026 0.8000 1.0000 2.0000 0.0000 Constraint 560 1019 0.8000 1.0000 2.0000 0.0000 Constraint 560 1011 0.8000 1.0000 2.0000 0.0000 Constraint 560 1003 0.8000 1.0000 2.0000 0.0000 Constraint 560 995 0.8000 1.0000 2.0000 0.0000 Constraint 560 987 0.8000 1.0000 2.0000 0.0000 Constraint 560 980 0.8000 1.0000 2.0000 0.0000 Constraint 560 960 0.8000 1.0000 2.0000 0.0000 Constraint 560 951 0.8000 1.0000 2.0000 0.0000 Constraint 560 931 0.8000 1.0000 2.0000 0.0000 Constraint 560 911 0.8000 1.0000 2.0000 0.0000 Constraint 560 901 0.8000 1.0000 2.0000 0.0000 Constraint 560 891 0.8000 1.0000 2.0000 0.0000 Constraint 560 883 0.8000 1.0000 2.0000 0.0000 Constraint 560 872 0.8000 1.0000 2.0000 0.0000 Constraint 560 866 0.8000 1.0000 2.0000 0.0000 Constraint 560 857 0.8000 1.0000 2.0000 0.0000 Constraint 560 840 0.8000 1.0000 2.0000 0.0000 Constraint 560 827 0.8000 1.0000 2.0000 0.0000 Constraint 560 822 0.8000 1.0000 2.0000 0.0000 Constraint 560 808 0.8000 1.0000 2.0000 0.0000 Constraint 560 801 0.8000 1.0000 2.0000 0.0000 Constraint 560 792 0.8000 1.0000 2.0000 0.0000 Constraint 560 784 0.8000 1.0000 2.0000 0.0000 Constraint 560 776 0.8000 1.0000 2.0000 0.0000 Constraint 560 768 0.8000 1.0000 2.0000 0.0000 Constraint 560 761 0.8000 1.0000 2.0000 0.0000 Constraint 560 751 0.8000 1.0000 2.0000 0.0000 Constraint 560 727 0.8000 1.0000 2.0000 0.0000 Constraint 560 719 0.8000 1.0000 2.0000 0.0000 Constraint 560 711 0.8000 1.0000 2.0000 0.0000 Constraint 560 706 0.8000 1.0000 2.0000 0.0000 Constraint 560 698 0.8000 1.0000 2.0000 0.0000 Constraint 560 690 0.8000 1.0000 2.0000 0.0000 Constraint 560 682 0.8000 1.0000 2.0000 0.0000 Constraint 560 621 0.8000 1.0000 2.0000 0.0000 Constraint 560 614 0.8000 1.0000 2.0000 0.0000 Constraint 560 603 0.8000 1.0000 2.0000 0.0000 Constraint 560 597 0.8000 1.0000 2.0000 0.0000 Constraint 560 590 0.8000 1.0000 2.0000 0.0000 Constraint 560 581 0.8000 1.0000 2.0000 0.0000 Constraint 560 574 0.8000 1.0000 2.0000 0.0000 Constraint 560 567 0.8000 1.0000 2.0000 0.0000 Constraint 552 1051 0.8000 1.0000 2.0000 0.0000 Constraint 552 1043 0.8000 1.0000 2.0000 0.0000 Constraint 552 1033 0.8000 1.0000 2.0000 0.0000 Constraint 552 1026 0.8000 1.0000 2.0000 0.0000 Constraint 552 1019 0.8000 1.0000 2.0000 0.0000 Constraint 552 1011 0.8000 1.0000 2.0000 0.0000 Constraint 552 1003 0.8000 1.0000 2.0000 0.0000 Constraint 552 995 0.8000 1.0000 2.0000 0.0000 Constraint 552 987 0.8000 1.0000 2.0000 0.0000 Constraint 552 980 0.8000 1.0000 2.0000 0.0000 Constraint 552 960 0.8000 1.0000 2.0000 0.0000 Constraint 552 951 0.8000 1.0000 2.0000 0.0000 Constraint 552 943 0.8000 1.0000 2.0000 0.0000 Constraint 552 931 0.8000 1.0000 2.0000 0.0000 Constraint 552 919 0.8000 1.0000 2.0000 0.0000 Constraint 552 891 0.8000 1.0000 2.0000 0.0000 Constraint 552 883 0.8000 1.0000 2.0000 0.0000 Constraint 552 872 0.8000 1.0000 2.0000 0.0000 Constraint 552 866 0.8000 1.0000 2.0000 0.0000 Constraint 552 857 0.8000 1.0000 2.0000 0.0000 Constraint 552 840 0.8000 1.0000 2.0000 0.0000 Constraint 552 827 0.8000 1.0000 2.0000 0.0000 Constraint 552 822 0.8000 1.0000 2.0000 0.0000 Constraint 552 792 0.8000 1.0000 2.0000 0.0000 Constraint 552 784 0.8000 1.0000 2.0000 0.0000 Constraint 552 768 0.8000 1.0000 2.0000 0.0000 Constraint 552 761 0.8000 1.0000 2.0000 0.0000 Constraint 552 751 0.8000 1.0000 2.0000 0.0000 Constraint 552 743 0.8000 1.0000 2.0000 0.0000 Constraint 552 735 0.8000 1.0000 2.0000 0.0000 Constraint 552 727 0.8000 1.0000 2.0000 0.0000 Constraint 552 719 0.8000 1.0000 2.0000 0.0000 Constraint 552 711 0.8000 1.0000 2.0000 0.0000 Constraint 552 706 0.8000 1.0000 2.0000 0.0000 Constraint 552 698 0.8000 1.0000 2.0000 0.0000 Constraint 552 690 0.8000 1.0000 2.0000 0.0000 Constraint 552 682 0.8000 1.0000 2.0000 0.0000 Constraint 552 674 0.8000 1.0000 2.0000 0.0000 Constraint 552 659 0.8000 1.0000 2.0000 0.0000 Constraint 552 650 0.8000 1.0000 2.0000 0.0000 Constraint 552 641 0.8000 1.0000 2.0000 0.0000 Constraint 552 621 0.8000 1.0000 2.0000 0.0000 Constraint 552 614 0.8000 1.0000 2.0000 0.0000 Constraint 552 603 0.8000 1.0000 2.0000 0.0000 Constraint 552 597 0.8000 1.0000 2.0000 0.0000 Constraint 552 590 0.8000 1.0000 2.0000 0.0000 Constraint 552 581 0.8000 1.0000 2.0000 0.0000 Constraint 552 574 0.8000 1.0000 2.0000 0.0000 Constraint 552 567 0.8000 1.0000 2.0000 0.0000 Constraint 552 560 0.8000 1.0000 2.0000 0.0000 Constraint 547 1051 0.8000 1.0000 2.0000 0.0000 Constraint 547 1043 0.8000 1.0000 2.0000 0.0000 Constraint 547 1033 0.8000 1.0000 2.0000 0.0000 Constraint 547 1026 0.8000 1.0000 2.0000 0.0000 Constraint 547 1019 0.8000 1.0000 2.0000 0.0000 Constraint 547 1011 0.8000 1.0000 2.0000 0.0000 Constraint 547 1003 0.8000 1.0000 2.0000 0.0000 Constraint 547 995 0.8000 1.0000 2.0000 0.0000 Constraint 547 987 0.8000 1.0000 2.0000 0.0000 Constraint 547 980 0.8000 1.0000 2.0000 0.0000 Constraint 547 972 0.8000 1.0000 2.0000 0.0000 Constraint 547 960 0.8000 1.0000 2.0000 0.0000 Constraint 547 951 0.8000 1.0000 2.0000 0.0000 Constraint 547 943 0.8000 1.0000 2.0000 0.0000 Constraint 547 931 0.8000 1.0000 2.0000 0.0000 Constraint 547 919 0.8000 1.0000 2.0000 0.0000 Constraint 547 891 0.8000 1.0000 2.0000 0.0000 Constraint 547 883 0.8000 1.0000 2.0000 0.0000 Constraint 547 872 0.8000 1.0000 2.0000 0.0000 Constraint 547 866 0.8000 1.0000 2.0000 0.0000 Constraint 547 857 0.8000 1.0000 2.0000 0.0000 Constraint 547 849 0.8000 1.0000 2.0000 0.0000 Constraint 547 840 0.8000 1.0000 2.0000 0.0000 Constraint 547 827 0.8000 1.0000 2.0000 0.0000 Constraint 547 822 0.8000 1.0000 2.0000 0.0000 Constraint 547 814 0.8000 1.0000 2.0000 0.0000 Constraint 547 801 0.8000 1.0000 2.0000 0.0000 Constraint 547 792 0.8000 1.0000 2.0000 0.0000 Constraint 547 784 0.8000 1.0000 2.0000 0.0000 Constraint 547 776 0.8000 1.0000 2.0000 0.0000 Constraint 547 768 0.8000 1.0000 2.0000 0.0000 Constraint 547 761 0.8000 1.0000 2.0000 0.0000 Constraint 547 751 0.8000 1.0000 2.0000 0.0000 Constraint 547 743 0.8000 1.0000 2.0000 0.0000 Constraint 547 735 0.8000 1.0000 2.0000 0.0000 Constraint 547 727 0.8000 1.0000 2.0000 0.0000 Constraint 547 719 0.8000 1.0000 2.0000 0.0000 Constraint 547 711 0.8000 1.0000 2.0000 0.0000 Constraint 547 706 0.8000 1.0000 2.0000 0.0000 Constraint 547 698 0.8000 1.0000 2.0000 0.0000 Constraint 547 690 0.8000 1.0000 2.0000 0.0000 Constraint 547 682 0.8000 1.0000 2.0000 0.0000 Constraint 547 674 0.8000 1.0000 2.0000 0.0000 Constraint 547 603 0.8000 1.0000 2.0000 0.0000 Constraint 547 597 0.8000 1.0000 2.0000 0.0000 Constraint 547 590 0.8000 1.0000 2.0000 0.0000 Constraint 547 581 0.8000 1.0000 2.0000 0.0000 Constraint 547 574 0.8000 1.0000 2.0000 0.0000 Constraint 547 567 0.8000 1.0000 2.0000 0.0000 Constraint 547 560 0.8000 1.0000 2.0000 0.0000 Constraint 547 552 0.8000 1.0000 2.0000 0.0000 Constraint 539 1051 0.8000 1.0000 2.0000 0.0000 Constraint 539 1043 0.8000 1.0000 2.0000 0.0000 Constraint 539 1033 0.8000 1.0000 2.0000 0.0000 Constraint 539 1026 0.8000 1.0000 2.0000 0.0000 Constraint 539 1019 0.8000 1.0000 2.0000 0.0000 Constraint 539 1011 0.8000 1.0000 2.0000 0.0000 Constraint 539 1003 0.8000 1.0000 2.0000 0.0000 Constraint 539 995 0.8000 1.0000 2.0000 0.0000 Constraint 539 987 0.8000 1.0000 2.0000 0.0000 Constraint 539 980 0.8000 1.0000 2.0000 0.0000 Constraint 539 972 0.8000 1.0000 2.0000 0.0000 Constraint 539 960 0.8000 1.0000 2.0000 0.0000 Constraint 539 951 0.8000 1.0000 2.0000 0.0000 Constraint 539 943 0.8000 1.0000 2.0000 0.0000 Constraint 539 931 0.8000 1.0000 2.0000 0.0000 Constraint 539 883 0.8000 1.0000 2.0000 0.0000 Constraint 539 872 0.8000 1.0000 2.0000 0.0000 Constraint 539 866 0.8000 1.0000 2.0000 0.0000 Constraint 539 857 0.8000 1.0000 2.0000 0.0000 Constraint 539 849 0.8000 1.0000 2.0000 0.0000 Constraint 539 840 0.8000 1.0000 2.0000 0.0000 Constraint 539 827 0.8000 1.0000 2.0000 0.0000 Constraint 539 822 0.8000 1.0000 2.0000 0.0000 Constraint 539 814 0.8000 1.0000 2.0000 0.0000 Constraint 539 808 0.8000 1.0000 2.0000 0.0000 Constraint 539 801 0.8000 1.0000 2.0000 0.0000 Constraint 539 792 0.8000 1.0000 2.0000 0.0000 Constraint 539 784 0.8000 1.0000 2.0000 0.0000 Constraint 539 776 0.8000 1.0000 2.0000 0.0000 Constraint 539 768 0.8000 1.0000 2.0000 0.0000 Constraint 539 761 0.8000 1.0000 2.0000 0.0000 Constraint 539 751 0.8000 1.0000 2.0000 0.0000 Constraint 539 735 0.8000 1.0000 2.0000 0.0000 Constraint 539 727 0.8000 1.0000 2.0000 0.0000 Constraint 539 719 0.8000 1.0000 2.0000 0.0000 Constraint 539 711 0.8000 1.0000 2.0000 0.0000 Constraint 539 706 0.8000 1.0000 2.0000 0.0000 Constraint 539 698 0.8000 1.0000 2.0000 0.0000 Constraint 539 682 0.8000 1.0000 2.0000 0.0000 Constraint 539 674 0.8000 1.0000 2.0000 0.0000 Constraint 539 650 0.8000 1.0000 2.0000 0.0000 Constraint 539 621 0.8000 1.0000 2.0000 0.0000 Constraint 539 597 0.8000 1.0000 2.0000 0.0000 Constraint 539 590 0.8000 1.0000 2.0000 0.0000 Constraint 539 581 0.8000 1.0000 2.0000 0.0000 Constraint 539 574 0.8000 1.0000 2.0000 0.0000 Constraint 539 567 0.8000 1.0000 2.0000 0.0000 Constraint 539 560 0.8000 1.0000 2.0000 0.0000 Constraint 539 552 0.8000 1.0000 2.0000 0.0000 Constraint 539 547 0.8000 1.0000 2.0000 0.0000 Constraint 531 1051 0.8000 1.0000 2.0000 0.0000 Constraint 531 1043 0.8000 1.0000 2.0000 0.0000 Constraint 531 1033 0.8000 1.0000 2.0000 0.0000 Constraint 531 1026 0.8000 1.0000 2.0000 0.0000 Constraint 531 1019 0.8000 1.0000 2.0000 0.0000 Constraint 531 1011 0.8000 1.0000 2.0000 0.0000 Constraint 531 995 0.8000 1.0000 2.0000 0.0000 Constraint 531 987 0.8000 1.0000 2.0000 0.0000 Constraint 531 980 0.8000 1.0000 2.0000 0.0000 Constraint 531 960 0.8000 1.0000 2.0000 0.0000 Constraint 531 951 0.8000 1.0000 2.0000 0.0000 Constraint 531 943 0.8000 1.0000 2.0000 0.0000 Constraint 531 931 0.8000 1.0000 2.0000 0.0000 Constraint 531 919 0.8000 1.0000 2.0000 0.0000 Constraint 531 901 0.8000 1.0000 2.0000 0.0000 Constraint 531 891 0.8000 1.0000 2.0000 0.0000 Constraint 531 883 0.8000 1.0000 2.0000 0.0000 Constraint 531 872 0.8000 1.0000 2.0000 0.0000 Constraint 531 866 0.8000 1.0000 2.0000 0.0000 Constraint 531 857 0.8000 1.0000 2.0000 0.0000 Constraint 531 849 0.8000 1.0000 2.0000 0.0000 Constraint 531 840 0.8000 1.0000 2.0000 0.0000 Constraint 531 827 0.8000 1.0000 2.0000 0.0000 Constraint 531 822 0.8000 1.0000 2.0000 0.0000 Constraint 531 808 0.8000 1.0000 2.0000 0.0000 Constraint 531 801 0.8000 1.0000 2.0000 0.0000 Constraint 531 792 0.8000 1.0000 2.0000 0.0000 Constraint 531 784 0.8000 1.0000 2.0000 0.0000 Constraint 531 768 0.8000 1.0000 2.0000 0.0000 Constraint 531 761 0.8000 1.0000 2.0000 0.0000 Constraint 531 735 0.8000 1.0000 2.0000 0.0000 Constraint 531 727 0.8000 1.0000 2.0000 0.0000 Constraint 531 711 0.8000 1.0000 2.0000 0.0000 Constraint 531 706 0.8000 1.0000 2.0000 0.0000 Constraint 531 698 0.8000 1.0000 2.0000 0.0000 Constraint 531 690 0.8000 1.0000 2.0000 0.0000 Constraint 531 682 0.8000 1.0000 2.0000 0.0000 Constraint 531 674 0.8000 1.0000 2.0000 0.0000 Constraint 531 621 0.8000 1.0000 2.0000 0.0000 Constraint 531 590 0.8000 1.0000 2.0000 0.0000 Constraint 531 581 0.8000 1.0000 2.0000 0.0000 Constraint 531 574 0.8000 1.0000 2.0000 0.0000 Constraint 531 567 0.8000 1.0000 2.0000 0.0000 Constraint 531 560 0.8000 1.0000 2.0000 0.0000 Constraint 531 552 0.8000 1.0000 2.0000 0.0000 Constraint 531 547 0.8000 1.0000 2.0000 0.0000 Constraint 531 539 0.8000 1.0000 2.0000 0.0000 Constraint 519 1051 0.8000 1.0000 2.0000 0.0000 Constraint 519 1043 0.8000 1.0000 2.0000 0.0000 Constraint 519 1033 0.8000 1.0000 2.0000 0.0000 Constraint 519 1026 0.8000 1.0000 2.0000 0.0000 Constraint 519 1019 0.8000 1.0000 2.0000 0.0000 Constraint 519 1011 0.8000 1.0000 2.0000 0.0000 Constraint 519 1003 0.8000 1.0000 2.0000 0.0000 Constraint 519 995 0.8000 1.0000 2.0000 0.0000 Constraint 519 987 0.8000 1.0000 2.0000 0.0000 Constraint 519 980 0.8000 1.0000 2.0000 0.0000 Constraint 519 972 0.8000 1.0000 2.0000 0.0000 Constraint 519 960 0.8000 1.0000 2.0000 0.0000 Constraint 519 951 0.8000 1.0000 2.0000 0.0000 Constraint 519 943 0.8000 1.0000 2.0000 0.0000 Constraint 519 931 0.8000 1.0000 2.0000 0.0000 Constraint 519 919 0.8000 1.0000 2.0000 0.0000 Constraint 519 911 0.8000 1.0000 2.0000 0.0000 Constraint 519 901 0.8000 1.0000 2.0000 0.0000 Constraint 519 891 0.8000 1.0000 2.0000 0.0000 Constraint 519 883 0.8000 1.0000 2.0000 0.0000 Constraint 519 872 0.8000 1.0000 2.0000 0.0000 Constraint 519 866 0.8000 1.0000 2.0000 0.0000 Constraint 519 857 0.8000 1.0000 2.0000 0.0000 Constraint 519 849 0.8000 1.0000 2.0000 0.0000 Constraint 519 840 0.8000 1.0000 2.0000 0.0000 Constraint 519 827 0.8000 1.0000 2.0000 0.0000 Constraint 519 822 0.8000 1.0000 2.0000 0.0000 Constraint 519 808 0.8000 1.0000 2.0000 0.0000 Constraint 519 801 0.8000 1.0000 2.0000 0.0000 Constraint 519 792 0.8000 1.0000 2.0000 0.0000 Constraint 519 784 0.8000 1.0000 2.0000 0.0000 Constraint 519 776 0.8000 1.0000 2.0000 0.0000 Constraint 519 768 0.8000 1.0000 2.0000 0.0000 Constraint 519 761 0.8000 1.0000 2.0000 0.0000 Constraint 519 751 0.8000 1.0000 2.0000 0.0000 Constraint 519 743 0.8000 1.0000 2.0000 0.0000 Constraint 519 735 0.8000 1.0000 2.0000 0.0000 Constraint 519 727 0.8000 1.0000 2.0000 0.0000 Constraint 519 698 0.8000 1.0000 2.0000 0.0000 Constraint 519 690 0.8000 1.0000 2.0000 0.0000 Constraint 519 682 0.8000 1.0000 2.0000 0.0000 Constraint 519 574 0.8000 1.0000 2.0000 0.0000 Constraint 519 567 0.8000 1.0000 2.0000 0.0000 Constraint 519 560 0.8000 1.0000 2.0000 0.0000 Constraint 519 552 0.8000 1.0000 2.0000 0.0000 Constraint 519 547 0.8000 1.0000 2.0000 0.0000 Constraint 519 539 0.8000 1.0000 2.0000 0.0000 Constraint 519 531 0.8000 1.0000 2.0000 0.0000 Constraint 510 1051 0.8000 1.0000 2.0000 0.0000 Constraint 510 1043 0.8000 1.0000 2.0000 0.0000 Constraint 510 1033 0.8000 1.0000 2.0000 0.0000 Constraint 510 1026 0.8000 1.0000 2.0000 0.0000 Constraint 510 1019 0.8000 1.0000 2.0000 0.0000 Constraint 510 1011 0.8000 1.0000 2.0000 0.0000 Constraint 510 1003 0.8000 1.0000 2.0000 0.0000 Constraint 510 995 0.8000 1.0000 2.0000 0.0000 Constraint 510 987 0.8000 1.0000 2.0000 0.0000 Constraint 510 980 0.8000 1.0000 2.0000 0.0000 Constraint 510 972 0.8000 1.0000 2.0000 0.0000 Constraint 510 960 0.8000 1.0000 2.0000 0.0000 Constraint 510 951 0.8000 1.0000 2.0000 0.0000 Constraint 510 943 0.8000 1.0000 2.0000 0.0000 Constraint 510 931 0.8000 1.0000 2.0000 0.0000 Constraint 510 919 0.8000 1.0000 2.0000 0.0000 Constraint 510 911 0.8000 1.0000 2.0000 0.0000 Constraint 510 901 0.8000 1.0000 2.0000 0.0000 Constraint 510 891 0.8000 1.0000 2.0000 0.0000 Constraint 510 883 0.8000 1.0000 2.0000 0.0000 Constraint 510 872 0.8000 1.0000 2.0000 0.0000 Constraint 510 866 0.8000 1.0000 2.0000 0.0000 Constraint 510 857 0.8000 1.0000 2.0000 0.0000 Constraint 510 849 0.8000 1.0000 2.0000 0.0000 Constraint 510 840 0.8000 1.0000 2.0000 0.0000 Constraint 510 822 0.8000 1.0000 2.0000 0.0000 Constraint 510 814 0.8000 1.0000 2.0000 0.0000 Constraint 510 808 0.8000 1.0000 2.0000 0.0000 Constraint 510 801 0.8000 1.0000 2.0000 0.0000 Constraint 510 792 0.8000 1.0000 2.0000 0.0000 Constraint 510 784 0.8000 1.0000 2.0000 0.0000 Constraint 510 776 0.8000 1.0000 2.0000 0.0000 Constraint 510 768 0.8000 1.0000 2.0000 0.0000 Constraint 510 761 0.8000 1.0000 2.0000 0.0000 Constraint 510 751 0.8000 1.0000 2.0000 0.0000 Constraint 510 735 0.8000 1.0000 2.0000 0.0000 Constraint 510 727 0.8000 1.0000 2.0000 0.0000 Constraint 510 719 0.8000 1.0000 2.0000 0.0000 Constraint 510 711 0.8000 1.0000 2.0000 0.0000 Constraint 510 706 0.8000 1.0000 2.0000 0.0000 Constraint 510 698 0.8000 1.0000 2.0000 0.0000 Constraint 510 690 0.8000 1.0000 2.0000 0.0000 Constraint 510 682 0.8000 1.0000 2.0000 0.0000 Constraint 510 674 0.8000 1.0000 2.0000 0.0000 Constraint 510 667 0.8000 1.0000 2.0000 0.0000 Constraint 510 659 0.8000 1.0000 2.0000 0.0000 Constraint 510 633 0.8000 1.0000 2.0000 0.0000 Constraint 510 627 0.8000 1.0000 2.0000 0.0000 Constraint 510 621 0.8000 1.0000 2.0000 0.0000 Constraint 510 614 0.8000 1.0000 2.0000 0.0000 Constraint 510 603 0.8000 1.0000 2.0000 0.0000 Constraint 510 597 0.8000 1.0000 2.0000 0.0000 Constraint 510 590 0.8000 1.0000 2.0000 0.0000 Constraint 510 574 0.8000 1.0000 2.0000 0.0000 Constraint 510 567 0.8000 1.0000 2.0000 0.0000 Constraint 510 560 0.8000 1.0000 2.0000 0.0000 Constraint 510 552 0.8000 1.0000 2.0000 0.0000 Constraint 510 547 0.8000 1.0000 2.0000 0.0000 Constraint 510 539 0.8000 1.0000 2.0000 0.0000 Constraint 510 531 0.8000 1.0000 2.0000 0.0000 Constraint 510 519 0.8000 1.0000 2.0000 0.0000 Constraint 505 1051 0.8000 1.0000 2.0000 0.0000 Constraint 505 1043 0.8000 1.0000 2.0000 0.0000 Constraint 505 1033 0.8000 1.0000 2.0000 0.0000 Constraint 505 1026 0.8000 1.0000 2.0000 0.0000 Constraint 505 1019 0.8000 1.0000 2.0000 0.0000 Constraint 505 1011 0.8000 1.0000 2.0000 0.0000 Constraint 505 1003 0.8000 1.0000 2.0000 0.0000 Constraint 505 995 0.8000 1.0000 2.0000 0.0000 Constraint 505 987 0.8000 1.0000 2.0000 0.0000 Constraint 505 980 0.8000 1.0000 2.0000 0.0000 Constraint 505 972 0.8000 1.0000 2.0000 0.0000 Constraint 505 960 0.8000 1.0000 2.0000 0.0000 Constraint 505 951 0.8000 1.0000 2.0000 0.0000 Constraint 505 943 0.8000 1.0000 2.0000 0.0000 Constraint 505 931 0.8000 1.0000 2.0000 0.0000 Constraint 505 919 0.8000 1.0000 2.0000 0.0000 Constraint 505 911 0.8000 1.0000 2.0000 0.0000 Constraint 505 901 0.8000 1.0000 2.0000 0.0000 Constraint 505 891 0.8000 1.0000 2.0000 0.0000 Constraint 505 883 0.8000 1.0000 2.0000 0.0000 Constraint 505 872 0.8000 1.0000 2.0000 0.0000 Constraint 505 866 0.8000 1.0000 2.0000 0.0000 Constraint 505 857 0.8000 1.0000 2.0000 0.0000 Constraint 505 849 0.8000 1.0000 2.0000 0.0000 Constraint 505 840 0.8000 1.0000 2.0000 0.0000 Constraint 505 827 0.8000 1.0000 2.0000 0.0000 Constraint 505 822 0.8000 1.0000 2.0000 0.0000 Constraint 505 814 0.8000 1.0000 2.0000 0.0000 Constraint 505 808 0.8000 1.0000 2.0000 0.0000 Constraint 505 792 0.8000 1.0000 2.0000 0.0000 Constraint 505 784 0.8000 1.0000 2.0000 0.0000 Constraint 505 776 0.8000 1.0000 2.0000 0.0000 Constraint 505 761 0.8000 1.0000 2.0000 0.0000 Constraint 505 751 0.8000 1.0000 2.0000 0.0000 Constraint 505 735 0.8000 1.0000 2.0000 0.0000 Constraint 505 711 0.8000 1.0000 2.0000 0.0000 Constraint 505 690 0.8000 1.0000 2.0000 0.0000 Constraint 505 682 0.8000 1.0000 2.0000 0.0000 Constraint 505 674 0.8000 1.0000 2.0000 0.0000 Constraint 505 667 0.8000 1.0000 2.0000 0.0000 Constraint 505 627 0.8000 1.0000 2.0000 0.0000 Constraint 505 614 0.8000 1.0000 2.0000 0.0000 Constraint 505 574 0.8000 1.0000 2.0000 0.0000 Constraint 505 560 0.8000 1.0000 2.0000 0.0000 Constraint 505 552 0.8000 1.0000 2.0000 0.0000 Constraint 505 547 0.8000 1.0000 2.0000 0.0000 Constraint 505 539 0.8000 1.0000 2.0000 0.0000 Constraint 505 531 0.8000 1.0000 2.0000 0.0000 Constraint 505 519 0.8000 1.0000 2.0000 0.0000 Constraint 505 510 0.8000 1.0000 2.0000 0.0000 Constraint 500 1051 0.8000 1.0000 2.0000 0.0000 Constraint 500 1043 0.8000 1.0000 2.0000 0.0000 Constraint 500 1033 0.8000 1.0000 2.0000 0.0000 Constraint 500 1026 0.8000 1.0000 2.0000 0.0000 Constraint 500 1019 0.8000 1.0000 2.0000 0.0000 Constraint 500 1011 0.8000 1.0000 2.0000 0.0000 Constraint 500 1003 0.8000 1.0000 2.0000 0.0000 Constraint 500 995 0.8000 1.0000 2.0000 0.0000 Constraint 500 987 0.8000 1.0000 2.0000 0.0000 Constraint 500 980 0.8000 1.0000 2.0000 0.0000 Constraint 500 972 0.8000 1.0000 2.0000 0.0000 Constraint 500 960 0.8000 1.0000 2.0000 0.0000 Constraint 500 951 0.8000 1.0000 2.0000 0.0000 Constraint 500 943 0.8000 1.0000 2.0000 0.0000 Constraint 500 931 0.8000 1.0000 2.0000 0.0000 Constraint 500 919 0.8000 1.0000 2.0000 0.0000 Constraint 500 911 0.8000 1.0000 2.0000 0.0000 Constraint 500 901 0.8000 1.0000 2.0000 0.0000 Constraint 500 891 0.8000 1.0000 2.0000 0.0000 Constraint 500 883 0.8000 1.0000 2.0000 0.0000 Constraint 500 872 0.8000 1.0000 2.0000 0.0000 Constraint 500 866 0.8000 1.0000 2.0000 0.0000 Constraint 500 857 0.8000 1.0000 2.0000 0.0000 Constraint 500 849 0.8000 1.0000 2.0000 0.0000 Constraint 500 840 0.8000 1.0000 2.0000 0.0000 Constraint 500 827 0.8000 1.0000 2.0000 0.0000 Constraint 500 822 0.8000 1.0000 2.0000 0.0000 Constraint 500 814 0.8000 1.0000 2.0000 0.0000 Constraint 500 808 0.8000 1.0000 2.0000 0.0000 Constraint 500 801 0.8000 1.0000 2.0000 0.0000 Constraint 500 792 0.8000 1.0000 2.0000 0.0000 Constraint 500 784 0.8000 1.0000 2.0000 0.0000 Constraint 500 761 0.8000 1.0000 2.0000 0.0000 Constraint 500 641 0.8000 1.0000 2.0000 0.0000 Constraint 500 574 0.8000 1.0000 2.0000 0.0000 Constraint 500 552 0.8000 1.0000 2.0000 0.0000 Constraint 500 547 0.8000 1.0000 2.0000 0.0000 Constraint 500 539 0.8000 1.0000 2.0000 0.0000 Constraint 500 531 0.8000 1.0000 2.0000 0.0000 Constraint 500 519 0.8000 1.0000 2.0000 0.0000 Constraint 500 510 0.8000 1.0000 2.0000 0.0000 Constraint 500 505 0.8000 1.0000 2.0000 0.0000 Constraint 493 1051 0.8000 1.0000 2.0000 0.0000 Constraint 493 1043 0.8000 1.0000 2.0000 0.0000 Constraint 493 1033 0.8000 1.0000 2.0000 0.0000 Constraint 493 1026 0.8000 1.0000 2.0000 0.0000 Constraint 493 1019 0.8000 1.0000 2.0000 0.0000 Constraint 493 1011 0.8000 1.0000 2.0000 0.0000 Constraint 493 1003 0.8000 1.0000 2.0000 0.0000 Constraint 493 995 0.8000 1.0000 2.0000 0.0000 Constraint 493 987 0.8000 1.0000 2.0000 0.0000 Constraint 493 980 0.8000 1.0000 2.0000 0.0000 Constraint 493 972 0.8000 1.0000 2.0000 0.0000 Constraint 493 960 0.8000 1.0000 2.0000 0.0000 Constraint 493 951 0.8000 1.0000 2.0000 0.0000 Constraint 493 891 0.8000 1.0000 2.0000 0.0000 Constraint 493 883 0.8000 1.0000 2.0000 0.0000 Constraint 493 872 0.8000 1.0000 2.0000 0.0000 Constraint 493 866 0.8000 1.0000 2.0000 0.0000 Constraint 493 857 0.8000 1.0000 2.0000 0.0000 Constraint 493 849 0.8000 1.0000 2.0000 0.0000 Constraint 493 814 0.8000 1.0000 2.0000 0.0000 Constraint 493 808 0.8000 1.0000 2.0000 0.0000 Constraint 493 801 0.8000 1.0000 2.0000 0.0000 Constraint 493 792 0.8000 1.0000 2.0000 0.0000 Constraint 493 784 0.8000 1.0000 2.0000 0.0000 Constraint 493 761 0.8000 1.0000 2.0000 0.0000 Constraint 493 706 0.8000 1.0000 2.0000 0.0000 Constraint 493 698 0.8000 1.0000 2.0000 0.0000 Constraint 493 690 0.8000 1.0000 2.0000 0.0000 Constraint 493 682 0.8000 1.0000 2.0000 0.0000 Constraint 493 641 0.8000 1.0000 2.0000 0.0000 Constraint 493 627 0.8000 1.0000 2.0000 0.0000 Constraint 493 614 0.8000 1.0000 2.0000 0.0000 Constraint 493 597 0.8000 1.0000 2.0000 0.0000 Constraint 493 552 0.8000 1.0000 2.0000 0.0000 Constraint 493 547 0.8000 1.0000 2.0000 0.0000 Constraint 493 539 0.8000 1.0000 2.0000 0.0000 Constraint 493 531 0.8000 1.0000 2.0000 0.0000 Constraint 493 519 0.8000 1.0000 2.0000 0.0000 Constraint 493 510 0.8000 1.0000 2.0000 0.0000 Constraint 493 505 0.8000 1.0000 2.0000 0.0000 Constraint 493 500 0.8000 1.0000 2.0000 0.0000 Constraint 486 1051 0.8000 1.0000 2.0000 0.0000 Constraint 486 1043 0.8000 1.0000 2.0000 0.0000 Constraint 486 1033 0.8000 1.0000 2.0000 0.0000 Constraint 486 1026 0.8000 1.0000 2.0000 0.0000 Constraint 486 1019 0.8000 1.0000 2.0000 0.0000 Constraint 486 1011 0.8000 1.0000 2.0000 0.0000 Constraint 486 1003 0.8000 1.0000 2.0000 0.0000 Constraint 486 995 0.8000 1.0000 2.0000 0.0000 Constraint 486 987 0.8000 1.0000 2.0000 0.0000 Constraint 486 980 0.8000 1.0000 2.0000 0.0000 Constraint 486 972 0.8000 1.0000 2.0000 0.0000 Constraint 486 960 0.8000 1.0000 2.0000 0.0000 Constraint 486 911 0.8000 1.0000 2.0000 0.0000 Constraint 486 901 0.8000 1.0000 2.0000 0.0000 Constraint 486 891 0.8000 1.0000 2.0000 0.0000 Constraint 486 883 0.8000 1.0000 2.0000 0.0000 Constraint 486 872 0.8000 1.0000 2.0000 0.0000 Constraint 486 866 0.8000 1.0000 2.0000 0.0000 Constraint 486 857 0.8000 1.0000 2.0000 0.0000 Constraint 486 849 0.8000 1.0000 2.0000 0.0000 Constraint 486 840 0.8000 1.0000 2.0000 0.0000 Constraint 486 827 0.8000 1.0000 2.0000 0.0000 Constraint 486 814 0.8000 1.0000 2.0000 0.0000 Constraint 486 808 0.8000 1.0000 2.0000 0.0000 Constraint 486 801 0.8000 1.0000 2.0000 0.0000 Constraint 486 792 0.8000 1.0000 2.0000 0.0000 Constraint 486 706 0.8000 1.0000 2.0000 0.0000 Constraint 486 698 0.8000 1.0000 2.0000 0.0000 Constraint 486 690 0.8000 1.0000 2.0000 0.0000 Constraint 486 682 0.8000 1.0000 2.0000 0.0000 Constraint 486 674 0.8000 1.0000 2.0000 0.0000 Constraint 486 667 0.8000 1.0000 2.0000 0.0000 Constraint 486 650 0.8000 1.0000 2.0000 0.0000 Constraint 486 641 0.8000 1.0000 2.0000 0.0000 Constraint 486 627 0.8000 1.0000 2.0000 0.0000 Constraint 486 539 0.8000 1.0000 2.0000 0.0000 Constraint 486 531 0.8000 1.0000 2.0000 0.0000 Constraint 486 519 0.8000 1.0000 2.0000 0.0000 Constraint 486 510 0.8000 1.0000 2.0000 0.0000 Constraint 486 505 0.8000 1.0000 2.0000 0.0000 Constraint 486 500 0.8000 1.0000 2.0000 0.0000 Constraint 486 493 0.8000 1.0000 2.0000 0.0000 Constraint 478 1051 0.8000 1.0000 2.0000 0.0000 Constraint 478 1043 0.8000 1.0000 2.0000 0.0000 Constraint 478 1033 0.8000 1.0000 2.0000 0.0000 Constraint 478 1026 0.8000 1.0000 2.0000 0.0000 Constraint 478 1019 0.8000 1.0000 2.0000 0.0000 Constraint 478 1011 0.8000 1.0000 2.0000 0.0000 Constraint 478 1003 0.8000 1.0000 2.0000 0.0000 Constraint 478 995 0.8000 1.0000 2.0000 0.0000 Constraint 478 987 0.8000 1.0000 2.0000 0.0000 Constraint 478 980 0.8000 1.0000 2.0000 0.0000 Constraint 478 972 0.8000 1.0000 2.0000 0.0000 Constraint 478 960 0.8000 1.0000 2.0000 0.0000 Constraint 478 911 0.8000 1.0000 2.0000 0.0000 Constraint 478 901 0.8000 1.0000 2.0000 0.0000 Constraint 478 891 0.8000 1.0000 2.0000 0.0000 Constraint 478 883 0.8000 1.0000 2.0000 0.0000 Constraint 478 872 0.8000 1.0000 2.0000 0.0000 Constraint 478 866 0.8000 1.0000 2.0000 0.0000 Constraint 478 857 0.8000 1.0000 2.0000 0.0000 Constraint 478 849 0.8000 1.0000 2.0000 0.0000 Constraint 478 840 0.8000 1.0000 2.0000 0.0000 Constraint 478 827 0.8000 1.0000 2.0000 0.0000 Constraint 478 808 0.8000 1.0000 2.0000 0.0000 Constraint 478 690 0.8000 1.0000 2.0000 0.0000 Constraint 478 682 0.8000 1.0000 2.0000 0.0000 Constraint 478 674 0.8000 1.0000 2.0000 0.0000 Constraint 478 650 0.8000 1.0000 2.0000 0.0000 Constraint 478 641 0.8000 1.0000 2.0000 0.0000 Constraint 478 621 0.8000 1.0000 2.0000 0.0000 Constraint 478 567 0.8000 1.0000 2.0000 0.0000 Constraint 478 531 0.8000 1.0000 2.0000 0.0000 Constraint 478 519 0.8000 1.0000 2.0000 0.0000 Constraint 478 510 0.8000 1.0000 2.0000 0.0000 Constraint 478 505 0.8000 1.0000 2.0000 0.0000 Constraint 478 500 0.8000 1.0000 2.0000 0.0000 Constraint 478 493 0.8000 1.0000 2.0000 0.0000 Constraint 478 486 0.8000 1.0000 2.0000 0.0000 Constraint 471 1051 0.8000 1.0000 2.0000 0.0000 Constraint 471 1043 0.8000 1.0000 2.0000 0.0000 Constraint 471 1033 0.8000 1.0000 2.0000 0.0000 Constraint 471 1026 0.8000 1.0000 2.0000 0.0000 Constraint 471 1019 0.8000 1.0000 2.0000 0.0000 Constraint 471 1011 0.8000 1.0000 2.0000 0.0000 Constraint 471 1003 0.8000 1.0000 2.0000 0.0000 Constraint 471 995 0.8000 1.0000 2.0000 0.0000 Constraint 471 987 0.8000 1.0000 2.0000 0.0000 Constraint 471 980 0.8000 1.0000 2.0000 0.0000 Constraint 471 972 0.8000 1.0000 2.0000 0.0000 Constraint 471 931 0.8000 1.0000 2.0000 0.0000 Constraint 471 919 0.8000 1.0000 2.0000 0.0000 Constraint 471 901 0.8000 1.0000 2.0000 0.0000 Constraint 471 891 0.8000 1.0000 2.0000 0.0000 Constraint 471 883 0.8000 1.0000 2.0000 0.0000 Constraint 471 872 0.8000 1.0000 2.0000 0.0000 Constraint 471 866 0.8000 1.0000 2.0000 0.0000 Constraint 471 857 0.8000 1.0000 2.0000 0.0000 Constraint 471 849 0.8000 1.0000 2.0000 0.0000 Constraint 471 840 0.8000 1.0000 2.0000 0.0000 Constraint 471 827 0.8000 1.0000 2.0000 0.0000 Constraint 471 822 0.8000 1.0000 2.0000 0.0000 Constraint 471 814 0.8000 1.0000 2.0000 0.0000 Constraint 471 808 0.8000 1.0000 2.0000 0.0000 Constraint 471 801 0.8000 1.0000 2.0000 0.0000 Constraint 471 792 0.8000 1.0000 2.0000 0.0000 Constraint 471 761 0.8000 1.0000 2.0000 0.0000 Constraint 471 674 0.8000 1.0000 2.0000 0.0000 Constraint 471 650 0.8000 1.0000 2.0000 0.0000 Constraint 471 641 0.8000 1.0000 2.0000 0.0000 Constraint 471 633 0.8000 1.0000 2.0000 0.0000 Constraint 471 621 0.8000 1.0000 2.0000 0.0000 Constraint 471 614 0.8000 1.0000 2.0000 0.0000 Constraint 471 597 0.8000 1.0000 2.0000 0.0000 Constraint 471 519 0.8000 1.0000 2.0000 0.0000 Constraint 471 510 0.8000 1.0000 2.0000 0.0000 Constraint 471 505 0.8000 1.0000 2.0000 0.0000 Constraint 471 500 0.8000 1.0000 2.0000 0.0000 Constraint 471 493 0.8000 1.0000 2.0000 0.0000 Constraint 471 486 0.8000 1.0000 2.0000 0.0000 Constraint 471 478 0.8000 1.0000 2.0000 0.0000 Constraint 466 1051 0.8000 1.0000 2.0000 0.0000 Constraint 466 1043 0.8000 1.0000 2.0000 0.0000 Constraint 466 1033 0.8000 1.0000 2.0000 0.0000 Constraint 466 1026 0.8000 1.0000 2.0000 0.0000 Constraint 466 1019 0.8000 1.0000 2.0000 0.0000 Constraint 466 1011 0.8000 1.0000 2.0000 0.0000 Constraint 466 1003 0.8000 1.0000 2.0000 0.0000 Constraint 466 995 0.8000 1.0000 2.0000 0.0000 Constraint 466 987 0.8000 1.0000 2.0000 0.0000 Constraint 466 980 0.8000 1.0000 2.0000 0.0000 Constraint 466 972 0.8000 1.0000 2.0000 0.0000 Constraint 466 931 0.8000 1.0000 2.0000 0.0000 Constraint 466 919 0.8000 1.0000 2.0000 0.0000 Constraint 466 911 0.8000 1.0000 2.0000 0.0000 Constraint 466 901 0.8000 1.0000 2.0000 0.0000 Constraint 466 891 0.8000 1.0000 2.0000 0.0000 Constraint 466 883 0.8000 1.0000 2.0000 0.0000 Constraint 466 872 0.8000 1.0000 2.0000 0.0000 Constraint 466 866 0.8000 1.0000 2.0000 0.0000 Constraint 466 857 0.8000 1.0000 2.0000 0.0000 Constraint 466 849 0.8000 1.0000 2.0000 0.0000 Constraint 466 840 0.8000 1.0000 2.0000 0.0000 Constraint 466 827 0.8000 1.0000 2.0000 0.0000 Constraint 466 822 0.8000 1.0000 2.0000 0.0000 Constraint 466 814 0.8000 1.0000 2.0000 0.0000 Constraint 466 808 0.8000 1.0000 2.0000 0.0000 Constraint 466 801 0.8000 1.0000 2.0000 0.0000 Constraint 466 792 0.8000 1.0000 2.0000 0.0000 Constraint 466 784 0.8000 1.0000 2.0000 0.0000 Constraint 466 776 0.8000 1.0000 2.0000 0.0000 Constraint 466 768 0.8000 1.0000 2.0000 0.0000 Constraint 466 761 0.8000 1.0000 2.0000 0.0000 Constraint 466 751 0.8000 1.0000 2.0000 0.0000 Constraint 466 743 0.8000 1.0000 2.0000 0.0000 Constraint 466 735 0.8000 1.0000 2.0000 0.0000 Constraint 466 727 0.8000 1.0000 2.0000 0.0000 Constraint 466 690 0.8000 1.0000 2.0000 0.0000 Constraint 466 682 0.8000 1.0000 2.0000 0.0000 Constraint 466 667 0.8000 1.0000 2.0000 0.0000 Constraint 466 659 0.8000 1.0000 2.0000 0.0000 Constraint 466 650 0.8000 1.0000 2.0000 0.0000 Constraint 466 641 0.8000 1.0000 2.0000 0.0000 Constraint 466 633 0.8000 1.0000 2.0000 0.0000 Constraint 466 627 0.8000 1.0000 2.0000 0.0000 Constraint 466 621 0.8000 1.0000 2.0000 0.0000 Constraint 466 614 0.8000 1.0000 2.0000 0.0000 Constraint 466 603 0.8000 1.0000 2.0000 0.0000 Constraint 466 597 0.8000 1.0000 2.0000 0.0000 Constraint 466 590 0.8000 1.0000 2.0000 0.0000 Constraint 466 581 0.8000 1.0000 2.0000 0.0000 Constraint 466 574 0.8000 1.0000 2.0000 0.0000 Constraint 466 567 0.8000 1.0000 2.0000 0.0000 Constraint 466 547 0.8000 1.0000 2.0000 0.0000 Constraint 466 539 0.8000 1.0000 2.0000 0.0000 Constraint 466 531 0.8000 1.0000 2.0000 0.0000 Constraint 466 519 0.8000 1.0000 2.0000 0.0000 Constraint 466 510 0.8000 1.0000 2.0000 0.0000 Constraint 466 505 0.8000 1.0000 2.0000 0.0000 Constraint 466 500 0.8000 1.0000 2.0000 0.0000 Constraint 466 493 0.8000 1.0000 2.0000 0.0000 Constraint 466 486 0.8000 1.0000 2.0000 0.0000 Constraint 466 478 0.8000 1.0000 2.0000 0.0000 Constraint 466 471 0.8000 1.0000 2.0000 0.0000 Constraint 459 1051 0.8000 1.0000 2.0000 0.0000 Constraint 459 1043 0.8000 1.0000 2.0000 0.0000 Constraint 459 1033 0.8000 1.0000 2.0000 0.0000 Constraint 459 1026 0.8000 1.0000 2.0000 0.0000 Constraint 459 1019 0.8000 1.0000 2.0000 0.0000 Constraint 459 1011 0.8000 1.0000 2.0000 0.0000 Constraint 459 1003 0.8000 1.0000 2.0000 0.0000 Constraint 459 995 0.8000 1.0000 2.0000 0.0000 Constraint 459 987 0.8000 1.0000 2.0000 0.0000 Constraint 459 972 0.8000 1.0000 2.0000 0.0000 Constraint 459 951 0.8000 1.0000 2.0000 0.0000 Constraint 459 943 0.8000 1.0000 2.0000 0.0000 Constraint 459 931 0.8000 1.0000 2.0000 0.0000 Constraint 459 919 0.8000 1.0000 2.0000 0.0000 Constraint 459 911 0.8000 1.0000 2.0000 0.0000 Constraint 459 901 0.8000 1.0000 2.0000 0.0000 Constraint 459 891 0.8000 1.0000 2.0000 0.0000 Constraint 459 883 0.8000 1.0000 2.0000 0.0000 Constraint 459 872 0.8000 1.0000 2.0000 0.0000 Constraint 459 866 0.8000 1.0000 2.0000 0.0000 Constraint 459 857 0.8000 1.0000 2.0000 0.0000 Constraint 459 849 0.8000 1.0000 2.0000 0.0000 Constraint 459 840 0.8000 1.0000 2.0000 0.0000 Constraint 459 827 0.8000 1.0000 2.0000 0.0000 Constraint 459 822 0.8000 1.0000 2.0000 0.0000 Constraint 459 814 0.8000 1.0000 2.0000 0.0000 Constraint 459 808 0.8000 1.0000 2.0000 0.0000 Constraint 459 801 0.8000 1.0000 2.0000 0.0000 Constraint 459 792 0.8000 1.0000 2.0000 0.0000 Constraint 459 784 0.8000 1.0000 2.0000 0.0000 Constraint 459 776 0.8000 1.0000 2.0000 0.0000 Constraint 459 768 0.8000 1.0000 2.0000 0.0000 Constraint 459 743 0.8000 1.0000 2.0000 0.0000 Constraint 459 735 0.8000 1.0000 2.0000 0.0000 Constraint 459 682 0.8000 1.0000 2.0000 0.0000 Constraint 459 674 0.8000 1.0000 2.0000 0.0000 Constraint 459 659 0.8000 1.0000 2.0000 0.0000 Constraint 459 650 0.8000 1.0000 2.0000 0.0000 Constraint 459 641 0.8000 1.0000 2.0000 0.0000 Constraint 459 633 0.8000 1.0000 2.0000 0.0000 Constraint 459 627 0.8000 1.0000 2.0000 0.0000 Constraint 459 621 0.8000 1.0000 2.0000 0.0000 Constraint 459 614 0.8000 1.0000 2.0000 0.0000 Constraint 459 597 0.8000 1.0000 2.0000 0.0000 Constraint 459 590 0.8000 1.0000 2.0000 0.0000 Constraint 459 581 0.8000 1.0000 2.0000 0.0000 Constraint 459 539 0.8000 1.0000 2.0000 0.0000 Constraint 459 531 0.8000 1.0000 2.0000 0.0000 Constraint 459 519 0.8000 1.0000 2.0000 0.0000 Constraint 459 510 0.8000 1.0000 2.0000 0.0000 Constraint 459 505 0.8000 1.0000 2.0000 0.0000 Constraint 459 500 0.8000 1.0000 2.0000 0.0000 Constraint 459 493 0.8000 1.0000 2.0000 0.0000 Constraint 459 486 0.8000 1.0000 2.0000 0.0000 Constraint 459 478 0.8000 1.0000 2.0000 0.0000 Constraint 459 471 0.8000 1.0000 2.0000 0.0000 Constraint 459 466 0.8000 1.0000 2.0000 0.0000 Constraint 445 1051 0.8000 1.0000 2.0000 0.0000 Constraint 445 1043 0.8000 1.0000 2.0000 0.0000 Constraint 445 1033 0.8000 1.0000 2.0000 0.0000 Constraint 445 1026 0.8000 1.0000 2.0000 0.0000 Constraint 445 1019 0.8000 1.0000 2.0000 0.0000 Constraint 445 1011 0.8000 1.0000 2.0000 0.0000 Constraint 445 1003 0.8000 1.0000 2.0000 0.0000 Constraint 445 995 0.8000 1.0000 2.0000 0.0000 Constraint 445 987 0.8000 1.0000 2.0000 0.0000 Constraint 445 980 0.8000 1.0000 2.0000 0.0000 Constraint 445 972 0.8000 1.0000 2.0000 0.0000 Constraint 445 960 0.8000 1.0000 2.0000 0.0000 Constraint 445 951 0.8000 1.0000 2.0000 0.0000 Constraint 445 943 0.8000 1.0000 2.0000 0.0000 Constraint 445 931 0.8000 1.0000 2.0000 0.0000 Constraint 445 919 0.8000 1.0000 2.0000 0.0000 Constraint 445 911 0.8000 1.0000 2.0000 0.0000 Constraint 445 901 0.8000 1.0000 2.0000 0.0000 Constraint 445 891 0.8000 1.0000 2.0000 0.0000 Constraint 445 883 0.8000 1.0000 2.0000 0.0000 Constraint 445 872 0.8000 1.0000 2.0000 0.0000 Constraint 445 866 0.8000 1.0000 2.0000 0.0000 Constraint 445 857 0.8000 1.0000 2.0000 0.0000 Constraint 445 849 0.8000 1.0000 2.0000 0.0000 Constraint 445 840 0.8000 1.0000 2.0000 0.0000 Constraint 445 827 0.8000 1.0000 2.0000 0.0000 Constraint 445 822 0.8000 1.0000 2.0000 0.0000 Constraint 445 814 0.8000 1.0000 2.0000 0.0000 Constraint 445 808 0.8000 1.0000 2.0000 0.0000 Constraint 445 743 0.8000 1.0000 2.0000 0.0000 Constraint 445 698 0.8000 1.0000 2.0000 0.0000 Constraint 445 674 0.8000 1.0000 2.0000 0.0000 Constraint 445 659 0.8000 1.0000 2.0000 0.0000 Constraint 445 650 0.8000 1.0000 2.0000 0.0000 Constraint 445 641 0.8000 1.0000 2.0000 0.0000 Constraint 445 633 0.8000 1.0000 2.0000 0.0000 Constraint 445 627 0.8000 1.0000 2.0000 0.0000 Constraint 445 621 0.8000 1.0000 2.0000 0.0000 Constraint 445 614 0.8000 1.0000 2.0000 0.0000 Constraint 445 597 0.8000 1.0000 2.0000 0.0000 Constraint 445 590 0.8000 1.0000 2.0000 0.0000 Constraint 445 581 0.8000 1.0000 2.0000 0.0000 Constraint 445 567 0.8000 1.0000 2.0000 0.0000 Constraint 445 547 0.8000 1.0000 2.0000 0.0000 Constraint 445 539 0.8000 1.0000 2.0000 0.0000 Constraint 445 505 0.8000 1.0000 2.0000 0.0000 Constraint 445 500 0.8000 1.0000 2.0000 0.0000 Constraint 445 493 0.8000 1.0000 2.0000 0.0000 Constraint 445 486 0.8000 1.0000 2.0000 0.0000 Constraint 445 478 0.8000 1.0000 2.0000 0.0000 Constraint 445 471 0.8000 1.0000 2.0000 0.0000 Constraint 445 466 0.8000 1.0000 2.0000 0.0000 Constraint 445 459 0.8000 1.0000 2.0000 0.0000 Constraint 437 1051 0.8000 1.0000 2.0000 0.0000 Constraint 437 1043 0.8000 1.0000 2.0000 0.0000 Constraint 437 1033 0.8000 1.0000 2.0000 0.0000 Constraint 437 1026 0.8000 1.0000 2.0000 0.0000 Constraint 437 1019 0.8000 1.0000 2.0000 0.0000 Constraint 437 1011 0.8000 1.0000 2.0000 0.0000 Constraint 437 1003 0.8000 1.0000 2.0000 0.0000 Constraint 437 995 0.8000 1.0000 2.0000 0.0000 Constraint 437 987 0.8000 1.0000 2.0000 0.0000 Constraint 437 980 0.8000 1.0000 2.0000 0.0000 Constraint 437 972 0.8000 1.0000 2.0000 0.0000 Constraint 437 951 0.8000 1.0000 2.0000 0.0000 Constraint 437 943 0.8000 1.0000 2.0000 0.0000 Constraint 437 931 0.8000 1.0000 2.0000 0.0000 Constraint 437 919 0.8000 1.0000 2.0000 0.0000 Constraint 437 911 0.8000 1.0000 2.0000 0.0000 Constraint 437 901 0.8000 1.0000 2.0000 0.0000 Constraint 437 891 0.8000 1.0000 2.0000 0.0000 Constraint 437 883 0.8000 1.0000 2.0000 0.0000 Constraint 437 872 0.8000 1.0000 2.0000 0.0000 Constraint 437 866 0.8000 1.0000 2.0000 0.0000 Constraint 437 857 0.8000 1.0000 2.0000 0.0000 Constraint 437 849 0.8000 1.0000 2.0000 0.0000 Constraint 437 840 0.8000 1.0000 2.0000 0.0000 Constraint 437 827 0.8000 1.0000 2.0000 0.0000 Constraint 437 822 0.8000 1.0000 2.0000 0.0000 Constraint 437 814 0.8000 1.0000 2.0000 0.0000 Constraint 437 808 0.8000 1.0000 2.0000 0.0000 Constraint 437 801 0.8000 1.0000 2.0000 0.0000 Constraint 437 792 0.8000 1.0000 2.0000 0.0000 Constraint 437 784 0.8000 1.0000 2.0000 0.0000 Constraint 437 776 0.8000 1.0000 2.0000 0.0000 Constraint 437 761 0.8000 1.0000 2.0000 0.0000 Constraint 437 751 0.8000 1.0000 2.0000 0.0000 Constraint 437 743 0.8000 1.0000 2.0000 0.0000 Constraint 437 735 0.8000 1.0000 2.0000 0.0000 Constraint 437 727 0.8000 1.0000 2.0000 0.0000 Constraint 437 719 0.8000 1.0000 2.0000 0.0000 Constraint 437 711 0.8000 1.0000 2.0000 0.0000 Constraint 437 706 0.8000 1.0000 2.0000 0.0000 Constraint 437 698 0.8000 1.0000 2.0000 0.0000 Constraint 437 690 0.8000 1.0000 2.0000 0.0000 Constraint 437 674 0.8000 1.0000 2.0000 0.0000 Constraint 437 667 0.8000 1.0000 2.0000 0.0000 Constraint 437 659 0.8000 1.0000 2.0000 0.0000 Constraint 437 650 0.8000 1.0000 2.0000 0.0000 Constraint 437 641 0.8000 1.0000 2.0000 0.0000 Constraint 437 633 0.8000 1.0000 2.0000 0.0000 Constraint 437 621 0.8000 1.0000 2.0000 0.0000 Constraint 437 614 0.8000 1.0000 2.0000 0.0000 Constraint 437 590 0.8000 1.0000 2.0000 0.0000 Constraint 437 581 0.8000 1.0000 2.0000 0.0000 Constraint 437 552 0.8000 1.0000 2.0000 0.0000 Constraint 437 531 0.8000 1.0000 2.0000 0.0000 Constraint 437 510 0.8000 1.0000 2.0000 0.0000 Constraint 437 500 0.8000 1.0000 2.0000 0.0000 Constraint 437 493 0.8000 1.0000 2.0000 0.0000 Constraint 437 486 0.8000 1.0000 2.0000 0.0000 Constraint 437 478 0.8000 1.0000 2.0000 0.0000 Constraint 437 471 0.8000 1.0000 2.0000 0.0000 Constraint 437 466 0.8000 1.0000 2.0000 0.0000 Constraint 437 459 0.8000 1.0000 2.0000 0.0000 Constraint 437 445 0.8000 1.0000 2.0000 0.0000 Constraint 430 1051 0.8000 1.0000 2.0000 0.0000 Constraint 430 1043 0.8000 1.0000 2.0000 0.0000 Constraint 430 1033 0.8000 1.0000 2.0000 0.0000 Constraint 430 1026 0.8000 1.0000 2.0000 0.0000 Constraint 430 1019 0.8000 1.0000 2.0000 0.0000 Constraint 430 1011 0.8000 1.0000 2.0000 0.0000 Constraint 430 1003 0.8000 1.0000 2.0000 0.0000 Constraint 430 995 0.8000 1.0000 2.0000 0.0000 Constraint 430 987 0.8000 1.0000 2.0000 0.0000 Constraint 430 980 0.8000 1.0000 2.0000 0.0000 Constraint 430 972 0.8000 1.0000 2.0000 0.0000 Constraint 430 931 0.8000 1.0000 2.0000 0.0000 Constraint 430 919 0.8000 1.0000 2.0000 0.0000 Constraint 430 911 0.8000 1.0000 2.0000 0.0000 Constraint 430 901 0.8000 1.0000 2.0000 0.0000 Constraint 430 891 0.8000 1.0000 2.0000 0.0000 Constraint 430 883 0.8000 1.0000 2.0000 0.0000 Constraint 430 872 0.8000 1.0000 2.0000 0.0000 Constraint 430 866 0.8000 1.0000 2.0000 0.0000 Constraint 430 857 0.8000 1.0000 2.0000 0.0000 Constraint 430 849 0.8000 1.0000 2.0000 0.0000 Constraint 430 840 0.8000 1.0000 2.0000 0.0000 Constraint 430 827 0.8000 1.0000 2.0000 0.0000 Constraint 430 822 0.8000 1.0000 2.0000 0.0000 Constraint 430 814 0.8000 1.0000 2.0000 0.0000 Constraint 430 808 0.8000 1.0000 2.0000 0.0000 Constraint 430 801 0.8000 1.0000 2.0000 0.0000 Constraint 430 792 0.8000 1.0000 2.0000 0.0000 Constraint 430 761 0.8000 1.0000 2.0000 0.0000 Constraint 430 751 0.8000 1.0000 2.0000 0.0000 Constraint 430 735 0.8000 1.0000 2.0000 0.0000 Constraint 430 727 0.8000 1.0000 2.0000 0.0000 Constraint 430 719 0.8000 1.0000 2.0000 0.0000 Constraint 430 711 0.8000 1.0000 2.0000 0.0000 Constraint 430 706 0.8000 1.0000 2.0000 0.0000 Constraint 430 698 0.8000 1.0000 2.0000 0.0000 Constraint 430 690 0.8000 1.0000 2.0000 0.0000 Constraint 430 674 0.8000 1.0000 2.0000 0.0000 Constraint 430 659 0.8000 1.0000 2.0000 0.0000 Constraint 430 650 0.8000 1.0000 2.0000 0.0000 Constraint 430 641 0.8000 1.0000 2.0000 0.0000 Constraint 430 621 0.8000 1.0000 2.0000 0.0000 Constraint 430 614 0.8000 1.0000 2.0000 0.0000 Constraint 430 597 0.8000 1.0000 2.0000 0.0000 Constraint 430 574 0.8000 1.0000 2.0000 0.0000 Constraint 430 567 0.8000 1.0000 2.0000 0.0000 Constraint 430 560 0.8000 1.0000 2.0000 0.0000 Constraint 430 552 0.8000 1.0000 2.0000 0.0000 Constraint 430 531 0.8000 1.0000 2.0000 0.0000 Constraint 430 510 0.8000 1.0000 2.0000 0.0000 Constraint 430 505 0.8000 1.0000 2.0000 0.0000 Constraint 430 493 0.8000 1.0000 2.0000 0.0000 Constraint 430 486 0.8000 1.0000 2.0000 0.0000 Constraint 430 478 0.8000 1.0000 2.0000 0.0000 Constraint 430 471 0.8000 1.0000 2.0000 0.0000 Constraint 430 466 0.8000 1.0000 2.0000 0.0000 Constraint 430 459 0.8000 1.0000 2.0000 0.0000 Constraint 430 445 0.8000 1.0000 2.0000 0.0000 Constraint 430 437 0.8000 1.0000 2.0000 0.0000 Constraint 419 1051 0.8000 1.0000 2.0000 0.0000 Constraint 419 1043 0.8000 1.0000 2.0000 0.0000 Constraint 419 1033 0.8000 1.0000 2.0000 0.0000 Constraint 419 1026 0.8000 1.0000 2.0000 0.0000 Constraint 419 1019 0.8000 1.0000 2.0000 0.0000 Constraint 419 1011 0.8000 1.0000 2.0000 0.0000 Constraint 419 1003 0.8000 1.0000 2.0000 0.0000 Constraint 419 995 0.8000 1.0000 2.0000 0.0000 Constraint 419 987 0.8000 1.0000 2.0000 0.0000 Constraint 419 980 0.8000 1.0000 2.0000 0.0000 Constraint 419 972 0.8000 1.0000 2.0000 0.0000 Constraint 419 960 0.8000 1.0000 2.0000 0.0000 Constraint 419 951 0.8000 1.0000 2.0000 0.0000 Constraint 419 943 0.8000 1.0000 2.0000 0.0000 Constraint 419 931 0.8000 1.0000 2.0000 0.0000 Constraint 419 919 0.8000 1.0000 2.0000 0.0000 Constraint 419 911 0.8000 1.0000 2.0000 0.0000 Constraint 419 901 0.8000 1.0000 2.0000 0.0000 Constraint 419 891 0.8000 1.0000 2.0000 0.0000 Constraint 419 883 0.8000 1.0000 2.0000 0.0000 Constraint 419 872 0.8000 1.0000 2.0000 0.0000 Constraint 419 866 0.8000 1.0000 2.0000 0.0000 Constraint 419 857 0.8000 1.0000 2.0000 0.0000 Constraint 419 849 0.8000 1.0000 2.0000 0.0000 Constraint 419 840 0.8000 1.0000 2.0000 0.0000 Constraint 419 827 0.8000 1.0000 2.0000 0.0000 Constraint 419 822 0.8000 1.0000 2.0000 0.0000 Constraint 419 814 0.8000 1.0000 2.0000 0.0000 Constraint 419 801 0.8000 1.0000 2.0000 0.0000 Constraint 419 792 0.8000 1.0000 2.0000 0.0000 Constraint 419 784 0.8000 1.0000 2.0000 0.0000 Constraint 419 776 0.8000 1.0000 2.0000 0.0000 Constraint 419 768 0.8000 1.0000 2.0000 0.0000 Constraint 419 761 0.8000 1.0000 2.0000 0.0000 Constraint 419 751 0.8000 1.0000 2.0000 0.0000 Constraint 419 743 0.8000 1.0000 2.0000 0.0000 Constraint 419 735 0.8000 1.0000 2.0000 0.0000 Constraint 419 727 0.8000 1.0000 2.0000 0.0000 Constraint 419 719 0.8000 1.0000 2.0000 0.0000 Constraint 419 711 0.8000 1.0000 2.0000 0.0000 Constraint 419 706 0.8000 1.0000 2.0000 0.0000 Constraint 419 698 0.8000 1.0000 2.0000 0.0000 Constraint 419 690 0.8000 1.0000 2.0000 0.0000 Constraint 419 674 0.8000 1.0000 2.0000 0.0000 Constraint 419 667 0.8000 1.0000 2.0000 0.0000 Constraint 419 633 0.8000 1.0000 2.0000 0.0000 Constraint 419 627 0.8000 1.0000 2.0000 0.0000 Constraint 419 621 0.8000 1.0000 2.0000 0.0000 Constraint 419 614 0.8000 1.0000 2.0000 0.0000 Constraint 419 603 0.8000 1.0000 2.0000 0.0000 Constraint 419 597 0.8000 1.0000 2.0000 0.0000 Constraint 419 590 0.8000 1.0000 2.0000 0.0000 Constraint 419 581 0.8000 1.0000 2.0000 0.0000 Constraint 419 574 0.8000 1.0000 2.0000 0.0000 Constraint 419 567 0.8000 1.0000 2.0000 0.0000 Constraint 419 560 0.8000 1.0000 2.0000 0.0000 Constraint 419 552 0.8000 1.0000 2.0000 0.0000 Constraint 419 547 0.8000 1.0000 2.0000 0.0000 Constraint 419 539 0.8000 1.0000 2.0000 0.0000 Constraint 419 531 0.8000 1.0000 2.0000 0.0000 Constraint 419 510 0.8000 1.0000 2.0000 0.0000 Constraint 419 505 0.8000 1.0000 2.0000 0.0000 Constraint 419 486 0.8000 1.0000 2.0000 0.0000 Constraint 419 478 0.8000 1.0000 2.0000 0.0000 Constraint 419 471 0.8000 1.0000 2.0000 0.0000 Constraint 419 466 0.8000 1.0000 2.0000 0.0000 Constraint 419 459 0.8000 1.0000 2.0000 0.0000 Constraint 419 445 0.8000 1.0000 2.0000 0.0000 Constraint 419 437 0.8000 1.0000 2.0000 0.0000 Constraint 419 430 0.8000 1.0000 2.0000 0.0000 Constraint 411 1051 0.8000 1.0000 2.0000 0.0000 Constraint 411 1043 0.8000 1.0000 2.0000 0.0000 Constraint 411 1033 0.8000 1.0000 2.0000 0.0000 Constraint 411 1026 0.8000 1.0000 2.0000 0.0000 Constraint 411 1019 0.8000 1.0000 2.0000 0.0000 Constraint 411 1011 0.8000 1.0000 2.0000 0.0000 Constraint 411 1003 0.8000 1.0000 2.0000 0.0000 Constraint 411 995 0.8000 1.0000 2.0000 0.0000 Constraint 411 987 0.8000 1.0000 2.0000 0.0000 Constraint 411 980 0.8000 1.0000 2.0000 0.0000 Constraint 411 972 0.8000 1.0000 2.0000 0.0000 Constraint 411 960 0.8000 1.0000 2.0000 0.0000 Constraint 411 951 0.8000 1.0000 2.0000 0.0000 Constraint 411 943 0.8000 1.0000 2.0000 0.0000 Constraint 411 931 0.8000 1.0000 2.0000 0.0000 Constraint 411 919 0.8000 1.0000 2.0000 0.0000 Constraint 411 911 0.8000 1.0000 2.0000 0.0000 Constraint 411 901 0.8000 1.0000 2.0000 0.0000 Constraint 411 891 0.8000 1.0000 2.0000 0.0000 Constraint 411 883 0.8000 1.0000 2.0000 0.0000 Constraint 411 872 0.8000 1.0000 2.0000 0.0000 Constraint 411 866 0.8000 1.0000 2.0000 0.0000 Constraint 411 857 0.8000 1.0000 2.0000 0.0000 Constraint 411 849 0.8000 1.0000 2.0000 0.0000 Constraint 411 840 0.8000 1.0000 2.0000 0.0000 Constraint 411 827 0.8000 1.0000 2.0000 0.0000 Constraint 411 822 0.8000 1.0000 2.0000 0.0000 Constraint 411 814 0.8000 1.0000 2.0000 0.0000 Constraint 411 808 0.8000 1.0000 2.0000 0.0000 Constraint 411 801 0.8000 1.0000 2.0000 0.0000 Constraint 411 792 0.8000 1.0000 2.0000 0.0000 Constraint 411 784 0.8000 1.0000 2.0000 0.0000 Constraint 411 776 0.8000 1.0000 2.0000 0.0000 Constraint 411 768 0.8000 1.0000 2.0000 0.0000 Constraint 411 761 0.8000 1.0000 2.0000 0.0000 Constraint 411 751 0.8000 1.0000 2.0000 0.0000 Constraint 411 743 0.8000 1.0000 2.0000 0.0000 Constraint 411 735 0.8000 1.0000 2.0000 0.0000 Constraint 411 727 0.8000 1.0000 2.0000 0.0000 Constraint 411 719 0.8000 1.0000 2.0000 0.0000 Constraint 411 711 0.8000 1.0000 2.0000 0.0000 Constraint 411 706 0.8000 1.0000 2.0000 0.0000 Constraint 411 698 0.8000 1.0000 2.0000 0.0000 Constraint 411 674 0.8000 1.0000 2.0000 0.0000 Constraint 411 667 0.8000 1.0000 2.0000 0.0000 Constraint 411 621 0.8000 1.0000 2.0000 0.0000 Constraint 411 614 0.8000 1.0000 2.0000 0.0000 Constraint 411 590 0.8000 1.0000 2.0000 0.0000 Constraint 411 581 0.8000 1.0000 2.0000 0.0000 Constraint 411 574 0.8000 1.0000 2.0000 0.0000 Constraint 411 560 0.8000 1.0000 2.0000 0.0000 Constraint 411 552 0.8000 1.0000 2.0000 0.0000 Constraint 411 531 0.8000 1.0000 2.0000 0.0000 Constraint 411 510 0.8000 1.0000 2.0000 0.0000 Constraint 411 505 0.8000 1.0000 2.0000 0.0000 Constraint 411 500 0.8000 1.0000 2.0000 0.0000 Constraint 411 478 0.8000 1.0000 2.0000 0.0000 Constraint 411 471 0.8000 1.0000 2.0000 0.0000 Constraint 411 466 0.8000 1.0000 2.0000 0.0000 Constraint 411 459 0.8000 1.0000 2.0000 0.0000 Constraint 411 445 0.8000 1.0000 2.0000 0.0000 Constraint 411 437 0.8000 1.0000 2.0000 0.0000 Constraint 411 430 0.8000 1.0000 2.0000 0.0000 Constraint 411 419 0.8000 1.0000 2.0000 0.0000 Constraint 404 1051 0.8000 1.0000 2.0000 0.0000 Constraint 404 1043 0.8000 1.0000 2.0000 0.0000 Constraint 404 1033 0.8000 1.0000 2.0000 0.0000 Constraint 404 1026 0.8000 1.0000 2.0000 0.0000 Constraint 404 1019 0.8000 1.0000 2.0000 0.0000 Constraint 404 1011 0.8000 1.0000 2.0000 0.0000 Constraint 404 1003 0.8000 1.0000 2.0000 0.0000 Constraint 404 995 0.8000 1.0000 2.0000 0.0000 Constraint 404 987 0.8000 1.0000 2.0000 0.0000 Constraint 404 980 0.8000 1.0000 2.0000 0.0000 Constraint 404 972 0.8000 1.0000 2.0000 0.0000 Constraint 404 960 0.8000 1.0000 2.0000 0.0000 Constraint 404 951 0.8000 1.0000 2.0000 0.0000 Constraint 404 931 0.8000 1.0000 2.0000 0.0000 Constraint 404 919 0.8000 1.0000 2.0000 0.0000 Constraint 404 911 0.8000 1.0000 2.0000 0.0000 Constraint 404 901 0.8000 1.0000 2.0000 0.0000 Constraint 404 891 0.8000 1.0000 2.0000 0.0000 Constraint 404 883 0.8000 1.0000 2.0000 0.0000 Constraint 404 872 0.8000 1.0000 2.0000 0.0000 Constraint 404 866 0.8000 1.0000 2.0000 0.0000 Constraint 404 857 0.8000 1.0000 2.0000 0.0000 Constraint 404 840 0.8000 1.0000 2.0000 0.0000 Constraint 404 827 0.8000 1.0000 2.0000 0.0000 Constraint 404 822 0.8000 1.0000 2.0000 0.0000 Constraint 404 814 0.8000 1.0000 2.0000 0.0000 Constraint 404 808 0.8000 1.0000 2.0000 0.0000 Constraint 404 801 0.8000 1.0000 2.0000 0.0000 Constraint 404 792 0.8000 1.0000 2.0000 0.0000 Constraint 404 735 0.8000 1.0000 2.0000 0.0000 Constraint 404 711 0.8000 1.0000 2.0000 0.0000 Constraint 404 706 0.8000 1.0000 2.0000 0.0000 Constraint 404 674 0.8000 1.0000 2.0000 0.0000 Constraint 404 614 0.8000 1.0000 2.0000 0.0000 Constraint 404 471 0.8000 1.0000 2.0000 0.0000 Constraint 404 466 0.8000 1.0000 2.0000 0.0000 Constraint 404 459 0.8000 1.0000 2.0000 0.0000 Constraint 404 445 0.8000 1.0000 2.0000 0.0000 Constraint 404 437 0.8000 1.0000 2.0000 0.0000 Constraint 404 430 0.8000 1.0000 2.0000 0.0000 Constraint 404 419 0.8000 1.0000 2.0000 0.0000 Constraint 404 411 0.8000 1.0000 2.0000 0.0000 Constraint 396 1051 0.8000 1.0000 2.0000 0.0000 Constraint 396 1043 0.8000 1.0000 2.0000 0.0000 Constraint 396 1033 0.8000 1.0000 2.0000 0.0000 Constraint 396 1026 0.8000 1.0000 2.0000 0.0000 Constraint 396 1019 0.8000 1.0000 2.0000 0.0000 Constraint 396 1011 0.8000 1.0000 2.0000 0.0000 Constraint 396 1003 0.8000 1.0000 2.0000 0.0000 Constraint 396 995 0.8000 1.0000 2.0000 0.0000 Constraint 396 987 0.8000 1.0000 2.0000 0.0000 Constraint 396 980 0.8000 1.0000 2.0000 0.0000 Constraint 396 972 0.8000 1.0000 2.0000 0.0000 Constraint 396 960 0.8000 1.0000 2.0000 0.0000 Constraint 396 951 0.8000 1.0000 2.0000 0.0000 Constraint 396 931 0.8000 1.0000 2.0000 0.0000 Constraint 396 919 0.8000 1.0000 2.0000 0.0000 Constraint 396 911 0.8000 1.0000 2.0000 0.0000 Constraint 396 901 0.8000 1.0000 2.0000 0.0000 Constraint 396 891 0.8000 1.0000 2.0000 0.0000 Constraint 396 883 0.8000 1.0000 2.0000 0.0000 Constraint 396 872 0.8000 1.0000 2.0000 0.0000 Constraint 396 866 0.8000 1.0000 2.0000 0.0000 Constraint 396 857 0.8000 1.0000 2.0000 0.0000 Constraint 396 840 0.8000 1.0000 2.0000 0.0000 Constraint 396 827 0.8000 1.0000 2.0000 0.0000 Constraint 396 822 0.8000 1.0000 2.0000 0.0000 Constraint 396 814 0.8000 1.0000 2.0000 0.0000 Constraint 396 808 0.8000 1.0000 2.0000 0.0000 Constraint 396 801 0.8000 1.0000 2.0000 0.0000 Constraint 396 792 0.8000 1.0000 2.0000 0.0000 Constraint 396 784 0.8000 1.0000 2.0000 0.0000 Constraint 396 776 0.8000 1.0000 2.0000 0.0000 Constraint 396 768 0.8000 1.0000 2.0000 0.0000 Constraint 396 761 0.8000 1.0000 2.0000 0.0000 Constraint 396 751 0.8000 1.0000 2.0000 0.0000 Constraint 396 743 0.8000 1.0000 2.0000 0.0000 Constraint 396 735 0.8000 1.0000 2.0000 0.0000 Constraint 396 727 0.8000 1.0000 2.0000 0.0000 Constraint 396 719 0.8000 1.0000 2.0000 0.0000 Constraint 396 706 0.8000 1.0000 2.0000 0.0000 Constraint 396 698 0.8000 1.0000 2.0000 0.0000 Constraint 396 674 0.8000 1.0000 2.0000 0.0000 Constraint 396 650 0.8000 1.0000 2.0000 0.0000 Constraint 396 641 0.8000 1.0000 2.0000 0.0000 Constraint 396 627 0.8000 1.0000 2.0000 0.0000 Constraint 396 621 0.8000 1.0000 2.0000 0.0000 Constraint 396 531 0.8000 1.0000 2.0000 0.0000 Constraint 396 519 0.8000 1.0000 2.0000 0.0000 Constraint 396 500 0.8000 1.0000 2.0000 0.0000 Constraint 396 486 0.8000 1.0000 2.0000 0.0000 Constraint 396 466 0.8000 1.0000 2.0000 0.0000 Constraint 396 459 0.8000 1.0000 2.0000 0.0000 Constraint 396 445 0.8000 1.0000 2.0000 0.0000 Constraint 396 437 0.8000 1.0000 2.0000 0.0000 Constraint 396 430 0.8000 1.0000 2.0000 0.0000 Constraint 396 419 0.8000 1.0000 2.0000 0.0000 Constraint 396 411 0.8000 1.0000 2.0000 0.0000 Constraint 396 404 0.8000 1.0000 2.0000 0.0000 Constraint 388 1051 0.8000 1.0000 2.0000 0.0000 Constraint 388 1043 0.8000 1.0000 2.0000 0.0000 Constraint 388 1033 0.8000 1.0000 2.0000 0.0000 Constraint 388 1026 0.8000 1.0000 2.0000 0.0000 Constraint 388 1019 0.8000 1.0000 2.0000 0.0000 Constraint 388 1011 0.8000 1.0000 2.0000 0.0000 Constraint 388 1003 0.8000 1.0000 2.0000 0.0000 Constraint 388 995 0.8000 1.0000 2.0000 0.0000 Constraint 388 987 0.8000 1.0000 2.0000 0.0000 Constraint 388 980 0.8000 1.0000 2.0000 0.0000 Constraint 388 972 0.8000 1.0000 2.0000 0.0000 Constraint 388 960 0.8000 1.0000 2.0000 0.0000 Constraint 388 951 0.8000 1.0000 2.0000 0.0000 Constraint 388 943 0.8000 1.0000 2.0000 0.0000 Constraint 388 931 0.8000 1.0000 2.0000 0.0000 Constraint 388 919 0.8000 1.0000 2.0000 0.0000 Constraint 388 911 0.8000 1.0000 2.0000 0.0000 Constraint 388 901 0.8000 1.0000 2.0000 0.0000 Constraint 388 891 0.8000 1.0000 2.0000 0.0000 Constraint 388 883 0.8000 1.0000 2.0000 0.0000 Constraint 388 872 0.8000 1.0000 2.0000 0.0000 Constraint 388 866 0.8000 1.0000 2.0000 0.0000 Constraint 388 857 0.8000 1.0000 2.0000 0.0000 Constraint 388 849 0.8000 1.0000 2.0000 0.0000 Constraint 388 840 0.8000 1.0000 2.0000 0.0000 Constraint 388 827 0.8000 1.0000 2.0000 0.0000 Constraint 388 822 0.8000 1.0000 2.0000 0.0000 Constraint 388 814 0.8000 1.0000 2.0000 0.0000 Constraint 388 808 0.8000 1.0000 2.0000 0.0000 Constraint 388 801 0.8000 1.0000 2.0000 0.0000 Constraint 388 792 0.8000 1.0000 2.0000 0.0000 Constraint 388 784 0.8000 1.0000 2.0000 0.0000 Constraint 388 776 0.8000 1.0000 2.0000 0.0000 Constraint 388 768 0.8000 1.0000 2.0000 0.0000 Constraint 388 761 0.8000 1.0000 2.0000 0.0000 Constraint 388 751 0.8000 1.0000 2.0000 0.0000 Constraint 388 743 0.8000 1.0000 2.0000 0.0000 Constraint 388 735 0.8000 1.0000 2.0000 0.0000 Constraint 388 727 0.8000 1.0000 2.0000 0.0000 Constraint 388 719 0.8000 1.0000 2.0000 0.0000 Constraint 388 711 0.8000 1.0000 2.0000 0.0000 Constraint 388 706 0.8000 1.0000 2.0000 0.0000 Constraint 388 698 0.8000 1.0000 2.0000 0.0000 Constraint 388 690 0.8000 1.0000 2.0000 0.0000 Constraint 388 674 0.8000 1.0000 2.0000 0.0000 Constraint 388 667 0.8000 1.0000 2.0000 0.0000 Constraint 388 650 0.8000 1.0000 2.0000 0.0000 Constraint 388 641 0.8000 1.0000 2.0000 0.0000 Constraint 388 581 0.8000 1.0000 2.0000 0.0000 Constraint 388 574 0.8000 1.0000 2.0000 0.0000 Constraint 388 567 0.8000 1.0000 2.0000 0.0000 Constraint 388 560 0.8000 1.0000 2.0000 0.0000 Constraint 388 552 0.8000 1.0000 2.0000 0.0000 Constraint 388 531 0.8000 1.0000 2.0000 0.0000 Constraint 388 486 0.8000 1.0000 2.0000 0.0000 Constraint 388 478 0.8000 1.0000 2.0000 0.0000 Constraint 388 459 0.8000 1.0000 2.0000 0.0000 Constraint 388 445 0.8000 1.0000 2.0000 0.0000 Constraint 388 437 0.8000 1.0000 2.0000 0.0000 Constraint 388 430 0.8000 1.0000 2.0000 0.0000 Constraint 388 419 0.8000 1.0000 2.0000 0.0000 Constraint 388 411 0.8000 1.0000 2.0000 0.0000 Constraint 388 404 0.8000 1.0000 2.0000 0.0000 Constraint 388 396 0.8000 1.0000 2.0000 0.0000 Constraint 380 1051 0.8000 1.0000 2.0000 0.0000 Constraint 380 1043 0.8000 1.0000 2.0000 0.0000 Constraint 380 1033 0.8000 1.0000 2.0000 0.0000 Constraint 380 1026 0.8000 1.0000 2.0000 0.0000 Constraint 380 1019 0.8000 1.0000 2.0000 0.0000 Constraint 380 1011 0.8000 1.0000 2.0000 0.0000 Constraint 380 1003 0.8000 1.0000 2.0000 0.0000 Constraint 380 995 0.8000 1.0000 2.0000 0.0000 Constraint 380 987 0.8000 1.0000 2.0000 0.0000 Constraint 380 980 0.8000 1.0000 2.0000 0.0000 Constraint 380 972 0.8000 1.0000 2.0000 0.0000 Constraint 380 960 0.8000 1.0000 2.0000 0.0000 Constraint 380 951 0.8000 1.0000 2.0000 0.0000 Constraint 380 931 0.8000 1.0000 2.0000 0.0000 Constraint 380 911 0.8000 1.0000 2.0000 0.0000 Constraint 380 901 0.8000 1.0000 2.0000 0.0000 Constraint 380 891 0.8000 1.0000 2.0000 0.0000 Constraint 380 883 0.8000 1.0000 2.0000 0.0000 Constraint 380 872 0.8000 1.0000 2.0000 0.0000 Constraint 380 866 0.8000 1.0000 2.0000 0.0000 Constraint 380 857 0.8000 1.0000 2.0000 0.0000 Constraint 380 849 0.8000 1.0000 2.0000 0.0000 Constraint 380 840 0.8000 1.0000 2.0000 0.0000 Constraint 380 827 0.8000 1.0000 2.0000 0.0000 Constraint 380 822 0.8000 1.0000 2.0000 0.0000 Constraint 380 814 0.8000 1.0000 2.0000 0.0000 Constraint 380 808 0.8000 1.0000 2.0000 0.0000 Constraint 380 801 0.8000 1.0000 2.0000 0.0000 Constraint 380 792 0.8000 1.0000 2.0000 0.0000 Constraint 380 776 0.8000 1.0000 2.0000 0.0000 Constraint 380 761 0.8000 1.0000 2.0000 0.0000 Constraint 380 735 0.8000 1.0000 2.0000 0.0000 Constraint 380 727 0.8000 1.0000 2.0000 0.0000 Constraint 380 711 0.8000 1.0000 2.0000 0.0000 Constraint 380 706 0.8000 1.0000 2.0000 0.0000 Constraint 380 674 0.8000 1.0000 2.0000 0.0000 Constraint 380 667 0.8000 1.0000 2.0000 0.0000 Constraint 380 641 0.8000 1.0000 2.0000 0.0000 Constraint 380 567 0.8000 1.0000 2.0000 0.0000 Constraint 380 547 0.8000 1.0000 2.0000 0.0000 Constraint 380 531 0.8000 1.0000 2.0000 0.0000 Constraint 380 445 0.8000 1.0000 2.0000 0.0000 Constraint 380 437 0.8000 1.0000 2.0000 0.0000 Constraint 380 430 0.8000 1.0000 2.0000 0.0000 Constraint 380 419 0.8000 1.0000 2.0000 0.0000 Constraint 380 411 0.8000 1.0000 2.0000 0.0000 Constraint 380 404 0.8000 1.0000 2.0000 0.0000 Constraint 380 396 0.8000 1.0000 2.0000 0.0000 Constraint 380 388 0.8000 1.0000 2.0000 0.0000 Constraint 372 1051 0.8000 1.0000 2.0000 0.0000 Constraint 372 1043 0.8000 1.0000 2.0000 0.0000 Constraint 372 1033 0.8000 1.0000 2.0000 0.0000 Constraint 372 1026 0.8000 1.0000 2.0000 0.0000 Constraint 372 1019 0.8000 1.0000 2.0000 0.0000 Constraint 372 1011 0.8000 1.0000 2.0000 0.0000 Constraint 372 1003 0.8000 1.0000 2.0000 0.0000 Constraint 372 995 0.8000 1.0000 2.0000 0.0000 Constraint 372 987 0.8000 1.0000 2.0000 0.0000 Constraint 372 980 0.8000 1.0000 2.0000 0.0000 Constraint 372 972 0.8000 1.0000 2.0000 0.0000 Constraint 372 960 0.8000 1.0000 2.0000 0.0000 Constraint 372 951 0.8000 1.0000 2.0000 0.0000 Constraint 372 931 0.8000 1.0000 2.0000 0.0000 Constraint 372 901 0.8000 1.0000 2.0000 0.0000 Constraint 372 891 0.8000 1.0000 2.0000 0.0000 Constraint 372 883 0.8000 1.0000 2.0000 0.0000 Constraint 372 872 0.8000 1.0000 2.0000 0.0000 Constraint 372 857 0.8000 1.0000 2.0000 0.0000 Constraint 372 840 0.8000 1.0000 2.0000 0.0000 Constraint 372 827 0.8000 1.0000 2.0000 0.0000 Constraint 372 822 0.8000 1.0000 2.0000 0.0000 Constraint 372 814 0.8000 1.0000 2.0000 0.0000 Constraint 372 808 0.8000 1.0000 2.0000 0.0000 Constraint 372 792 0.8000 1.0000 2.0000 0.0000 Constraint 372 761 0.8000 1.0000 2.0000 0.0000 Constraint 372 735 0.8000 1.0000 2.0000 0.0000 Constraint 372 727 0.8000 1.0000 2.0000 0.0000 Constraint 372 711 0.8000 1.0000 2.0000 0.0000 Constraint 372 706 0.8000 1.0000 2.0000 0.0000 Constraint 372 690 0.8000 1.0000 2.0000 0.0000 Constraint 372 682 0.8000 1.0000 2.0000 0.0000 Constraint 372 674 0.8000 1.0000 2.0000 0.0000 Constraint 372 667 0.8000 1.0000 2.0000 0.0000 Constraint 372 650 0.8000 1.0000 2.0000 0.0000 Constraint 372 590 0.8000 1.0000 2.0000 0.0000 Constraint 372 574 0.8000 1.0000 2.0000 0.0000 Constraint 372 567 0.8000 1.0000 2.0000 0.0000 Constraint 372 547 0.8000 1.0000 2.0000 0.0000 Constraint 372 539 0.8000 1.0000 2.0000 0.0000 Constraint 372 510 0.8000 1.0000 2.0000 0.0000 Constraint 372 505 0.8000 1.0000 2.0000 0.0000 Constraint 372 478 0.8000 1.0000 2.0000 0.0000 Constraint 372 459 0.8000 1.0000 2.0000 0.0000 Constraint 372 437 0.8000 1.0000 2.0000 0.0000 Constraint 372 430 0.8000 1.0000 2.0000 0.0000 Constraint 372 419 0.8000 1.0000 2.0000 0.0000 Constraint 372 411 0.8000 1.0000 2.0000 0.0000 Constraint 372 404 0.8000 1.0000 2.0000 0.0000 Constraint 372 396 0.8000 1.0000 2.0000 0.0000 Constraint 372 388 0.8000 1.0000 2.0000 0.0000 Constraint 372 380 0.8000 1.0000 2.0000 0.0000 Constraint 361 1051 0.8000 1.0000 2.0000 0.0000 Constraint 361 1043 0.8000 1.0000 2.0000 0.0000 Constraint 361 1033 0.8000 1.0000 2.0000 0.0000 Constraint 361 1026 0.8000 1.0000 2.0000 0.0000 Constraint 361 1019 0.8000 1.0000 2.0000 0.0000 Constraint 361 1011 0.8000 1.0000 2.0000 0.0000 Constraint 361 1003 0.8000 1.0000 2.0000 0.0000 Constraint 361 995 0.8000 1.0000 2.0000 0.0000 Constraint 361 987 0.8000 1.0000 2.0000 0.0000 Constraint 361 980 0.8000 1.0000 2.0000 0.0000 Constraint 361 972 0.8000 1.0000 2.0000 0.0000 Constraint 361 960 0.8000 1.0000 2.0000 0.0000 Constraint 361 951 0.8000 1.0000 2.0000 0.0000 Constraint 361 943 0.8000 1.0000 2.0000 0.0000 Constraint 361 931 0.8000 1.0000 2.0000 0.0000 Constraint 361 919 0.8000 1.0000 2.0000 0.0000 Constraint 361 901 0.8000 1.0000 2.0000 0.0000 Constraint 361 891 0.8000 1.0000 2.0000 0.0000 Constraint 361 883 0.8000 1.0000 2.0000 0.0000 Constraint 361 872 0.8000 1.0000 2.0000 0.0000 Constraint 361 866 0.8000 1.0000 2.0000 0.0000 Constraint 361 857 0.8000 1.0000 2.0000 0.0000 Constraint 361 849 0.8000 1.0000 2.0000 0.0000 Constraint 361 840 0.8000 1.0000 2.0000 0.0000 Constraint 361 827 0.8000 1.0000 2.0000 0.0000 Constraint 361 822 0.8000 1.0000 2.0000 0.0000 Constraint 361 814 0.8000 1.0000 2.0000 0.0000 Constraint 361 808 0.8000 1.0000 2.0000 0.0000 Constraint 361 801 0.8000 1.0000 2.0000 0.0000 Constraint 361 792 0.8000 1.0000 2.0000 0.0000 Constraint 361 784 0.8000 1.0000 2.0000 0.0000 Constraint 361 776 0.8000 1.0000 2.0000 0.0000 Constraint 361 768 0.8000 1.0000 2.0000 0.0000 Constraint 361 761 0.8000 1.0000 2.0000 0.0000 Constraint 361 751 0.8000 1.0000 2.0000 0.0000 Constraint 361 743 0.8000 1.0000 2.0000 0.0000 Constraint 361 735 0.8000 1.0000 2.0000 0.0000 Constraint 361 727 0.8000 1.0000 2.0000 0.0000 Constraint 361 719 0.8000 1.0000 2.0000 0.0000 Constraint 361 711 0.8000 1.0000 2.0000 0.0000 Constraint 361 706 0.8000 1.0000 2.0000 0.0000 Constraint 361 698 0.8000 1.0000 2.0000 0.0000 Constraint 361 674 0.8000 1.0000 2.0000 0.0000 Constraint 361 667 0.8000 1.0000 2.0000 0.0000 Constraint 361 650 0.8000 1.0000 2.0000 0.0000 Constraint 361 621 0.8000 1.0000 2.0000 0.0000 Constraint 361 614 0.8000 1.0000 2.0000 0.0000 Constraint 361 603 0.8000 1.0000 2.0000 0.0000 Constraint 361 590 0.8000 1.0000 2.0000 0.0000 Constraint 361 581 0.8000 1.0000 2.0000 0.0000 Constraint 361 574 0.8000 1.0000 2.0000 0.0000 Constraint 361 567 0.8000 1.0000 2.0000 0.0000 Constraint 361 560 0.8000 1.0000 2.0000 0.0000 Constraint 361 552 0.8000 1.0000 2.0000 0.0000 Constraint 361 547 0.8000 1.0000 2.0000 0.0000 Constraint 361 539 0.8000 1.0000 2.0000 0.0000 Constraint 361 531 0.8000 1.0000 2.0000 0.0000 Constraint 361 519 0.8000 1.0000 2.0000 0.0000 Constraint 361 510 0.8000 1.0000 2.0000 0.0000 Constraint 361 505 0.8000 1.0000 2.0000 0.0000 Constraint 361 500 0.8000 1.0000 2.0000 0.0000 Constraint 361 437 0.8000 1.0000 2.0000 0.0000 Constraint 361 430 0.8000 1.0000 2.0000 0.0000 Constraint 361 419 0.8000 1.0000 2.0000 0.0000 Constraint 361 411 0.8000 1.0000 2.0000 0.0000 Constraint 361 404 0.8000 1.0000 2.0000 0.0000 Constraint 361 396 0.8000 1.0000 2.0000 0.0000 Constraint 361 388 0.8000 1.0000 2.0000 0.0000 Constraint 361 380 0.8000 1.0000 2.0000 0.0000 Constraint 361 372 0.8000 1.0000 2.0000 0.0000 Constraint 352 1051 0.8000 1.0000 2.0000 0.0000 Constraint 352 1043 0.8000 1.0000 2.0000 0.0000 Constraint 352 1033 0.8000 1.0000 2.0000 0.0000 Constraint 352 1026 0.8000 1.0000 2.0000 0.0000 Constraint 352 1019 0.8000 1.0000 2.0000 0.0000 Constraint 352 1011 0.8000 1.0000 2.0000 0.0000 Constraint 352 1003 0.8000 1.0000 2.0000 0.0000 Constraint 352 995 0.8000 1.0000 2.0000 0.0000 Constraint 352 987 0.8000 1.0000 2.0000 0.0000 Constraint 352 980 0.8000 1.0000 2.0000 0.0000 Constraint 352 972 0.8000 1.0000 2.0000 0.0000 Constraint 352 960 0.8000 1.0000 2.0000 0.0000 Constraint 352 951 0.8000 1.0000 2.0000 0.0000 Constraint 352 943 0.8000 1.0000 2.0000 0.0000 Constraint 352 931 0.8000 1.0000 2.0000 0.0000 Constraint 352 919 0.8000 1.0000 2.0000 0.0000 Constraint 352 911 0.8000 1.0000 2.0000 0.0000 Constraint 352 901 0.8000 1.0000 2.0000 0.0000 Constraint 352 891 0.8000 1.0000 2.0000 0.0000 Constraint 352 883 0.8000 1.0000 2.0000 0.0000 Constraint 352 872 0.8000 1.0000 2.0000 0.0000 Constraint 352 866 0.8000 1.0000 2.0000 0.0000 Constraint 352 857 0.8000 1.0000 2.0000 0.0000 Constraint 352 849 0.8000 1.0000 2.0000 0.0000 Constraint 352 840 0.8000 1.0000 2.0000 0.0000 Constraint 352 827 0.8000 1.0000 2.0000 0.0000 Constraint 352 822 0.8000 1.0000 2.0000 0.0000 Constraint 352 814 0.8000 1.0000 2.0000 0.0000 Constraint 352 808 0.8000 1.0000 2.0000 0.0000 Constraint 352 801 0.8000 1.0000 2.0000 0.0000 Constraint 352 792 0.8000 1.0000 2.0000 0.0000 Constraint 352 784 0.8000 1.0000 2.0000 0.0000 Constraint 352 776 0.8000 1.0000 2.0000 0.0000 Constraint 352 768 0.8000 1.0000 2.0000 0.0000 Constraint 352 761 0.8000 1.0000 2.0000 0.0000 Constraint 352 743 0.8000 1.0000 2.0000 0.0000 Constraint 352 735 0.8000 1.0000 2.0000 0.0000 Constraint 352 727 0.8000 1.0000 2.0000 0.0000 Constraint 352 719 0.8000 1.0000 2.0000 0.0000 Constraint 352 711 0.8000 1.0000 2.0000 0.0000 Constraint 352 706 0.8000 1.0000 2.0000 0.0000 Constraint 352 674 0.8000 1.0000 2.0000 0.0000 Constraint 352 667 0.8000 1.0000 2.0000 0.0000 Constraint 352 641 0.8000 1.0000 2.0000 0.0000 Constraint 352 633 0.8000 1.0000 2.0000 0.0000 Constraint 352 621 0.8000 1.0000 2.0000 0.0000 Constraint 352 614 0.8000 1.0000 2.0000 0.0000 Constraint 352 590 0.8000 1.0000 2.0000 0.0000 Constraint 352 552 0.8000 1.0000 2.0000 0.0000 Constraint 352 547 0.8000 1.0000 2.0000 0.0000 Constraint 352 539 0.8000 1.0000 2.0000 0.0000 Constraint 352 531 0.8000 1.0000 2.0000 0.0000 Constraint 352 519 0.8000 1.0000 2.0000 0.0000 Constraint 352 510 0.8000 1.0000 2.0000 0.0000 Constraint 352 505 0.8000 1.0000 2.0000 0.0000 Constraint 352 500 0.8000 1.0000 2.0000 0.0000 Constraint 352 430 0.8000 1.0000 2.0000 0.0000 Constraint 352 419 0.8000 1.0000 2.0000 0.0000 Constraint 352 411 0.8000 1.0000 2.0000 0.0000 Constraint 352 404 0.8000 1.0000 2.0000 0.0000 Constraint 352 396 0.8000 1.0000 2.0000 0.0000 Constraint 352 388 0.8000 1.0000 2.0000 0.0000 Constraint 352 380 0.8000 1.0000 2.0000 0.0000 Constraint 352 372 0.8000 1.0000 2.0000 0.0000 Constraint 352 361 0.8000 1.0000 2.0000 0.0000 Constraint 345 1051 0.8000 1.0000 2.0000 0.0000 Constraint 345 1043 0.8000 1.0000 2.0000 0.0000 Constraint 345 1033 0.8000 1.0000 2.0000 0.0000 Constraint 345 1026 0.8000 1.0000 2.0000 0.0000 Constraint 345 1019 0.8000 1.0000 2.0000 0.0000 Constraint 345 1011 0.8000 1.0000 2.0000 0.0000 Constraint 345 1003 0.8000 1.0000 2.0000 0.0000 Constraint 345 995 0.8000 1.0000 2.0000 0.0000 Constraint 345 987 0.8000 1.0000 2.0000 0.0000 Constraint 345 980 0.8000 1.0000 2.0000 0.0000 Constraint 345 972 0.8000 1.0000 2.0000 0.0000 Constraint 345 960 0.8000 1.0000 2.0000 0.0000 Constraint 345 951 0.8000 1.0000 2.0000 0.0000 Constraint 345 943 0.8000 1.0000 2.0000 0.0000 Constraint 345 911 0.8000 1.0000 2.0000 0.0000 Constraint 345 891 0.8000 1.0000 2.0000 0.0000 Constraint 345 883 0.8000 1.0000 2.0000 0.0000 Constraint 345 872 0.8000 1.0000 2.0000 0.0000 Constraint 345 866 0.8000 1.0000 2.0000 0.0000 Constraint 345 857 0.8000 1.0000 2.0000 0.0000 Constraint 345 849 0.8000 1.0000 2.0000 0.0000 Constraint 345 840 0.8000 1.0000 2.0000 0.0000 Constraint 345 827 0.8000 1.0000 2.0000 0.0000 Constraint 345 822 0.8000 1.0000 2.0000 0.0000 Constraint 345 814 0.8000 1.0000 2.0000 0.0000 Constraint 345 808 0.8000 1.0000 2.0000 0.0000 Constraint 345 801 0.8000 1.0000 2.0000 0.0000 Constraint 345 792 0.8000 1.0000 2.0000 0.0000 Constraint 345 761 0.8000 1.0000 2.0000 0.0000 Constraint 345 743 0.8000 1.0000 2.0000 0.0000 Constraint 345 735 0.8000 1.0000 2.0000 0.0000 Constraint 345 711 0.8000 1.0000 2.0000 0.0000 Constraint 345 690 0.8000 1.0000 2.0000 0.0000 Constraint 345 674 0.8000 1.0000 2.0000 0.0000 Constraint 345 667 0.8000 1.0000 2.0000 0.0000 Constraint 345 641 0.8000 1.0000 2.0000 0.0000 Constraint 345 621 0.8000 1.0000 2.0000 0.0000 Constraint 345 614 0.8000 1.0000 2.0000 0.0000 Constraint 345 567 0.8000 1.0000 2.0000 0.0000 Constraint 345 539 0.8000 1.0000 2.0000 0.0000 Constraint 345 531 0.8000 1.0000 2.0000 0.0000 Constraint 345 505 0.8000 1.0000 2.0000 0.0000 Constraint 345 500 0.8000 1.0000 2.0000 0.0000 Constraint 345 486 0.8000 1.0000 2.0000 0.0000 Constraint 345 445 0.8000 1.0000 2.0000 0.0000 Constraint 345 411 0.8000 1.0000 2.0000 0.0000 Constraint 345 404 0.8000 1.0000 2.0000 0.0000 Constraint 345 396 0.8000 1.0000 2.0000 0.0000 Constraint 345 388 0.8000 1.0000 2.0000 0.0000 Constraint 345 380 0.8000 1.0000 2.0000 0.0000 Constraint 345 372 0.8000 1.0000 2.0000 0.0000 Constraint 345 361 0.8000 1.0000 2.0000 0.0000 Constraint 345 352 0.8000 1.0000 2.0000 0.0000 Constraint 337 1051 0.8000 1.0000 2.0000 0.0000 Constraint 337 1043 0.8000 1.0000 2.0000 0.0000 Constraint 337 1033 0.8000 1.0000 2.0000 0.0000 Constraint 337 1026 0.8000 1.0000 2.0000 0.0000 Constraint 337 1019 0.8000 1.0000 2.0000 0.0000 Constraint 337 1011 0.8000 1.0000 2.0000 0.0000 Constraint 337 1003 0.8000 1.0000 2.0000 0.0000 Constraint 337 995 0.8000 1.0000 2.0000 0.0000 Constraint 337 987 0.8000 1.0000 2.0000 0.0000 Constraint 337 980 0.8000 1.0000 2.0000 0.0000 Constraint 337 972 0.8000 1.0000 2.0000 0.0000 Constraint 337 960 0.8000 1.0000 2.0000 0.0000 Constraint 337 951 0.8000 1.0000 2.0000 0.0000 Constraint 337 943 0.8000 1.0000 2.0000 0.0000 Constraint 337 931 0.8000 1.0000 2.0000 0.0000 Constraint 337 891 0.8000 1.0000 2.0000 0.0000 Constraint 337 883 0.8000 1.0000 2.0000 0.0000 Constraint 337 872 0.8000 1.0000 2.0000 0.0000 Constraint 337 866 0.8000 1.0000 2.0000 0.0000 Constraint 337 857 0.8000 1.0000 2.0000 0.0000 Constraint 337 840 0.8000 1.0000 2.0000 0.0000 Constraint 337 827 0.8000 1.0000 2.0000 0.0000 Constraint 337 822 0.8000 1.0000 2.0000 0.0000 Constraint 337 814 0.8000 1.0000 2.0000 0.0000 Constraint 337 808 0.8000 1.0000 2.0000 0.0000 Constraint 337 801 0.8000 1.0000 2.0000 0.0000 Constraint 337 792 0.8000 1.0000 2.0000 0.0000 Constraint 337 784 0.8000 1.0000 2.0000 0.0000 Constraint 337 776 0.8000 1.0000 2.0000 0.0000 Constraint 337 768 0.8000 1.0000 2.0000 0.0000 Constraint 337 761 0.8000 1.0000 2.0000 0.0000 Constraint 337 751 0.8000 1.0000 2.0000 0.0000 Constraint 337 743 0.8000 1.0000 2.0000 0.0000 Constraint 337 735 0.8000 1.0000 2.0000 0.0000 Constraint 337 727 0.8000 1.0000 2.0000 0.0000 Constraint 337 719 0.8000 1.0000 2.0000 0.0000 Constraint 337 706 0.8000 1.0000 2.0000 0.0000 Constraint 337 674 0.8000 1.0000 2.0000 0.0000 Constraint 337 667 0.8000 1.0000 2.0000 0.0000 Constraint 337 659 0.8000 1.0000 2.0000 0.0000 Constraint 337 650 0.8000 1.0000 2.0000 0.0000 Constraint 337 641 0.8000 1.0000 2.0000 0.0000 Constraint 337 633 0.8000 1.0000 2.0000 0.0000 Constraint 337 627 0.8000 1.0000 2.0000 0.0000 Constraint 337 621 0.8000 1.0000 2.0000 0.0000 Constraint 337 614 0.8000 1.0000 2.0000 0.0000 Constraint 337 590 0.8000 1.0000 2.0000 0.0000 Constraint 337 581 0.8000 1.0000 2.0000 0.0000 Constraint 337 574 0.8000 1.0000 2.0000 0.0000 Constraint 337 547 0.8000 1.0000 2.0000 0.0000 Constraint 337 539 0.8000 1.0000 2.0000 0.0000 Constraint 337 531 0.8000 1.0000 2.0000 0.0000 Constraint 337 519 0.8000 1.0000 2.0000 0.0000 Constraint 337 510 0.8000 1.0000 2.0000 0.0000 Constraint 337 505 0.8000 1.0000 2.0000 0.0000 Constraint 337 500 0.8000 1.0000 2.0000 0.0000 Constraint 337 486 0.8000 1.0000 2.0000 0.0000 Constraint 337 478 0.8000 1.0000 2.0000 0.0000 Constraint 337 459 0.8000 1.0000 2.0000 0.0000 Constraint 337 445 0.8000 1.0000 2.0000 0.0000 Constraint 337 430 0.8000 1.0000 2.0000 0.0000 Constraint 337 419 0.8000 1.0000 2.0000 0.0000 Constraint 337 411 0.8000 1.0000 2.0000 0.0000 Constraint 337 404 0.8000 1.0000 2.0000 0.0000 Constraint 337 396 0.8000 1.0000 2.0000 0.0000 Constraint 337 388 0.8000 1.0000 2.0000 0.0000 Constraint 337 380 0.8000 1.0000 2.0000 0.0000 Constraint 337 372 0.8000 1.0000 2.0000 0.0000 Constraint 337 361 0.8000 1.0000 2.0000 0.0000 Constraint 337 352 0.8000 1.0000 2.0000 0.0000 Constraint 337 345 0.8000 1.0000 2.0000 0.0000 Constraint 326 1051 0.8000 1.0000 2.0000 0.0000 Constraint 326 1043 0.8000 1.0000 2.0000 0.0000 Constraint 326 1033 0.8000 1.0000 2.0000 0.0000 Constraint 326 1026 0.8000 1.0000 2.0000 0.0000 Constraint 326 1019 0.8000 1.0000 2.0000 0.0000 Constraint 326 1011 0.8000 1.0000 2.0000 0.0000 Constraint 326 1003 0.8000 1.0000 2.0000 0.0000 Constraint 326 995 0.8000 1.0000 2.0000 0.0000 Constraint 326 987 0.8000 1.0000 2.0000 0.0000 Constraint 326 980 0.8000 1.0000 2.0000 0.0000 Constraint 326 972 0.8000 1.0000 2.0000 0.0000 Constraint 326 960 0.8000 1.0000 2.0000 0.0000 Constraint 326 951 0.8000 1.0000 2.0000 0.0000 Constraint 326 943 0.8000 1.0000 2.0000 0.0000 Constraint 326 872 0.8000 1.0000 2.0000 0.0000 Constraint 326 857 0.8000 1.0000 2.0000 0.0000 Constraint 326 849 0.8000 1.0000 2.0000 0.0000 Constraint 326 840 0.8000 1.0000 2.0000 0.0000 Constraint 326 827 0.8000 1.0000 2.0000 0.0000 Constraint 326 822 0.8000 1.0000 2.0000 0.0000 Constraint 326 814 0.8000 1.0000 2.0000 0.0000 Constraint 326 808 0.8000 1.0000 2.0000 0.0000 Constraint 326 801 0.8000 1.0000 2.0000 0.0000 Constraint 326 792 0.8000 1.0000 2.0000 0.0000 Constraint 326 784 0.8000 1.0000 2.0000 0.0000 Constraint 326 776 0.8000 1.0000 2.0000 0.0000 Constraint 326 768 0.8000 1.0000 2.0000 0.0000 Constraint 326 761 0.8000 1.0000 2.0000 0.0000 Constraint 326 751 0.8000 1.0000 2.0000 0.0000 Constraint 326 743 0.8000 1.0000 2.0000 0.0000 Constraint 326 735 0.8000 1.0000 2.0000 0.0000 Constraint 326 727 0.8000 1.0000 2.0000 0.0000 Constraint 326 719 0.8000 1.0000 2.0000 0.0000 Constraint 326 698 0.8000 1.0000 2.0000 0.0000 Constraint 326 690 0.8000 1.0000 2.0000 0.0000 Constraint 326 674 0.8000 1.0000 2.0000 0.0000 Constraint 326 667 0.8000 1.0000 2.0000 0.0000 Constraint 326 659 0.8000 1.0000 2.0000 0.0000 Constraint 326 650 0.8000 1.0000 2.0000 0.0000 Constraint 326 641 0.8000 1.0000 2.0000 0.0000 Constraint 326 633 0.8000 1.0000 2.0000 0.0000 Constraint 326 621 0.8000 1.0000 2.0000 0.0000 Constraint 326 614 0.8000 1.0000 2.0000 0.0000 Constraint 326 603 0.8000 1.0000 2.0000 0.0000 Constraint 326 597 0.8000 1.0000 2.0000 0.0000 Constraint 326 574 0.8000 1.0000 2.0000 0.0000 Constraint 326 567 0.8000 1.0000 2.0000 0.0000 Constraint 326 560 0.8000 1.0000 2.0000 0.0000 Constraint 326 552 0.8000 1.0000 2.0000 0.0000 Constraint 326 547 0.8000 1.0000 2.0000 0.0000 Constraint 326 539 0.8000 1.0000 2.0000 0.0000 Constraint 326 531 0.8000 1.0000 2.0000 0.0000 Constraint 326 505 0.8000 1.0000 2.0000 0.0000 Constraint 326 500 0.8000 1.0000 2.0000 0.0000 Constraint 326 478 0.8000 1.0000 2.0000 0.0000 Constraint 326 445 0.8000 1.0000 2.0000 0.0000 Constraint 326 411 0.8000 1.0000 2.0000 0.0000 Constraint 326 404 0.8000 1.0000 2.0000 0.0000 Constraint 326 396 0.8000 1.0000 2.0000 0.0000 Constraint 326 388 0.8000 1.0000 2.0000 0.0000 Constraint 326 380 0.8000 1.0000 2.0000 0.0000 Constraint 326 372 0.8000 1.0000 2.0000 0.0000 Constraint 326 361 0.8000 1.0000 2.0000 0.0000 Constraint 326 352 0.8000 1.0000 2.0000 0.0000 Constraint 326 345 0.8000 1.0000 2.0000 0.0000 Constraint 326 337 0.8000 1.0000 2.0000 0.0000 Constraint 317 1051 0.8000 1.0000 2.0000 0.0000 Constraint 317 1043 0.8000 1.0000 2.0000 0.0000 Constraint 317 1033 0.8000 1.0000 2.0000 0.0000 Constraint 317 1026 0.8000 1.0000 2.0000 0.0000 Constraint 317 1019 0.8000 1.0000 2.0000 0.0000 Constraint 317 1011 0.8000 1.0000 2.0000 0.0000 Constraint 317 1003 0.8000 1.0000 2.0000 0.0000 Constraint 317 995 0.8000 1.0000 2.0000 0.0000 Constraint 317 987 0.8000 1.0000 2.0000 0.0000 Constraint 317 980 0.8000 1.0000 2.0000 0.0000 Constraint 317 972 0.8000 1.0000 2.0000 0.0000 Constraint 317 960 0.8000 1.0000 2.0000 0.0000 Constraint 317 951 0.8000 1.0000 2.0000 0.0000 Constraint 317 943 0.8000 1.0000 2.0000 0.0000 Constraint 317 901 0.8000 1.0000 2.0000 0.0000 Constraint 317 891 0.8000 1.0000 2.0000 0.0000 Constraint 317 883 0.8000 1.0000 2.0000 0.0000 Constraint 317 872 0.8000 1.0000 2.0000 0.0000 Constraint 317 866 0.8000 1.0000 2.0000 0.0000 Constraint 317 857 0.8000 1.0000 2.0000 0.0000 Constraint 317 840 0.8000 1.0000 2.0000 0.0000 Constraint 317 827 0.8000 1.0000 2.0000 0.0000 Constraint 317 814 0.8000 1.0000 2.0000 0.0000 Constraint 317 808 0.8000 1.0000 2.0000 0.0000 Constraint 317 801 0.8000 1.0000 2.0000 0.0000 Constraint 317 792 0.8000 1.0000 2.0000 0.0000 Constraint 317 784 0.8000 1.0000 2.0000 0.0000 Constraint 317 776 0.8000 1.0000 2.0000 0.0000 Constraint 317 768 0.8000 1.0000 2.0000 0.0000 Constraint 317 761 0.8000 1.0000 2.0000 0.0000 Constraint 317 751 0.8000 1.0000 2.0000 0.0000 Constraint 317 727 0.8000 1.0000 2.0000 0.0000 Constraint 317 698 0.8000 1.0000 2.0000 0.0000 Constraint 317 674 0.8000 1.0000 2.0000 0.0000 Constraint 317 667 0.8000 1.0000 2.0000 0.0000 Constraint 317 659 0.8000 1.0000 2.0000 0.0000 Constraint 317 650 0.8000 1.0000 2.0000 0.0000 Constraint 317 641 0.8000 1.0000 2.0000 0.0000 Constraint 317 633 0.8000 1.0000 2.0000 0.0000 Constraint 317 614 0.8000 1.0000 2.0000 0.0000 Constraint 317 603 0.8000 1.0000 2.0000 0.0000 Constraint 317 597 0.8000 1.0000 2.0000 0.0000 Constraint 317 567 0.8000 1.0000 2.0000 0.0000 Constraint 317 560 0.8000 1.0000 2.0000 0.0000 Constraint 317 552 0.8000 1.0000 2.0000 0.0000 Constraint 317 531 0.8000 1.0000 2.0000 0.0000 Constraint 317 519 0.8000 1.0000 2.0000 0.0000 Constraint 317 505 0.8000 1.0000 2.0000 0.0000 Constraint 317 500 0.8000 1.0000 2.0000 0.0000 Constraint 317 493 0.8000 1.0000 2.0000 0.0000 Constraint 317 486 0.8000 1.0000 2.0000 0.0000 Constraint 317 478 0.8000 1.0000 2.0000 0.0000 Constraint 317 445 0.8000 1.0000 2.0000 0.0000 Constraint 317 437 0.8000 1.0000 2.0000 0.0000 Constraint 317 411 0.8000 1.0000 2.0000 0.0000 Constraint 317 396 0.8000 1.0000 2.0000 0.0000 Constraint 317 388 0.8000 1.0000 2.0000 0.0000 Constraint 317 380 0.8000 1.0000 2.0000 0.0000 Constraint 317 372 0.8000 1.0000 2.0000 0.0000 Constraint 317 361 0.8000 1.0000 2.0000 0.0000 Constraint 317 352 0.8000 1.0000 2.0000 0.0000 Constraint 317 345 0.8000 1.0000 2.0000 0.0000 Constraint 317 337 0.8000 1.0000 2.0000 0.0000 Constraint 317 326 0.8000 1.0000 2.0000 0.0000 Constraint 309 1051 0.8000 1.0000 2.0000 0.0000 Constraint 309 1043 0.8000 1.0000 2.0000 0.0000 Constraint 309 1033 0.8000 1.0000 2.0000 0.0000 Constraint 309 1026 0.8000 1.0000 2.0000 0.0000 Constraint 309 1019 0.8000 1.0000 2.0000 0.0000 Constraint 309 1011 0.8000 1.0000 2.0000 0.0000 Constraint 309 1003 0.8000 1.0000 2.0000 0.0000 Constraint 309 995 0.8000 1.0000 2.0000 0.0000 Constraint 309 987 0.8000 1.0000 2.0000 0.0000 Constraint 309 980 0.8000 1.0000 2.0000 0.0000 Constraint 309 972 0.8000 1.0000 2.0000 0.0000 Constraint 309 960 0.8000 1.0000 2.0000 0.0000 Constraint 309 951 0.8000 1.0000 2.0000 0.0000 Constraint 309 943 0.8000 1.0000 2.0000 0.0000 Constraint 309 919 0.8000 1.0000 2.0000 0.0000 Constraint 309 911 0.8000 1.0000 2.0000 0.0000 Constraint 309 872 0.8000 1.0000 2.0000 0.0000 Constraint 309 857 0.8000 1.0000 2.0000 0.0000 Constraint 309 849 0.8000 1.0000 2.0000 0.0000 Constraint 309 840 0.8000 1.0000 2.0000 0.0000 Constraint 309 827 0.8000 1.0000 2.0000 0.0000 Constraint 309 822 0.8000 1.0000 2.0000 0.0000 Constraint 309 814 0.8000 1.0000 2.0000 0.0000 Constraint 309 808 0.8000 1.0000 2.0000 0.0000 Constraint 309 801 0.8000 1.0000 2.0000 0.0000 Constraint 309 792 0.8000 1.0000 2.0000 0.0000 Constraint 309 784 0.8000 1.0000 2.0000 0.0000 Constraint 309 776 0.8000 1.0000 2.0000 0.0000 Constraint 309 768 0.8000 1.0000 2.0000 0.0000 Constraint 309 761 0.8000 1.0000 2.0000 0.0000 Constraint 309 751 0.8000 1.0000 2.0000 0.0000 Constraint 309 743 0.8000 1.0000 2.0000 0.0000 Constraint 309 727 0.8000 1.0000 2.0000 0.0000 Constraint 309 719 0.8000 1.0000 2.0000 0.0000 Constraint 309 706 0.8000 1.0000 2.0000 0.0000 Constraint 309 698 0.8000 1.0000 2.0000 0.0000 Constraint 309 690 0.8000 1.0000 2.0000 0.0000 Constraint 309 682 0.8000 1.0000 2.0000 0.0000 Constraint 309 674 0.8000 1.0000 2.0000 0.0000 Constraint 309 667 0.8000 1.0000 2.0000 0.0000 Constraint 309 659 0.8000 1.0000 2.0000 0.0000 Constraint 309 650 0.8000 1.0000 2.0000 0.0000 Constraint 309 641 0.8000 1.0000 2.0000 0.0000 Constraint 309 633 0.8000 1.0000 2.0000 0.0000 Constraint 309 621 0.8000 1.0000 2.0000 0.0000 Constraint 309 614 0.8000 1.0000 2.0000 0.0000 Constraint 309 547 0.8000 1.0000 2.0000 0.0000 Constraint 309 539 0.8000 1.0000 2.0000 0.0000 Constraint 309 531 0.8000 1.0000 2.0000 0.0000 Constraint 309 510 0.8000 1.0000 2.0000 0.0000 Constraint 309 505 0.8000 1.0000 2.0000 0.0000 Constraint 309 500 0.8000 1.0000 2.0000 0.0000 Constraint 309 486 0.8000 1.0000 2.0000 0.0000 Constraint 309 459 0.8000 1.0000 2.0000 0.0000 Constraint 309 445 0.8000 1.0000 2.0000 0.0000 Constraint 309 437 0.8000 1.0000 2.0000 0.0000 Constraint 309 430 0.8000 1.0000 2.0000 0.0000 Constraint 309 419 0.8000 1.0000 2.0000 0.0000 Constraint 309 411 0.8000 1.0000 2.0000 0.0000 Constraint 309 404 0.8000 1.0000 2.0000 0.0000 Constraint 309 380 0.8000 1.0000 2.0000 0.0000 Constraint 309 372 0.8000 1.0000 2.0000 0.0000 Constraint 309 361 0.8000 1.0000 2.0000 0.0000 Constraint 309 352 0.8000 1.0000 2.0000 0.0000 Constraint 309 345 0.8000 1.0000 2.0000 0.0000 Constraint 309 337 0.8000 1.0000 2.0000 0.0000 Constraint 309 326 0.8000 1.0000 2.0000 0.0000 Constraint 309 317 0.8000 1.0000 2.0000 0.0000 Constraint 303 1051 0.8000 1.0000 2.0000 0.0000 Constraint 303 1043 0.8000 1.0000 2.0000 0.0000 Constraint 303 1033 0.8000 1.0000 2.0000 0.0000 Constraint 303 1026 0.8000 1.0000 2.0000 0.0000 Constraint 303 1019 0.8000 1.0000 2.0000 0.0000 Constraint 303 1011 0.8000 1.0000 2.0000 0.0000 Constraint 303 1003 0.8000 1.0000 2.0000 0.0000 Constraint 303 995 0.8000 1.0000 2.0000 0.0000 Constraint 303 987 0.8000 1.0000 2.0000 0.0000 Constraint 303 980 0.8000 1.0000 2.0000 0.0000 Constraint 303 972 0.8000 1.0000 2.0000 0.0000 Constraint 303 960 0.8000 1.0000 2.0000 0.0000 Constraint 303 951 0.8000 1.0000 2.0000 0.0000 Constraint 303 943 0.8000 1.0000 2.0000 0.0000 Constraint 303 919 0.8000 1.0000 2.0000 0.0000 Constraint 303 911 0.8000 1.0000 2.0000 0.0000 Constraint 303 901 0.8000 1.0000 2.0000 0.0000 Constraint 303 891 0.8000 1.0000 2.0000 0.0000 Constraint 303 883 0.8000 1.0000 2.0000 0.0000 Constraint 303 872 0.8000 1.0000 2.0000 0.0000 Constraint 303 866 0.8000 1.0000 2.0000 0.0000 Constraint 303 857 0.8000 1.0000 2.0000 0.0000 Constraint 303 849 0.8000 1.0000 2.0000 0.0000 Constraint 303 840 0.8000 1.0000 2.0000 0.0000 Constraint 303 827 0.8000 1.0000 2.0000 0.0000 Constraint 303 822 0.8000 1.0000 2.0000 0.0000 Constraint 303 814 0.8000 1.0000 2.0000 0.0000 Constraint 303 808 0.8000 1.0000 2.0000 0.0000 Constraint 303 801 0.8000 1.0000 2.0000 0.0000 Constraint 303 792 0.8000 1.0000 2.0000 0.0000 Constraint 303 784 0.8000 1.0000 2.0000 0.0000 Constraint 303 776 0.8000 1.0000 2.0000 0.0000 Constraint 303 768 0.8000 1.0000 2.0000 0.0000 Constraint 303 761 0.8000 1.0000 2.0000 0.0000 Constraint 303 751 0.8000 1.0000 2.0000 0.0000 Constraint 303 743 0.8000 1.0000 2.0000 0.0000 Constraint 303 735 0.8000 1.0000 2.0000 0.0000 Constraint 303 727 0.8000 1.0000 2.0000 0.0000 Constraint 303 719 0.8000 1.0000 2.0000 0.0000 Constraint 303 711 0.8000 1.0000 2.0000 0.0000 Constraint 303 706 0.8000 1.0000 2.0000 0.0000 Constraint 303 698 0.8000 1.0000 2.0000 0.0000 Constraint 303 690 0.8000 1.0000 2.0000 0.0000 Constraint 303 682 0.8000 1.0000 2.0000 0.0000 Constraint 303 674 0.8000 1.0000 2.0000 0.0000 Constraint 303 667 0.8000 1.0000 2.0000 0.0000 Constraint 303 650 0.8000 1.0000 2.0000 0.0000 Constraint 303 641 0.8000 1.0000 2.0000 0.0000 Constraint 303 633 0.8000 1.0000 2.0000 0.0000 Constraint 303 621 0.8000 1.0000 2.0000 0.0000 Constraint 303 614 0.8000 1.0000 2.0000 0.0000 Constraint 303 603 0.8000 1.0000 2.0000 0.0000 Constraint 303 597 0.8000 1.0000 2.0000 0.0000 Constraint 303 590 0.8000 1.0000 2.0000 0.0000 Constraint 303 581 0.8000 1.0000 2.0000 0.0000 Constraint 303 574 0.8000 1.0000 2.0000 0.0000 Constraint 303 552 0.8000 1.0000 2.0000 0.0000 Constraint 303 531 0.8000 1.0000 2.0000 0.0000 Constraint 303 510 0.8000 1.0000 2.0000 0.0000 Constraint 303 505 0.8000 1.0000 2.0000 0.0000 Constraint 303 459 0.8000 1.0000 2.0000 0.0000 Constraint 303 445 0.8000 1.0000 2.0000 0.0000 Constraint 303 437 0.8000 1.0000 2.0000 0.0000 Constraint 303 430 0.8000 1.0000 2.0000 0.0000 Constraint 303 419 0.8000 1.0000 2.0000 0.0000 Constraint 303 411 0.8000 1.0000 2.0000 0.0000 Constraint 303 404 0.8000 1.0000 2.0000 0.0000 Constraint 303 396 0.8000 1.0000 2.0000 0.0000 Constraint 303 388 0.8000 1.0000 2.0000 0.0000 Constraint 303 380 0.8000 1.0000 2.0000 0.0000 Constraint 303 372 0.8000 1.0000 2.0000 0.0000 Constraint 303 361 0.8000 1.0000 2.0000 0.0000 Constraint 303 352 0.8000 1.0000 2.0000 0.0000 Constraint 303 345 0.8000 1.0000 2.0000 0.0000 Constraint 303 337 0.8000 1.0000 2.0000 0.0000 Constraint 303 326 0.8000 1.0000 2.0000 0.0000 Constraint 303 317 0.8000 1.0000 2.0000 0.0000 Constraint 303 309 0.8000 1.0000 2.0000 0.0000 Constraint 294 1051 0.8000 1.0000 2.0000 0.0000 Constraint 294 1043 0.8000 1.0000 2.0000 0.0000 Constraint 294 1033 0.8000 1.0000 2.0000 0.0000 Constraint 294 1026 0.8000 1.0000 2.0000 0.0000 Constraint 294 1019 0.8000 1.0000 2.0000 0.0000 Constraint 294 1011 0.8000 1.0000 2.0000 0.0000 Constraint 294 1003 0.8000 1.0000 2.0000 0.0000 Constraint 294 995 0.8000 1.0000 2.0000 0.0000 Constraint 294 987 0.8000 1.0000 2.0000 0.0000 Constraint 294 980 0.8000 1.0000 2.0000 0.0000 Constraint 294 972 0.8000 1.0000 2.0000 0.0000 Constraint 294 960 0.8000 1.0000 2.0000 0.0000 Constraint 294 951 0.8000 1.0000 2.0000 0.0000 Constraint 294 943 0.8000 1.0000 2.0000 0.0000 Constraint 294 931 0.8000 1.0000 2.0000 0.0000 Constraint 294 919 0.8000 1.0000 2.0000 0.0000 Constraint 294 911 0.8000 1.0000 2.0000 0.0000 Constraint 294 901 0.8000 1.0000 2.0000 0.0000 Constraint 294 883 0.8000 1.0000 2.0000 0.0000 Constraint 294 872 0.8000 1.0000 2.0000 0.0000 Constraint 294 866 0.8000 1.0000 2.0000 0.0000 Constraint 294 857 0.8000 1.0000 2.0000 0.0000 Constraint 294 849 0.8000 1.0000 2.0000 0.0000 Constraint 294 840 0.8000 1.0000 2.0000 0.0000 Constraint 294 827 0.8000 1.0000 2.0000 0.0000 Constraint 294 822 0.8000 1.0000 2.0000 0.0000 Constraint 294 814 0.8000 1.0000 2.0000 0.0000 Constraint 294 808 0.8000 1.0000 2.0000 0.0000 Constraint 294 801 0.8000 1.0000 2.0000 0.0000 Constraint 294 792 0.8000 1.0000 2.0000 0.0000 Constraint 294 784 0.8000 1.0000 2.0000 0.0000 Constraint 294 776 0.8000 1.0000 2.0000 0.0000 Constraint 294 768 0.8000 1.0000 2.0000 0.0000 Constraint 294 761 0.8000 1.0000 2.0000 0.0000 Constraint 294 751 0.8000 1.0000 2.0000 0.0000 Constraint 294 743 0.8000 1.0000 2.0000 0.0000 Constraint 294 735 0.8000 1.0000 2.0000 0.0000 Constraint 294 727 0.8000 1.0000 2.0000 0.0000 Constraint 294 719 0.8000 1.0000 2.0000 0.0000 Constraint 294 711 0.8000 1.0000 2.0000 0.0000 Constraint 294 706 0.8000 1.0000 2.0000 0.0000 Constraint 294 698 0.8000 1.0000 2.0000 0.0000 Constraint 294 690 0.8000 1.0000 2.0000 0.0000 Constraint 294 682 0.8000 1.0000 2.0000 0.0000 Constraint 294 674 0.8000 1.0000 2.0000 0.0000 Constraint 294 667 0.8000 1.0000 2.0000 0.0000 Constraint 294 659 0.8000 1.0000 2.0000 0.0000 Constraint 294 650 0.8000 1.0000 2.0000 0.0000 Constraint 294 641 0.8000 1.0000 2.0000 0.0000 Constraint 294 633 0.8000 1.0000 2.0000 0.0000 Constraint 294 621 0.8000 1.0000 2.0000 0.0000 Constraint 294 614 0.8000 1.0000 2.0000 0.0000 Constraint 294 603 0.8000 1.0000 2.0000 0.0000 Constraint 294 597 0.8000 1.0000 2.0000 0.0000 Constraint 294 531 0.8000 1.0000 2.0000 0.0000 Constraint 294 510 0.8000 1.0000 2.0000 0.0000 Constraint 294 505 0.8000 1.0000 2.0000 0.0000 Constraint 294 500 0.8000 1.0000 2.0000 0.0000 Constraint 294 493 0.8000 1.0000 2.0000 0.0000 Constraint 294 486 0.8000 1.0000 2.0000 0.0000 Constraint 294 478 0.8000 1.0000 2.0000 0.0000 Constraint 294 471 0.8000 1.0000 2.0000 0.0000 Constraint 294 466 0.8000 1.0000 2.0000 0.0000 Constraint 294 459 0.8000 1.0000 2.0000 0.0000 Constraint 294 445 0.8000 1.0000 2.0000 0.0000 Constraint 294 437 0.8000 1.0000 2.0000 0.0000 Constraint 294 430 0.8000 1.0000 2.0000 0.0000 Constraint 294 419 0.8000 1.0000 2.0000 0.0000 Constraint 294 411 0.8000 1.0000 2.0000 0.0000 Constraint 294 404 0.8000 1.0000 2.0000 0.0000 Constraint 294 361 0.8000 1.0000 2.0000 0.0000 Constraint 294 352 0.8000 1.0000 2.0000 0.0000 Constraint 294 345 0.8000 1.0000 2.0000 0.0000 Constraint 294 337 0.8000 1.0000 2.0000 0.0000 Constraint 294 326 0.8000 1.0000 2.0000 0.0000 Constraint 294 317 0.8000 1.0000 2.0000 0.0000 Constraint 294 309 0.8000 1.0000 2.0000 0.0000 Constraint 294 303 0.8000 1.0000 2.0000 0.0000 Constraint 286 1051 0.8000 1.0000 2.0000 0.0000 Constraint 286 1043 0.8000 1.0000 2.0000 0.0000 Constraint 286 1033 0.8000 1.0000 2.0000 0.0000 Constraint 286 1026 0.8000 1.0000 2.0000 0.0000 Constraint 286 1019 0.8000 1.0000 2.0000 0.0000 Constraint 286 1011 0.8000 1.0000 2.0000 0.0000 Constraint 286 1003 0.8000 1.0000 2.0000 0.0000 Constraint 286 995 0.8000 1.0000 2.0000 0.0000 Constraint 286 987 0.8000 1.0000 2.0000 0.0000 Constraint 286 980 0.8000 1.0000 2.0000 0.0000 Constraint 286 972 0.8000 1.0000 2.0000 0.0000 Constraint 286 960 0.8000 1.0000 2.0000 0.0000 Constraint 286 951 0.8000 1.0000 2.0000 0.0000 Constraint 286 943 0.8000 1.0000 2.0000 0.0000 Constraint 286 931 0.8000 1.0000 2.0000 0.0000 Constraint 286 919 0.8000 1.0000 2.0000 0.0000 Constraint 286 911 0.8000 1.0000 2.0000 0.0000 Constraint 286 901 0.8000 1.0000 2.0000 0.0000 Constraint 286 883 0.8000 1.0000 2.0000 0.0000 Constraint 286 872 0.8000 1.0000 2.0000 0.0000 Constraint 286 866 0.8000 1.0000 2.0000 0.0000 Constraint 286 857 0.8000 1.0000 2.0000 0.0000 Constraint 286 840 0.8000 1.0000 2.0000 0.0000 Constraint 286 827 0.8000 1.0000 2.0000 0.0000 Constraint 286 822 0.8000 1.0000 2.0000 0.0000 Constraint 286 814 0.8000 1.0000 2.0000 0.0000 Constraint 286 808 0.8000 1.0000 2.0000 0.0000 Constraint 286 801 0.8000 1.0000 2.0000 0.0000 Constraint 286 792 0.8000 1.0000 2.0000 0.0000 Constraint 286 784 0.8000 1.0000 2.0000 0.0000 Constraint 286 776 0.8000 1.0000 2.0000 0.0000 Constraint 286 768 0.8000 1.0000 2.0000 0.0000 Constraint 286 761 0.8000 1.0000 2.0000 0.0000 Constraint 286 751 0.8000 1.0000 2.0000 0.0000 Constraint 286 743 0.8000 1.0000 2.0000 0.0000 Constraint 286 735 0.8000 1.0000 2.0000 0.0000 Constraint 286 727 0.8000 1.0000 2.0000 0.0000 Constraint 286 719 0.8000 1.0000 2.0000 0.0000 Constraint 286 711 0.8000 1.0000 2.0000 0.0000 Constraint 286 706 0.8000 1.0000 2.0000 0.0000 Constraint 286 698 0.8000 1.0000 2.0000 0.0000 Constraint 286 690 0.8000 1.0000 2.0000 0.0000 Constraint 286 682 0.8000 1.0000 2.0000 0.0000 Constraint 286 674 0.8000 1.0000 2.0000 0.0000 Constraint 286 667 0.8000 1.0000 2.0000 0.0000 Constraint 286 659 0.8000 1.0000 2.0000 0.0000 Constraint 286 650 0.8000 1.0000 2.0000 0.0000 Constraint 286 641 0.8000 1.0000 2.0000 0.0000 Constraint 286 633 0.8000 1.0000 2.0000 0.0000 Constraint 286 627 0.8000 1.0000 2.0000 0.0000 Constraint 286 621 0.8000 1.0000 2.0000 0.0000 Constraint 286 614 0.8000 1.0000 2.0000 0.0000 Constraint 286 603 0.8000 1.0000 2.0000 0.0000 Constraint 286 597 0.8000 1.0000 2.0000 0.0000 Constraint 286 581 0.8000 1.0000 2.0000 0.0000 Constraint 286 531 0.8000 1.0000 2.0000 0.0000 Constraint 286 519 0.8000 1.0000 2.0000 0.0000 Constraint 286 510 0.8000 1.0000 2.0000 0.0000 Constraint 286 505 0.8000 1.0000 2.0000 0.0000 Constraint 286 500 0.8000 1.0000 2.0000 0.0000 Constraint 286 493 0.8000 1.0000 2.0000 0.0000 Constraint 286 486 0.8000 1.0000 2.0000 0.0000 Constraint 286 478 0.8000 1.0000 2.0000 0.0000 Constraint 286 471 0.8000 1.0000 2.0000 0.0000 Constraint 286 466 0.8000 1.0000 2.0000 0.0000 Constraint 286 459 0.8000 1.0000 2.0000 0.0000 Constraint 286 445 0.8000 1.0000 2.0000 0.0000 Constraint 286 437 0.8000 1.0000 2.0000 0.0000 Constraint 286 430 0.8000 1.0000 2.0000 0.0000 Constraint 286 419 0.8000 1.0000 2.0000 0.0000 Constraint 286 411 0.8000 1.0000 2.0000 0.0000 Constraint 286 404 0.8000 1.0000 2.0000 0.0000 Constraint 286 396 0.8000 1.0000 2.0000 0.0000 Constraint 286 388 0.8000 1.0000 2.0000 0.0000 Constraint 286 372 0.8000 1.0000 2.0000 0.0000 Constraint 286 352 0.8000 1.0000 2.0000 0.0000 Constraint 286 345 0.8000 1.0000 2.0000 0.0000 Constraint 286 337 0.8000 1.0000 2.0000 0.0000 Constraint 286 326 0.8000 1.0000 2.0000 0.0000 Constraint 286 317 0.8000 1.0000 2.0000 0.0000 Constraint 286 309 0.8000 1.0000 2.0000 0.0000 Constraint 286 303 0.8000 1.0000 2.0000 0.0000 Constraint 286 294 0.8000 1.0000 2.0000 0.0000 Constraint 277 1051 0.8000 1.0000 2.0000 0.0000 Constraint 277 1043 0.8000 1.0000 2.0000 0.0000 Constraint 277 1033 0.8000 1.0000 2.0000 0.0000 Constraint 277 1026 0.8000 1.0000 2.0000 0.0000 Constraint 277 1019 0.8000 1.0000 2.0000 0.0000 Constraint 277 1011 0.8000 1.0000 2.0000 0.0000 Constraint 277 1003 0.8000 1.0000 2.0000 0.0000 Constraint 277 995 0.8000 1.0000 2.0000 0.0000 Constraint 277 987 0.8000 1.0000 2.0000 0.0000 Constraint 277 980 0.8000 1.0000 2.0000 0.0000 Constraint 277 972 0.8000 1.0000 2.0000 0.0000 Constraint 277 960 0.8000 1.0000 2.0000 0.0000 Constraint 277 951 0.8000 1.0000 2.0000 0.0000 Constraint 277 943 0.8000 1.0000 2.0000 0.0000 Constraint 277 931 0.8000 1.0000 2.0000 0.0000 Constraint 277 919 0.8000 1.0000 2.0000 0.0000 Constraint 277 911 0.8000 1.0000 2.0000 0.0000 Constraint 277 901 0.8000 1.0000 2.0000 0.0000 Constraint 277 891 0.8000 1.0000 2.0000 0.0000 Constraint 277 883 0.8000 1.0000 2.0000 0.0000 Constraint 277 872 0.8000 1.0000 2.0000 0.0000 Constraint 277 866 0.8000 1.0000 2.0000 0.0000 Constraint 277 857 0.8000 1.0000 2.0000 0.0000 Constraint 277 840 0.8000 1.0000 2.0000 0.0000 Constraint 277 827 0.8000 1.0000 2.0000 0.0000 Constraint 277 822 0.8000 1.0000 2.0000 0.0000 Constraint 277 814 0.8000 1.0000 2.0000 0.0000 Constraint 277 808 0.8000 1.0000 2.0000 0.0000 Constraint 277 801 0.8000 1.0000 2.0000 0.0000 Constraint 277 792 0.8000 1.0000 2.0000 0.0000 Constraint 277 784 0.8000 1.0000 2.0000 0.0000 Constraint 277 776 0.8000 1.0000 2.0000 0.0000 Constraint 277 768 0.8000 1.0000 2.0000 0.0000 Constraint 277 761 0.8000 1.0000 2.0000 0.0000 Constraint 277 751 0.8000 1.0000 2.0000 0.0000 Constraint 277 743 0.8000 1.0000 2.0000 0.0000 Constraint 277 735 0.8000 1.0000 2.0000 0.0000 Constraint 277 727 0.8000 1.0000 2.0000 0.0000 Constraint 277 719 0.8000 1.0000 2.0000 0.0000 Constraint 277 711 0.8000 1.0000 2.0000 0.0000 Constraint 277 706 0.8000 1.0000 2.0000 0.0000 Constraint 277 698 0.8000 1.0000 2.0000 0.0000 Constraint 277 690 0.8000 1.0000 2.0000 0.0000 Constraint 277 682 0.8000 1.0000 2.0000 0.0000 Constraint 277 674 0.8000 1.0000 2.0000 0.0000 Constraint 277 667 0.8000 1.0000 2.0000 0.0000 Constraint 277 659 0.8000 1.0000 2.0000 0.0000 Constraint 277 650 0.8000 1.0000 2.0000 0.0000 Constraint 277 641 0.8000 1.0000 2.0000 0.0000 Constraint 277 633 0.8000 1.0000 2.0000 0.0000 Constraint 277 627 0.8000 1.0000 2.0000 0.0000 Constraint 277 621 0.8000 1.0000 2.0000 0.0000 Constraint 277 614 0.8000 1.0000 2.0000 0.0000 Constraint 277 603 0.8000 1.0000 2.0000 0.0000 Constraint 277 590 0.8000 1.0000 2.0000 0.0000 Constraint 277 581 0.8000 1.0000 2.0000 0.0000 Constraint 277 574 0.8000 1.0000 2.0000 0.0000 Constraint 277 547 0.8000 1.0000 2.0000 0.0000 Constraint 277 531 0.8000 1.0000 2.0000 0.0000 Constraint 277 519 0.8000 1.0000 2.0000 0.0000 Constraint 277 510 0.8000 1.0000 2.0000 0.0000 Constraint 277 505 0.8000 1.0000 2.0000 0.0000 Constraint 277 500 0.8000 1.0000 2.0000 0.0000 Constraint 277 493 0.8000 1.0000 2.0000 0.0000 Constraint 277 459 0.8000 1.0000 2.0000 0.0000 Constraint 277 445 0.8000 1.0000 2.0000 0.0000 Constraint 277 437 0.8000 1.0000 2.0000 0.0000 Constraint 277 419 0.8000 1.0000 2.0000 0.0000 Constraint 277 411 0.8000 1.0000 2.0000 0.0000 Constraint 277 404 0.8000 1.0000 2.0000 0.0000 Constraint 277 388 0.8000 1.0000 2.0000 0.0000 Constraint 277 380 0.8000 1.0000 2.0000 0.0000 Constraint 277 345 0.8000 1.0000 2.0000 0.0000 Constraint 277 337 0.8000 1.0000 2.0000 0.0000 Constraint 277 326 0.8000 1.0000 2.0000 0.0000 Constraint 277 317 0.8000 1.0000 2.0000 0.0000 Constraint 277 309 0.8000 1.0000 2.0000 0.0000 Constraint 277 303 0.8000 1.0000 2.0000 0.0000 Constraint 277 294 0.8000 1.0000 2.0000 0.0000 Constraint 277 286 0.8000 1.0000 2.0000 0.0000 Constraint 270 1051 0.8000 1.0000 2.0000 0.0000 Constraint 270 1043 0.8000 1.0000 2.0000 0.0000 Constraint 270 1033 0.8000 1.0000 2.0000 0.0000 Constraint 270 1026 0.8000 1.0000 2.0000 0.0000 Constraint 270 1019 0.8000 1.0000 2.0000 0.0000 Constraint 270 1011 0.8000 1.0000 2.0000 0.0000 Constraint 270 1003 0.8000 1.0000 2.0000 0.0000 Constraint 270 995 0.8000 1.0000 2.0000 0.0000 Constraint 270 987 0.8000 1.0000 2.0000 0.0000 Constraint 270 980 0.8000 1.0000 2.0000 0.0000 Constraint 270 972 0.8000 1.0000 2.0000 0.0000 Constraint 270 960 0.8000 1.0000 2.0000 0.0000 Constraint 270 951 0.8000 1.0000 2.0000 0.0000 Constraint 270 943 0.8000 1.0000 2.0000 0.0000 Constraint 270 931 0.8000 1.0000 2.0000 0.0000 Constraint 270 919 0.8000 1.0000 2.0000 0.0000 Constraint 270 911 0.8000 1.0000 2.0000 0.0000 Constraint 270 901 0.8000 1.0000 2.0000 0.0000 Constraint 270 891 0.8000 1.0000 2.0000 0.0000 Constraint 270 883 0.8000 1.0000 2.0000 0.0000 Constraint 270 872 0.8000 1.0000 2.0000 0.0000 Constraint 270 866 0.8000 1.0000 2.0000 0.0000 Constraint 270 857 0.8000 1.0000 2.0000 0.0000 Constraint 270 849 0.8000 1.0000 2.0000 0.0000 Constraint 270 840 0.8000 1.0000 2.0000 0.0000 Constraint 270 827 0.8000 1.0000 2.0000 0.0000 Constraint 270 822 0.8000 1.0000 2.0000 0.0000 Constraint 270 814 0.8000 1.0000 2.0000 0.0000 Constraint 270 808 0.8000 1.0000 2.0000 0.0000 Constraint 270 801 0.8000 1.0000 2.0000 0.0000 Constraint 270 792 0.8000 1.0000 2.0000 0.0000 Constraint 270 784 0.8000 1.0000 2.0000 0.0000 Constraint 270 776 0.8000 1.0000 2.0000 0.0000 Constraint 270 768 0.8000 1.0000 2.0000 0.0000 Constraint 270 761 0.8000 1.0000 2.0000 0.0000 Constraint 270 751 0.8000 1.0000 2.0000 0.0000 Constraint 270 743 0.8000 1.0000 2.0000 0.0000 Constraint 270 735 0.8000 1.0000 2.0000 0.0000 Constraint 270 727 0.8000 1.0000 2.0000 0.0000 Constraint 270 711 0.8000 1.0000 2.0000 0.0000 Constraint 270 706 0.8000 1.0000 2.0000 0.0000 Constraint 270 698 0.8000 1.0000 2.0000 0.0000 Constraint 270 690 0.8000 1.0000 2.0000 0.0000 Constraint 270 682 0.8000 1.0000 2.0000 0.0000 Constraint 270 674 0.8000 1.0000 2.0000 0.0000 Constraint 270 667 0.8000 1.0000 2.0000 0.0000 Constraint 270 659 0.8000 1.0000 2.0000 0.0000 Constraint 270 650 0.8000 1.0000 2.0000 0.0000 Constraint 270 641 0.8000 1.0000 2.0000 0.0000 Constraint 270 633 0.8000 1.0000 2.0000 0.0000 Constraint 270 627 0.8000 1.0000 2.0000 0.0000 Constraint 270 621 0.8000 1.0000 2.0000 0.0000 Constraint 270 614 0.8000 1.0000 2.0000 0.0000 Constraint 270 603 0.8000 1.0000 2.0000 0.0000 Constraint 270 597 0.8000 1.0000 2.0000 0.0000 Constraint 270 581 0.8000 1.0000 2.0000 0.0000 Constraint 270 510 0.8000 1.0000 2.0000 0.0000 Constraint 270 505 0.8000 1.0000 2.0000 0.0000 Constraint 270 459 0.8000 1.0000 2.0000 0.0000 Constraint 270 445 0.8000 1.0000 2.0000 0.0000 Constraint 270 419 0.8000 1.0000 2.0000 0.0000 Constraint 270 411 0.8000 1.0000 2.0000 0.0000 Constraint 270 404 0.8000 1.0000 2.0000 0.0000 Constraint 270 396 0.8000 1.0000 2.0000 0.0000 Constraint 270 388 0.8000 1.0000 2.0000 0.0000 Constraint 270 380 0.8000 1.0000 2.0000 0.0000 Constraint 270 337 0.8000 1.0000 2.0000 0.0000 Constraint 270 326 0.8000 1.0000 2.0000 0.0000 Constraint 270 317 0.8000 1.0000 2.0000 0.0000 Constraint 270 309 0.8000 1.0000 2.0000 0.0000 Constraint 270 303 0.8000 1.0000 2.0000 0.0000 Constraint 270 294 0.8000 1.0000 2.0000 0.0000 Constraint 270 286 0.8000 1.0000 2.0000 0.0000 Constraint 270 277 0.8000 1.0000 2.0000 0.0000 Constraint 262 1051 0.8000 1.0000 2.0000 0.0000 Constraint 262 1043 0.8000 1.0000 2.0000 0.0000 Constraint 262 1033 0.8000 1.0000 2.0000 0.0000 Constraint 262 1026 0.8000 1.0000 2.0000 0.0000 Constraint 262 1019 0.8000 1.0000 2.0000 0.0000 Constraint 262 1011 0.8000 1.0000 2.0000 0.0000 Constraint 262 1003 0.8000 1.0000 2.0000 0.0000 Constraint 262 995 0.8000 1.0000 2.0000 0.0000 Constraint 262 987 0.8000 1.0000 2.0000 0.0000 Constraint 262 980 0.8000 1.0000 2.0000 0.0000 Constraint 262 972 0.8000 1.0000 2.0000 0.0000 Constraint 262 960 0.8000 1.0000 2.0000 0.0000 Constraint 262 951 0.8000 1.0000 2.0000 0.0000 Constraint 262 943 0.8000 1.0000 2.0000 0.0000 Constraint 262 931 0.8000 1.0000 2.0000 0.0000 Constraint 262 919 0.8000 1.0000 2.0000 0.0000 Constraint 262 911 0.8000 1.0000 2.0000 0.0000 Constraint 262 901 0.8000 1.0000 2.0000 0.0000 Constraint 262 883 0.8000 1.0000 2.0000 0.0000 Constraint 262 872 0.8000 1.0000 2.0000 0.0000 Constraint 262 866 0.8000 1.0000 2.0000 0.0000 Constraint 262 857 0.8000 1.0000 2.0000 0.0000 Constraint 262 849 0.8000 1.0000 2.0000 0.0000 Constraint 262 840 0.8000 1.0000 2.0000 0.0000 Constraint 262 827 0.8000 1.0000 2.0000 0.0000 Constraint 262 822 0.8000 1.0000 2.0000 0.0000 Constraint 262 814 0.8000 1.0000 2.0000 0.0000 Constraint 262 808 0.8000 1.0000 2.0000 0.0000 Constraint 262 801 0.8000 1.0000 2.0000 0.0000 Constraint 262 792 0.8000 1.0000 2.0000 0.0000 Constraint 262 784 0.8000 1.0000 2.0000 0.0000 Constraint 262 776 0.8000 1.0000 2.0000 0.0000 Constraint 262 768 0.8000 1.0000 2.0000 0.0000 Constraint 262 761 0.8000 1.0000 2.0000 0.0000 Constraint 262 751 0.8000 1.0000 2.0000 0.0000 Constraint 262 743 0.8000 1.0000 2.0000 0.0000 Constraint 262 735 0.8000 1.0000 2.0000 0.0000 Constraint 262 727 0.8000 1.0000 2.0000 0.0000 Constraint 262 719 0.8000 1.0000 2.0000 0.0000 Constraint 262 711 0.8000 1.0000 2.0000 0.0000 Constraint 262 706 0.8000 1.0000 2.0000 0.0000 Constraint 262 698 0.8000 1.0000 2.0000 0.0000 Constraint 262 690 0.8000 1.0000 2.0000 0.0000 Constraint 262 682 0.8000 1.0000 2.0000 0.0000 Constraint 262 674 0.8000 1.0000 2.0000 0.0000 Constraint 262 667 0.8000 1.0000 2.0000 0.0000 Constraint 262 659 0.8000 1.0000 2.0000 0.0000 Constraint 262 650 0.8000 1.0000 2.0000 0.0000 Constraint 262 641 0.8000 1.0000 2.0000 0.0000 Constraint 262 633 0.8000 1.0000 2.0000 0.0000 Constraint 262 627 0.8000 1.0000 2.0000 0.0000 Constraint 262 621 0.8000 1.0000 2.0000 0.0000 Constraint 262 614 0.8000 1.0000 2.0000 0.0000 Constraint 262 603 0.8000 1.0000 2.0000 0.0000 Constraint 262 597 0.8000 1.0000 2.0000 0.0000 Constraint 262 590 0.8000 1.0000 2.0000 0.0000 Constraint 262 581 0.8000 1.0000 2.0000 0.0000 Constraint 262 574 0.8000 1.0000 2.0000 0.0000 Constraint 262 552 0.8000 1.0000 2.0000 0.0000 Constraint 262 547 0.8000 1.0000 2.0000 0.0000 Constraint 262 510 0.8000 1.0000 2.0000 0.0000 Constraint 262 505 0.8000 1.0000 2.0000 0.0000 Constraint 262 500 0.8000 1.0000 2.0000 0.0000 Constraint 262 493 0.8000 1.0000 2.0000 0.0000 Constraint 262 486 0.8000 1.0000 2.0000 0.0000 Constraint 262 478 0.8000 1.0000 2.0000 0.0000 Constraint 262 352 0.8000 1.0000 2.0000 0.0000 Constraint 262 326 0.8000 1.0000 2.0000 0.0000 Constraint 262 317 0.8000 1.0000 2.0000 0.0000 Constraint 262 309 0.8000 1.0000 2.0000 0.0000 Constraint 262 303 0.8000 1.0000 2.0000 0.0000 Constraint 262 294 0.8000 1.0000 2.0000 0.0000 Constraint 262 286 0.8000 1.0000 2.0000 0.0000 Constraint 262 277 0.8000 1.0000 2.0000 0.0000 Constraint 262 270 0.8000 1.0000 2.0000 0.0000 Constraint 253 1051 0.8000 1.0000 2.0000 0.0000 Constraint 253 1043 0.8000 1.0000 2.0000 0.0000 Constraint 253 1033 0.8000 1.0000 2.0000 0.0000 Constraint 253 1026 0.8000 1.0000 2.0000 0.0000 Constraint 253 1019 0.8000 1.0000 2.0000 0.0000 Constraint 253 1011 0.8000 1.0000 2.0000 0.0000 Constraint 253 1003 0.8000 1.0000 2.0000 0.0000 Constraint 253 995 0.8000 1.0000 2.0000 0.0000 Constraint 253 987 0.8000 1.0000 2.0000 0.0000 Constraint 253 980 0.8000 1.0000 2.0000 0.0000 Constraint 253 972 0.8000 1.0000 2.0000 0.0000 Constraint 253 960 0.8000 1.0000 2.0000 0.0000 Constraint 253 951 0.8000 1.0000 2.0000 0.0000 Constraint 253 943 0.8000 1.0000 2.0000 0.0000 Constraint 253 931 0.8000 1.0000 2.0000 0.0000 Constraint 253 919 0.8000 1.0000 2.0000 0.0000 Constraint 253 911 0.8000 1.0000 2.0000 0.0000 Constraint 253 901 0.8000 1.0000 2.0000 0.0000 Constraint 253 891 0.8000 1.0000 2.0000 0.0000 Constraint 253 883 0.8000 1.0000 2.0000 0.0000 Constraint 253 872 0.8000 1.0000 2.0000 0.0000 Constraint 253 866 0.8000 1.0000 2.0000 0.0000 Constraint 253 857 0.8000 1.0000 2.0000 0.0000 Constraint 253 849 0.8000 1.0000 2.0000 0.0000 Constraint 253 840 0.8000 1.0000 2.0000 0.0000 Constraint 253 827 0.8000 1.0000 2.0000 0.0000 Constraint 253 822 0.8000 1.0000 2.0000 0.0000 Constraint 253 814 0.8000 1.0000 2.0000 0.0000 Constraint 253 808 0.8000 1.0000 2.0000 0.0000 Constraint 253 801 0.8000 1.0000 2.0000 0.0000 Constraint 253 792 0.8000 1.0000 2.0000 0.0000 Constraint 253 784 0.8000 1.0000 2.0000 0.0000 Constraint 253 776 0.8000 1.0000 2.0000 0.0000 Constraint 253 768 0.8000 1.0000 2.0000 0.0000 Constraint 253 761 0.8000 1.0000 2.0000 0.0000 Constraint 253 751 0.8000 1.0000 2.0000 0.0000 Constraint 253 743 0.8000 1.0000 2.0000 0.0000 Constraint 253 735 0.8000 1.0000 2.0000 0.0000 Constraint 253 727 0.8000 1.0000 2.0000 0.0000 Constraint 253 719 0.8000 1.0000 2.0000 0.0000 Constraint 253 706 0.8000 1.0000 2.0000 0.0000 Constraint 253 698 0.8000 1.0000 2.0000 0.0000 Constraint 253 690 0.8000 1.0000 2.0000 0.0000 Constraint 253 682 0.8000 1.0000 2.0000 0.0000 Constraint 253 674 0.8000 1.0000 2.0000 0.0000 Constraint 253 667 0.8000 1.0000 2.0000 0.0000 Constraint 253 659 0.8000 1.0000 2.0000 0.0000 Constraint 253 650 0.8000 1.0000 2.0000 0.0000 Constraint 253 641 0.8000 1.0000 2.0000 0.0000 Constraint 253 633 0.8000 1.0000 2.0000 0.0000 Constraint 253 627 0.8000 1.0000 2.0000 0.0000 Constraint 253 621 0.8000 1.0000 2.0000 0.0000 Constraint 253 614 0.8000 1.0000 2.0000 0.0000 Constraint 253 603 0.8000 1.0000 2.0000 0.0000 Constraint 253 597 0.8000 1.0000 2.0000 0.0000 Constraint 253 590 0.8000 1.0000 2.0000 0.0000 Constraint 253 581 0.8000 1.0000 2.0000 0.0000 Constraint 253 574 0.8000 1.0000 2.0000 0.0000 Constraint 253 567 0.8000 1.0000 2.0000 0.0000 Constraint 253 552 0.8000 1.0000 2.0000 0.0000 Constraint 253 547 0.8000 1.0000 2.0000 0.0000 Constraint 253 519 0.8000 1.0000 2.0000 0.0000 Constraint 253 510 0.8000 1.0000 2.0000 0.0000 Constraint 253 505 0.8000 1.0000 2.0000 0.0000 Constraint 253 500 0.8000 1.0000 2.0000 0.0000 Constraint 253 493 0.8000 1.0000 2.0000 0.0000 Constraint 253 486 0.8000 1.0000 2.0000 0.0000 Constraint 253 478 0.8000 1.0000 2.0000 0.0000 Constraint 253 471 0.8000 1.0000 2.0000 0.0000 Constraint 253 459 0.8000 1.0000 2.0000 0.0000 Constraint 253 445 0.8000 1.0000 2.0000 0.0000 Constraint 253 437 0.8000 1.0000 2.0000 0.0000 Constraint 253 419 0.8000 1.0000 2.0000 0.0000 Constraint 253 411 0.8000 1.0000 2.0000 0.0000 Constraint 253 404 0.8000 1.0000 2.0000 0.0000 Constraint 253 396 0.8000 1.0000 2.0000 0.0000 Constraint 253 388 0.8000 1.0000 2.0000 0.0000 Constraint 253 372 0.8000 1.0000 2.0000 0.0000 Constraint 253 352 0.8000 1.0000 2.0000 0.0000 Constraint 253 317 0.8000 1.0000 2.0000 0.0000 Constraint 253 309 0.8000 1.0000 2.0000 0.0000 Constraint 253 303 0.8000 1.0000 2.0000 0.0000 Constraint 253 294 0.8000 1.0000 2.0000 0.0000 Constraint 253 286 0.8000 1.0000 2.0000 0.0000 Constraint 253 277 0.8000 1.0000 2.0000 0.0000 Constraint 253 270 0.8000 1.0000 2.0000 0.0000 Constraint 253 262 0.8000 1.0000 2.0000 0.0000 Constraint 247 1051 0.8000 1.0000 2.0000 0.0000 Constraint 247 1043 0.8000 1.0000 2.0000 0.0000 Constraint 247 1033 0.8000 1.0000 2.0000 0.0000 Constraint 247 1026 0.8000 1.0000 2.0000 0.0000 Constraint 247 1019 0.8000 1.0000 2.0000 0.0000 Constraint 247 1011 0.8000 1.0000 2.0000 0.0000 Constraint 247 1003 0.8000 1.0000 2.0000 0.0000 Constraint 247 995 0.8000 1.0000 2.0000 0.0000 Constraint 247 987 0.8000 1.0000 2.0000 0.0000 Constraint 247 980 0.8000 1.0000 2.0000 0.0000 Constraint 247 972 0.8000 1.0000 2.0000 0.0000 Constraint 247 960 0.8000 1.0000 2.0000 0.0000 Constraint 247 951 0.8000 1.0000 2.0000 0.0000 Constraint 247 943 0.8000 1.0000 2.0000 0.0000 Constraint 247 931 0.8000 1.0000 2.0000 0.0000 Constraint 247 919 0.8000 1.0000 2.0000 0.0000 Constraint 247 911 0.8000 1.0000 2.0000 0.0000 Constraint 247 901 0.8000 1.0000 2.0000 0.0000 Constraint 247 891 0.8000 1.0000 2.0000 0.0000 Constraint 247 883 0.8000 1.0000 2.0000 0.0000 Constraint 247 872 0.8000 1.0000 2.0000 0.0000 Constraint 247 866 0.8000 1.0000 2.0000 0.0000 Constraint 247 857 0.8000 1.0000 2.0000 0.0000 Constraint 247 849 0.8000 1.0000 2.0000 0.0000 Constraint 247 840 0.8000 1.0000 2.0000 0.0000 Constraint 247 827 0.8000 1.0000 2.0000 0.0000 Constraint 247 822 0.8000 1.0000 2.0000 0.0000 Constraint 247 814 0.8000 1.0000 2.0000 0.0000 Constraint 247 808 0.8000 1.0000 2.0000 0.0000 Constraint 247 801 0.8000 1.0000 2.0000 0.0000 Constraint 247 792 0.8000 1.0000 2.0000 0.0000 Constraint 247 776 0.8000 1.0000 2.0000 0.0000 Constraint 247 768 0.8000 1.0000 2.0000 0.0000 Constraint 247 761 0.8000 1.0000 2.0000 0.0000 Constraint 247 751 0.8000 1.0000 2.0000 0.0000 Constraint 247 743 0.8000 1.0000 2.0000 0.0000 Constraint 247 735 0.8000 1.0000 2.0000 0.0000 Constraint 247 727 0.8000 1.0000 2.0000 0.0000 Constraint 247 719 0.8000 1.0000 2.0000 0.0000 Constraint 247 711 0.8000 1.0000 2.0000 0.0000 Constraint 247 706 0.8000 1.0000 2.0000 0.0000 Constraint 247 698 0.8000 1.0000 2.0000 0.0000 Constraint 247 690 0.8000 1.0000 2.0000 0.0000 Constraint 247 682 0.8000 1.0000 2.0000 0.0000 Constraint 247 674 0.8000 1.0000 2.0000 0.0000 Constraint 247 667 0.8000 1.0000 2.0000 0.0000 Constraint 247 659 0.8000 1.0000 2.0000 0.0000 Constraint 247 650 0.8000 1.0000 2.0000 0.0000 Constraint 247 641 0.8000 1.0000 2.0000 0.0000 Constraint 247 633 0.8000 1.0000 2.0000 0.0000 Constraint 247 627 0.8000 1.0000 2.0000 0.0000 Constraint 247 621 0.8000 1.0000 2.0000 0.0000 Constraint 247 614 0.8000 1.0000 2.0000 0.0000 Constraint 247 603 0.8000 1.0000 2.0000 0.0000 Constraint 247 597 0.8000 1.0000 2.0000 0.0000 Constraint 247 590 0.8000 1.0000 2.0000 0.0000 Constraint 247 581 0.8000 1.0000 2.0000 0.0000 Constraint 247 574 0.8000 1.0000 2.0000 0.0000 Constraint 247 567 0.8000 1.0000 2.0000 0.0000 Constraint 247 560 0.8000 1.0000 2.0000 0.0000 Constraint 247 552 0.8000 1.0000 2.0000 0.0000 Constraint 247 547 0.8000 1.0000 2.0000 0.0000 Constraint 247 539 0.8000 1.0000 2.0000 0.0000 Constraint 247 519 0.8000 1.0000 2.0000 0.0000 Constraint 247 510 0.8000 1.0000 2.0000 0.0000 Constraint 247 505 0.8000 1.0000 2.0000 0.0000 Constraint 247 500 0.8000 1.0000 2.0000 0.0000 Constraint 247 493 0.8000 1.0000 2.0000 0.0000 Constraint 247 486 0.8000 1.0000 2.0000 0.0000 Constraint 247 478 0.8000 1.0000 2.0000 0.0000 Constraint 247 471 0.8000 1.0000 2.0000 0.0000 Constraint 247 466 0.8000 1.0000 2.0000 0.0000 Constraint 247 459 0.8000 1.0000 2.0000 0.0000 Constraint 247 445 0.8000 1.0000 2.0000 0.0000 Constraint 247 419 0.8000 1.0000 2.0000 0.0000 Constraint 247 411 0.8000 1.0000 2.0000 0.0000 Constraint 247 372 0.8000 1.0000 2.0000 0.0000 Constraint 247 361 0.8000 1.0000 2.0000 0.0000 Constraint 247 352 0.8000 1.0000 2.0000 0.0000 Constraint 247 345 0.8000 1.0000 2.0000 0.0000 Constraint 247 309 0.8000 1.0000 2.0000 0.0000 Constraint 247 303 0.8000 1.0000 2.0000 0.0000 Constraint 247 294 0.8000 1.0000 2.0000 0.0000 Constraint 247 286 0.8000 1.0000 2.0000 0.0000 Constraint 247 277 0.8000 1.0000 2.0000 0.0000 Constraint 247 270 0.8000 1.0000 2.0000 0.0000 Constraint 247 262 0.8000 1.0000 2.0000 0.0000 Constraint 247 253 0.8000 1.0000 2.0000 0.0000 Constraint 238 1051 0.8000 1.0000 2.0000 0.0000 Constraint 238 1043 0.8000 1.0000 2.0000 0.0000 Constraint 238 1033 0.8000 1.0000 2.0000 0.0000 Constraint 238 1026 0.8000 1.0000 2.0000 0.0000 Constraint 238 1019 0.8000 1.0000 2.0000 0.0000 Constraint 238 1011 0.8000 1.0000 2.0000 0.0000 Constraint 238 1003 0.8000 1.0000 2.0000 0.0000 Constraint 238 995 0.8000 1.0000 2.0000 0.0000 Constraint 238 987 0.8000 1.0000 2.0000 0.0000 Constraint 238 980 0.8000 1.0000 2.0000 0.0000 Constraint 238 972 0.8000 1.0000 2.0000 0.0000 Constraint 238 960 0.8000 1.0000 2.0000 0.0000 Constraint 238 951 0.8000 1.0000 2.0000 0.0000 Constraint 238 943 0.8000 1.0000 2.0000 0.0000 Constraint 238 931 0.8000 1.0000 2.0000 0.0000 Constraint 238 919 0.8000 1.0000 2.0000 0.0000 Constraint 238 911 0.8000 1.0000 2.0000 0.0000 Constraint 238 901 0.8000 1.0000 2.0000 0.0000 Constraint 238 891 0.8000 1.0000 2.0000 0.0000 Constraint 238 883 0.8000 1.0000 2.0000 0.0000 Constraint 238 872 0.8000 1.0000 2.0000 0.0000 Constraint 238 866 0.8000 1.0000 2.0000 0.0000 Constraint 238 857 0.8000 1.0000 2.0000 0.0000 Constraint 238 849 0.8000 1.0000 2.0000 0.0000 Constraint 238 840 0.8000 1.0000 2.0000 0.0000 Constraint 238 827 0.8000 1.0000 2.0000 0.0000 Constraint 238 822 0.8000 1.0000 2.0000 0.0000 Constraint 238 814 0.8000 1.0000 2.0000 0.0000 Constraint 238 808 0.8000 1.0000 2.0000 0.0000 Constraint 238 801 0.8000 1.0000 2.0000 0.0000 Constraint 238 792 0.8000 1.0000 2.0000 0.0000 Constraint 238 768 0.8000 1.0000 2.0000 0.0000 Constraint 238 761 0.8000 1.0000 2.0000 0.0000 Constraint 238 751 0.8000 1.0000 2.0000 0.0000 Constraint 238 743 0.8000 1.0000 2.0000 0.0000 Constraint 238 735 0.8000 1.0000 2.0000 0.0000 Constraint 238 727 0.8000 1.0000 2.0000 0.0000 Constraint 238 719 0.8000 1.0000 2.0000 0.0000 Constraint 238 711 0.8000 1.0000 2.0000 0.0000 Constraint 238 706 0.8000 1.0000 2.0000 0.0000 Constraint 238 698 0.8000 1.0000 2.0000 0.0000 Constraint 238 690 0.8000 1.0000 2.0000 0.0000 Constraint 238 682 0.8000 1.0000 2.0000 0.0000 Constraint 238 674 0.8000 1.0000 2.0000 0.0000 Constraint 238 667 0.8000 1.0000 2.0000 0.0000 Constraint 238 659 0.8000 1.0000 2.0000 0.0000 Constraint 238 650 0.8000 1.0000 2.0000 0.0000 Constraint 238 641 0.8000 1.0000 2.0000 0.0000 Constraint 238 633 0.8000 1.0000 2.0000 0.0000 Constraint 238 627 0.8000 1.0000 2.0000 0.0000 Constraint 238 621 0.8000 1.0000 2.0000 0.0000 Constraint 238 614 0.8000 1.0000 2.0000 0.0000 Constraint 238 603 0.8000 1.0000 2.0000 0.0000 Constraint 238 597 0.8000 1.0000 2.0000 0.0000 Constraint 238 590 0.8000 1.0000 2.0000 0.0000 Constraint 238 581 0.8000 1.0000 2.0000 0.0000 Constraint 238 574 0.8000 1.0000 2.0000 0.0000 Constraint 238 567 0.8000 1.0000 2.0000 0.0000 Constraint 238 560 0.8000 1.0000 2.0000 0.0000 Constraint 238 552 0.8000 1.0000 2.0000 0.0000 Constraint 238 547 0.8000 1.0000 2.0000 0.0000 Constraint 238 531 0.8000 1.0000 2.0000 0.0000 Constraint 238 519 0.8000 1.0000 2.0000 0.0000 Constraint 238 510 0.8000 1.0000 2.0000 0.0000 Constraint 238 505 0.8000 1.0000 2.0000 0.0000 Constraint 238 500 0.8000 1.0000 2.0000 0.0000 Constraint 238 493 0.8000 1.0000 2.0000 0.0000 Constraint 238 486 0.8000 1.0000 2.0000 0.0000 Constraint 238 478 0.8000 1.0000 2.0000 0.0000 Constraint 238 466 0.8000 1.0000 2.0000 0.0000 Constraint 238 459 0.8000 1.0000 2.0000 0.0000 Constraint 238 445 0.8000 1.0000 2.0000 0.0000 Constraint 238 419 0.8000 1.0000 2.0000 0.0000 Constraint 238 411 0.8000 1.0000 2.0000 0.0000 Constraint 238 352 0.8000 1.0000 2.0000 0.0000 Constraint 238 345 0.8000 1.0000 2.0000 0.0000 Constraint 238 303 0.8000 1.0000 2.0000 0.0000 Constraint 238 294 0.8000 1.0000 2.0000 0.0000 Constraint 238 286 0.8000 1.0000 2.0000 0.0000 Constraint 238 277 0.8000 1.0000 2.0000 0.0000 Constraint 238 270 0.8000 1.0000 2.0000 0.0000 Constraint 238 262 0.8000 1.0000 2.0000 0.0000 Constraint 238 253 0.8000 1.0000 2.0000 0.0000 Constraint 238 247 0.8000 1.0000 2.0000 0.0000 Constraint 232 1051 0.8000 1.0000 2.0000 0.0000 Constraint 232 1043 0.8000 1.0000 2.0000 0.0000 Constraint 232 1033 0.8000 1.0000 2.0000 0.0000 Constraint 232 1026 0.8000 1.0000 2.0000 0.0000 Constraint 232 1019 0.8000 1.0000 2.0000 0.0000 Constraint 232 1011 0.8000 1.0000 2.0000 0.0000 Constraint 232 1003 0.8000 1.0000 2.0000 0.0000 Constraint 232 995 0.8000 1.0000 2.0000 0.0000 Constraint 232 987 0.8000 1.0000 2.0000 0.0000 Constraint 232 980 0.8000 1.0000 2.0000 0.0000 Constraint 232 972 0.8000 1.0000 2.0000 0.0000 Constraint 232 960 0.8000 1.0000 2.0000 0.0000 Constraint 232 951 0.8000 1.0000 2.0000 0.0000 Constraint 232 943 0.8000 1.0000 2.0000 0.0000 Constraint 232 931 0.8000 1.0000 2.0000 0.0000 Constraint 232 919 0.8000 1.0000 2.0000 0.0000 Constraint 232 911 0.8000 1.0000 2.0000 0.0000 Constraint 232 901 0.8000 1.0000 2.0000 0.0000 Constraint 232 891 0.8000 1.0000 2.0000 0.0000 Constraint 232 883 0.8000 1.0000 2.0000 0.0000 Constraint 232 872 0.8000 1.0000 2.0000 0.0000 Constraint 232 866 0.8000 1.0000 2.0000 0.0000 Constraint 232 857 0.8000 1.0000 2.0000 0.0000 Constraint 232 849 0.8000 1.0000 2.0000 0.0000 Constraint 232 840 0.8000 1.0000 2.0000 0.0000 Constraint 232 827 0.8000 1.0000 2.0000 0.0000 Constraint 232 822 0.8000 1.0000 2.0000 0.0000 Constraint 232 814 0.8000 1.0000 2.0000 0.0000 Constraint 232 808 0.8000 1.0000 2.0000 0.0000 Constraint 232 801 0.8000 1.0000 2.0000 0.0000 Constraint 232 792 0.8000 1.0000 2.0000 0.0000 Constraint 232 784 0.8000 1.0000 2.0000 0.0000 Constraint 232 768 0.8000 1.0000 2.0000 0.0000 Constraint 232 761 0.8000 1.0000 2.0000 0.0000 Constraint 232 751 0.8000 1.0000 2.0000 0.0000 Constraint 232 743 0.8000 1.0000 2.0000 0.0000 Constraint 232 735 0.8000 1.0000 2.0000 0.0000 Constraint 232 727 0.8000 1.0000 2.0000 0.0000 Constraint 232 719 0.8000 1.0000 2.0000 0.0000 Constraint 232 711 0.8000 1.0000 2.0000 0.0000 Constraint 232 706 0.8000 1.0000 2.0000 0.0000 Constraint 232 698 0.8000 1.0000 2.0000 0.0000 Constraint 232 690 0.8000 1.0000 2.0000 0.0000 Constraint 232 682 0.8000 1.0000 2.0000 0.0000 Constraint 232 674 0.8000 1.0000 2.0000 0.0000 Constraint 232 667 0.8000 1.0000 2.0000 0.0000 Constraint 232 659 0.8000 1.0000 2.0000 0.0000 Constraint 232 650 0.8000 1.0000 2.0000 0.0000 Constraint 232 641 0.8000 1.0000 2.0000 0.0000 Constraint 232 633 0.8000 1.0000 2.0000 0.0000 Constraint 232 627 0.8000 1.0000 2.0000 0.0000 Constraint 232 621 0.8000 1.0000 2.0000 0.0000 Constraint 232 614 0.8000 1.0000 2.0000 0.0000 Constraint 232 603 0.8000 1.0000 2.0000 0.0000 Constraint 232 597 0.8000 1.0000 2.0000 0.0000 Constraint 232 590 0.8000 1.0000 2.0000 0.0000 Constraint 232 581 0.8000 1.0000 2.0000 0.0000 Constraint 232 574 0.8000 1.0000 2.0000 0.0000 Constraint 232 567 0.8000 1.0000 2.0000 0.0000 Constraint 232 552 0.8000 1.0000 2.0000 0.0000 Constraint 232 547 0.8000 1.0000 2.0000 0.0000 Constraint 232 539 0.8000 1.0000 2.0000 0.0000 Constraint 232 531 0.8000 1.0000 2.0000 0.0000 Constraint 232 519 0.8000 1.0000 2.0000 0.0000 Constraint 232 510 0.8000 1.0000 2.0000 0.0000 Constraint 232 505 0.8000 1.0000 2.0000 0.0000 Constraint 232 500 0.8000 1.0000 2.0000 0.0000 Constraint 232 493 0.8000 1.0000 2.0000 0.0000 Constraint 232 486 0.8000 1.0000 2.0000 0.0000 Constraint 232 478 0.8000 1.0000 2.0000 0.0000 Constraint 232 466 0.8000 1.0000 2.0000 0.0000 Constraint 232 459 0.8000 1.0000 2.0000 0.0000 Constraint 232 445 0.8000 1.0000 2.0000 0.0000 Constraint 232 437 0.8000 1.0000 2.0000 0.0000 Constraint 232 419 0.8000 1.0000 2.0000 0.0000 Constraint 232 411 0.8000 1.0000 2.0000 0.0000 Constraint 232 388 0.8000 1.0000 2.0000 0.0000 Constraint 232 380 0.8000 1.0000 2.0000 0.0000 Constraint 232 372 0.8000 1.0000 2.0000 0.0000 Constraint 232 361 0.8000 1.0000 2.0000 0.0000 Constraint 232 352 0.8000 1.0000 2.0000 0.0000 Constraint 232 317 0.8000 1.0000 2.0000 0.0000 Constraint 232 294 0.8000 1.0000 2.0000 0.0000 Constraint 232 286 0.8000 1.0000 2.0000 0.0000 Constraint 232 277 0.8000 1.0000 2.0000 0.0000 Constraint 232 270 0.8000 1.0000 2.0000 0.0000 Constraint 232 262 0.8000 1.0000 2.0000 0.0000 Constraint 232 253 0.8000 1.0000 2.0000 0.0000 Constraint 232 247 0.8000 1.0000 2.0000 0.0000 Constraint 232 238 0.8000 1.0000 2.0000 0.0000 Constraint 220 1051 0.8000 1.0000 2.0000 0.0000 Constraint 220 1043 0.8000 1.0000 2.0000 0.0000 Constraint 220 1033 0.8000 1.0000 2.0000 0.0000 Constraint 220 1026 0.8000 1.0000 2.0000 0.0000 Constraint 220 1019 0.8000 1.0000 2.0000 0.0000 Constraint 220 1011 0.8000 1.0000 2.0000 0.0000 Constraint 220 1003 0.8000 1.0000 2.0000 0.0000 Constraint 220 995 0.8000 1.0000 2.0000 0.0000 Constraint 220 987 0.8000 1.0000 2.0000 0.0000 Constraint 220 980 0.8000 1.0000 2.0000 0.0000 Constraint 220 972 0.8000 1.0000 2.0000 0.0000 Constraint 220 960 0.8000 1.0000 2.0000 0.0000 Constraint 220 951 0.8000 1.0000 2.0000 0.0000 Constraint 220 943 0.8000 1.0000 2.0000 0.0000 Constraint 220 931 0.8000 1.0000 2.0000 0.0000 Constraint 220 919 0.8000 1.0000 2.0000 0.0000 Constraint 220 911 0.8000 1.0000 2.0000 0.0000 Constraint 220 901 0.8000 1.0000 2.0000 0.0000 Constraint 220 891 0.8000 1.0000 2.0000 0.0000 Constraint 220 883 0.8000 1.0000 2.0000 0.0000 Constraint 220 872 0.8000 1.0000 2.0000 0.0000 Constraint 220 866 0.8000 1.0000 2.0000 0.0000 Constraint 220 857 0.8000 1.0000 2.0000 0.0000 Constraint 220 849 0.8000 1.0000 2.0000 0.0000 Constraint 220 840 0.8000 1.0000 2.0000 0.0000 Constraint 220 827 0.8000 1.0000 2.0000 0.0000 Constraint 220 822 0.8000 1.0000 2.0000 0.0000 Constraint 220 814 0.8000 1.0000 2.0000 0.0000 Constraint 220 808 0.8000 1.0000 2.0000 0.0000 Constraint 220 792 0.8000 1.0000 2.0000 0.0000 Constraint 220 784 0.8000 1.0000 2.0000 0.0000 Constraint 220 768 0.8000 1.0000 2.0000 0.0000 Constraint 220 761 0.8000 1.0000 2.0000 0.0000 Constraint 220 751 0.8000 1.0000 2.0000 0.0000 Constraint 220 743 0.8000 1.0000 2.0000 0.0000 Constraint 220 735 0.8000 1.0000 2.0000 0.0000 Constraint 220 727 0.8000 1.0000 2.0000 0.0000 Constraint 220 719 0.8000 1.0000 2.0000 0.0000 Constraint 220 711 0.8000 1.0000 2.0000 0.0000 Constraint 220 706 0.8000 1.0000 2.0000 0.0000 Constraint 220 698 0.8000 1.0000 2.0000 0.0000 Constraint 220 690 0.8000 1.0000 2.0000 0.0000 Constraint 220 682 0.8000 1.0000 2.0000 0.0000 Constraint 220 674 0.8000 1.0000 2.0000 0.0000 Constraint 220 667 0.8000 1.0000 2.0000 0.0000 Constraint 220 659 0.8000 1.0000 2.0000 0.0000 Constraint 220 650 0.8000 1.0000 2.0000 0.0000 Constraint 220 641 0.8000 1.0000 2.0000 0.0000 Constraint 220 633 0.8000 1.0000 2.0000 0.0000 Constraint 220 627 0.8000 1.0000 2.0000 0.0000 Constraint 220 621 0.8000 1.0000 2.0000 0.0000 Constraint 220 614 0.8000 1.0000 2.0000 0.0000 Constraint 220 603 0.8000 1.0000 2.0000 0.0000 Constraint 220 597 0.8000 1.0000 2.0000 0.0000 Constraint 220 581 0.8000 1.0000 2.0000 0.0000 Constraint 220 574 0.8000 1.0000 2.0000 0.0000 Constraint 220 567 0.8000 1.0000 2.0000 0.0000 Constraint 220 539 0.8000 1.0000 2.0000 0.0000 Constraint 220 531 0.8000 1.0000 2.0000 0.0000 Constraint 220 519 0.8000 1.0000 2.0000 0.0000 Constraint 220 510 0.8000 1.0000 2.0000 0.0000 Constraint 220 505 0.8000 1.0000 2.0000 0.0000 Constraint 220 500 0.8000 1.0000 2.0000 0.0000 Constraint 220 493 0.8000 1.0000 2.0000 0.0000 Constraint 220 486 0.8000 1.0000 2.0000 0.0000 Constraint 220 478 0.8000 1.0000 2.0000 0.0000 Constraint 220 466 0.8000 1.0000 2.0000 0.0000 Constraint 220 459 0.8000 1.0000 2.0000 0.0000 Constraint 220 445 0.8000 1.0000 2.0000 0.0000 Constraint 220 437 0.8000 1.0000 2.0000 0.0000 Constraint 220 430 0.8000 1.0000 2.0000 0.0000 Constraint 220 419 0.8000 1.0000 2.0000 0.0000 Constraint 220 411 0.8000 1.0000 2.0000 0.0000 Constraint 220 404 0.8000 1.0000 2.0000 0.0000 Constraint 220 396 0.8000 1.0000 2.0000 0.0000 Constraint 220 388 0.8000 1.0000 2.0000 0.0000 Constraint 220 380 0.8000 1.0000 2.0000 0.0000 Constraint 220 361 0.8000 1.0000 2.0000 0.0000 Constraint 220 352 0.8000 1.0000 2.0000 0.0000 Constraint 220 345 0.8000 1.0000 2.0000 0.0000 Constraint 220 317 0.8000 1.0000 2.0000 0.0000 Constraint 220 309 0.8000 1.0000 2.0000 0.0000 Constraint 220 303 0.8000 1.0000 2.0000 0.0000 Constraint 220 286 0.8000 1.0000 2.0000 0.0000 Constraint 220 277 0.8000 1.0000 2.0000 0.0000 Constraint 220 270 0.8000 1.0000 2.0000 0.0000 Constraint 220 262 0.8000 1.0000 2.0000 0.0000 Constraint 220 253 0.8000 1.0000 2.0000 0.0000 Constraint 220 247 0.8000 1.0000 2.0000 0.0000 Constraint 220 238 0.8000 1.0000 2.0000 0.0000 Constraint 220 232 0.8000 1.0000 2.0000 0.0000 Constraint 208 1051 0.8000 1.0000 2.0000 0.0000 Constraint 208 1043 0.8000 1.0000 2.0000 0.0000 Constraint 208 1033 0.8000 1.0000 2.0000 0.0000 Constraint 208 1026 0.8000 1.0000 2.0000 0.0000 Constraint 208 1019 0.8000 1.0000 2.0000 0.0000 Constraint 208 1011 0.8000 1.0000 2.0000 0.0000 Constraint 208 1003 0.8000 1.0000 2.0000 0.0000 Constraint 208 995 0.8000 1.0000 2.0000 0.0000 Constraint 208 987 0.8000 1.0000 2.0000 0.0000 Constraint 208 980 0.8000 1.0000 2.0000 0.0000 Constraint 208 972 0.8000 1.0000 2.0000 0.0000 Constraint 208 960 0.8000 1.0000 2.0000 0.0000 Constraint 208 951 0.8000 1.0000 2.0000 0.0000 Constraint 208 943 0.8000 1.0000 2.0000 0.0000 Constraint 208 931 0.8000 1.0000 2.0000 0.0000 Constraint 208 919 0.8000 1.0000 2.0000 0.0000 Constraint 208 911 0.8000 1.0000 2.0000 0.0000 Constraint 208 901 0.8000 1.0000 2.0000 0.0000 Constraint 208 891 0.8000 1.0000 2.0000 0.0000 Constraint 208 883 0.8000 1.0000 2.0000 0.0000 Constraint 208 872 0.8000 1.0000 2.0000 0.0000 Constraint 208 866 0.8000 1.0000 2.0000 0.0000 Constraint 208 857 0.8000 1.0000 2.0000 0.0000 Constraint 208 849 0.8000 1.0000 2.0000 0.0000 Constraint 208 840 0.8000 1.0000 2.0000 0.0000 Constraint 208 827 0.8000 1.0000 2.0000 0.0000 Constraint 208 822 0.8000 1.0000 2.0000 0.0000 Constraint 208 814 0.8000 1.0000 2.0000 0.0000 Constraint 208 808 0.8000 1.0000 2.0000 0.0000 Constraint 208 792 0.8000 1.0000 2.0000 0.0000 Constraint 208 784 0.8000 1.0000 2.0000 0.0000 Constraint 208 768 0.8000 1.0000 2.0000 0.0000 Constraint 208 761 0.8000 1.0000 2.0000 0.0000 Constraint 208 751 0.8000 1.0000 2.0000 0.0000 Constraint 208 743 0.8000 1.0000 2.0000 0.0000 Constraint 208 735 0.8000 1.0000 2.0000 0.0000 Constraint 208 727 0.8000 1.0000 2.0000 0.0000 Constraint 208 719 0.8000 1.0000 2.0000 0.0000 Constraint 208 711 0.8000 1.0000 2.0000 0.0000 Constraint 208 706 0.8000 1.0000 2.0000 0.0000 Constraint 208 698 0.8000 1.0000 2.0000 0.0000 Constraint 208 690 0.8000 1.0000 2.0000 0.0000 Constraint 208 682 0.8000 1.0000 2.0000 0.0000 Constraint 208 674 0.8000 1.0000 2.0000 0.0000 Constraint 208 667 0.8000 1.0000 2.0000 0.0000 Constraint 208 641 0.8000 1.0000 2.0000 0.0000 Constraint 208 633 0.8000 1.0000 2.0000 0.0000 Constraint 208 627 0.8000 1.0000 2.0000 0.0000 Constraint 208 621 0.8000 1.0000 2.0000 0.0000 Constraint 208 614 0.8000 1.0000 2.0000 0.0000 Constraint 208 603 0.8000 1.0000 2.0000 0.0000 Constraint 208 597 0.8000 1.0000 2.0000 0.0000 Constraint 208 590 0.8000 1.0000 2.0000 0.0000 Constraint 208 581 0.8000 1.0000 2.0000 0.0000 Constraint 208 574 0.8000 1.0000 2.0000 0.0000 Constraint 208 567 0.8000 1.0000 2.0000 0.0000 Constraint 208 531 0.8000 1.0000 2.0000 0.0000 Constraint 208 519 0.8000 1.0000 2.0000 0.0000 Constraint 208 510 0.8000 1.0000 2.0000 0.0000 Constraint 208 505 0.8000 1.0000 2.0000 0.0000 Constraint 208 500 0.8000 1.0000 2.0000 0.0000 Constraint 208 493 0.8000 1.0000 2.0000 0.0000 Constraint 208 486 0.8000 1.0000 2.0000 0.0000 Constraint 208 478 0.8000 1.0000 2.0000 0.0000 Constraint 208 466 0.8000 1.0000 2.0000 0.0000 Constraint 208 459 0.8000 1.0000 2.0000 0.0000 Constraint 208 445 0.8000 1.0000 2.0000 0.0000 Constraint 208 437 0.8000 1.0000 2.0000 0.0000 Constraint 208 430 0.8000 1.0000 2.0000 0.0000 Constraint 208 419 0.8000 1.0000 2.0000 0.0000 Constraint 208 411 0.8000 1.0000 2.0000 0.0000 Constraint 208 404 0.8000 1.0000 2.0000 0.0000 Constraint 208 396 0.8000 1.0000 2.0000 0.0000 Constraint 208 388 0.8000 1.0000 2.0000 0.0000 Constraint 208 380 0.8000 1.0000 2.0000 0.0000 Constraint 208 372 0.8000 1.0000 2.0000 0.0000 Constraint 208 361 0.8000 1.0000 2.0000 0.0000 Constraint 208 352 0.8000 1.0000 2.0000 0.0000 Constraint 208 345 0.8000 1.0000 2.0000 0.0000 Constraint 208 337 0.8000 1.0000 2.0000 0.0000 Constraint 208 317 0.8000 1.0000 2.0000 0.0000 Constraint 208 309 0.8000 1.0000 2.0000 0.0000 Constraint 208 303 0.8000 1.0000 2.0000 0.0000 Constraint 208 294 0.8000 1.0000 2.0000 0.0000 Constraint 208 277 0.8000 1.0000 2.0000 0.0000 Constraint 208 270 0.8000 1.0000 2.0000 0.0000 Constraint 208 262 0.8000 1.0000 2.0000 0.0000 Constraint 208 253 0.8000 1.0000 2.0000 0.0000 Constraint 208 247 0.8000 1.0000 2.0000 0.0000 Constraint 208 238 0.8000 1.0000 2.0000 0.0000 Constraint 208 232 0.8000 1.0000 2.0000 0.0000 Constraint 208 220 0.8000 1.0000 2.0000 0.0000 Constraint 199 1051 0.8000 1.0000 2.0000 0.0000 Constraint 199 1043 0.8000 1.0000 2.0000 0.0000 Constraint 199 1033 0.8000 1.0000 2.0000 0.0000 Constraint 199 1026 0.8000 1.0000 2.0000 0.0000 Constraint 199 1019 0.8000 1.0000 2.0000 0.0000 Constraint 199 1011 0.8000 1.0000 2.0000 0.0000 Constraint 199 1003 0.8000 1.0000 2.0000 0.0000 Constraint 199 995 0.8000 1.0000 2.0000 0.0000 Constraint 199 987 0.8000 1.0000 2.0000 0.0000 Constraint 199 980 0.8000 1.0000 2.0000 0.0000 Constraint 199 972 0.8000 1.0000 2.0000 0.0000 Constraint 199 960 0.8000 1.0000 2.0000 0.0000 Constraint 199 951 0.8000 1.0000 2.0000 0.0000 Constraint 199 943 0.8000 1.0000 2.0000 0.0000 Constraint 199 931 0.8000 1.0000 2.0000 0.0000 Constraint 199 919 0.8000 1.0000 2.0000 0.0000 Constraint 199 911 0.8000 1.0000 2.0000 0.0000 Constraint 199 901 0.8000 1.0000 2.0000 0.0000 Constraint 199 891 0.8000 1.0000 2.0000 0.0000 Constraint 199 883 0.8000 1.0000 2.0000 0.0000 Constraint 199 872 0.8000 1.0000 2.0000 0.0000 Constraint 199 866 0.8000 1.0000 2.0000 0.0000 Constraint 199 857 0.8000 1.0000 2.0000 0.0000 Constraint 199 849 0.8000 1.0000 2.0000 0.0000 Constraint 199 840 0.8000 1.0000 2.0000 0.0000 Constraint 199 827 0.8000 1.0000 2.0000 0.0000 Constraint 199 822 0.8000 1.0000 2.0000 0.0000 Constraint 199 814 0.8000 1.0000 2.0000 0.0000 Constraint 199 808 0.8000 1.0000 2.0000 0.0000 Constraint 199 792 0.8000 1.0000 2.0000 0.0000 Constraint 199 784 0.8000 1.0000 2.0000 0.0000 Constraint 199 776 0.8000 1.0000 2.0000 0.0000 Constraint 199 768 0.8000 1.0000 2.0000 0.0000 Constraint 199 761 0.8000 1.0000 2.0000 0.0000 Constraint 199 751 0.8000 1.0000 2.0000 0.0000 Constraint 199 743 0.8000 1.0000 2.0000 0.0000 Constraint 199 735 0.8000 1.0000 2.0000 0.0000 Constraint 199 727 0.8000 1.0000 2.0000 0.0000 Constraint 199 719 0.8000 1.0000 2.0000 0.0000 Constraint 199 711 0.8000 1.0000 2.0000 0.0000 Constraint 199 706 0.8000 1.0000 2.0000 0.0000 Constraint 199 698 0.8000 1.0000 2.0000 0.0000 Constraint 199 690 0.8000 1.0000 2.0000 0.0000 Constraint 199 682 0.8000 1.0000 2.0000 0.0000 Constraint 199 674 0.8000 1.0000 2.0000 0.0000 Constraint 199 667 0.8000 1.0000 2.0000 0.0000 Constraint 199 659 0.8000 1.0000 2.0000 0.0000 Constraint 199 650 0.8000 1.0000 2.0000 0.0000 Constraint 199 641 0.8000 1.0000 2.0000 0.0000 Constraint 199 633 0.8000 1.0000 2.0000 0.0000 Constraint 199 627 0.8000 1.0000 2.0000 0.0000 Constraint 199 621 0.8000 1.0000 2.0000 0.0000 Constraint 199 614 0.8000 1.0000 2.0000 0.0000 Constraint 199 603 0.8000 1.0000 2.0000 0.0000 Constraint 199 597 0.8000 1.0000 2.0000 0.0000 Constraint 199 590 0.8000 1.0000 2.0000 0.0000 Constraint 199 581 0.8000 1.0000 2.0000 0.0000 Constraint 199 574 0.8000 1.0000 2.0000 0.0000 Constraint 199 547 0.8000 1.0000 2.0000 0.0000 Constraint 199 539 0.8000 1.0000 2.0000 0.0000 Constraint 199 531 0.8000 1.0000 2.0000 0.0000 Constraint 199 519 0.8000 1.0000 2.0000 0.0000 Constraint 199 510 0.8000 1.0000 2.0000 0.0000 Constraint 199 505 0.8000 1.0000 2.0000 0.0000 Constraint 199 500 0.8000 1.0000 2.0000 0.0000 Constraint 199 493 0.8000 1.0000 2.0000 0.0000 Constraint 199 486 0.8000 1.0000 2.0000 0.0000 Constraint 199 478 0.8000 1.0000 2.0000 0.0000 Constraint 199 471 0.8000 1.0000 2.0000 0.0000 Constraint 199 466 0.8000 1.0000 2.0000 0.0000 Constraint 199 459 0.8000 1.0000 2.0000 0.0000 Constraint 199 445 0.8000 1.0000 2.0000 0.0000 Constraint 199 437 0.8000 1.0000 2.0000 0.0000 Constraint 199 430 0.8000 1.0000 2.0000 0.0000 Constraint 199 419 0.8000 1.0000 2.0000 0.0000 Constraint 199 411 0.8000 1.0000 2.0000 0.0000 Constraint 199 388 0.8000 1.0000 2.0000 0.0000 Constraint 199 372 0.8000 1.0000 2.0000 0.0000 Constraint 199 361 0.8000 1.0000 2.0000 0.0000 Constraint 199 352 0.8000 1.0000 2.0000 0.0000 Constraint 199 345 0.8000 1.0000 2.0000 0.0000 Constraint 199 337 0.8000 1.0000 2.0000 0.0000 Constraint 199 326 0.8000 1.0000 2.0000 0.0000 Constraint 199 262 0.8000 1.0000 2.0000 0.0000 Constraint 199 253 0.8000 1.0000 2.0000 0.0000 Constraint 199 247 0.8000 1.0000 2.0000 0.0000 Constraint 199 238 0.8000 1.0000 2.0000 0.0000 Constraint 199 232 0.8000 1.0000 2.0000 0.0000 Constraint 199 220 0.8000 1.0000 2.0000 0.0000 Constraint 199 208 0.8000 1.0000 2.0000 0.0000 Constraint 191 1051 0.8000 1.0000 2.0000 0.0000 Constraint 191 1043 0.8000 1.0000 2.0000 0.0000 Constraint 191 1033 0.8000 1.0000 2.0000 0.0000 Constraint 191 1026 0.8000 1.0000 2.0000 0.0000 Constraint 191 1019 0.8000 1.0000 2.0000 0.0000 Constraint 191 1011 0.8000 1.0000 2.0000 0.0000 Constraint 191 1003 0.8000 1.0000 2.0000 0.0000 Constraint 191 995 0.8000 1.0000 2.0000 0.0000 Constraint 191 987 0.8000 1.0000 2.0000 0.0000 Constraint 191 980 0.8000 1.0000 2.0000 0.0000 Constraint 191 972 0.8000 1.0000 2.0000 0.0000 Constraint 191 960 0.8000 1.0000 2.0000 0.0000 Constraint 191 951 0.8000 1.0000 2.0000 0.0000 Constraint 191 943 0.8000 1.0000 2.0000 0.0000 Constraint 191 931 0.8000 1.0000 2.0000 0.0000 Constraint 191 919 0.8000 1.0000 2.0000 0.0000 Constraint 191 911 0.8000 1.0000 2.0000 0.0000 Constraint 191 901 0.8000 1.0000 2.0000 0.0000 Constraint 191 891 0.8000 1.0000 2.0000 0.0000 Constraint 191 883 0.8000 1.0000 2.0000 0.0000 Constraint 191 872 0.8000 1.0000 2.0000 0.0000 Constraint 191 866 0.8000 1.0000 2.0000 0.0000 Constraint 191 857 0.8000 1.0000 2.0000 0.0000 Constraint 191 849 0.8000 1.0000 2.0000 0.0000 Constraint 191 840 0.8000 1.0000 2.0000 0.0000 Constraint 191 827 0.8000 1.0000 2.0000 0.0000 Constraint 191 822 0.8000 1.0000 2.0000 0.0000 Constraint 191 814 0.8000 1.0000 2.0000 0.0000 Constraint 191 808 0.8000 1.0000 2.0000 0.0000 Constraint 191 801 0.8000 1.0000 2.0000 0.0000 Constraint 191 792 0.8000 1.0000 2.0000 0.0000 Constraint 191 784 0.8000 1.0000 2.0000 0.0000 Constraint 191 776 0.8000 1.0000 2.0000 0.0000 Constraint 191 768 0.8000 1.0000 2.0000 0.0000 Constraint 191 761 0.8000 1.0000 2.0000 0.0000 Constraint 191 751 0.8000 1.0000 2.0000 0.0000 Constraint 191 743 0.8000 1.0000 2.0000 0.0000 Constraint 191 735 0.8000 1.0000 2.0000 0.0000 Constraint 191 727 0.8000 1.0000 2.0000 0.0000 Constraint 191 719 0.8000 1.0000 2.0000 0.0000 Constraint 191 711 0.8000 1.0000 2.0000 0.0000 Constraint 191 706 0.8000 1.0000 2.0000 0.0000 Constraint 191 698 0.8000 1.0000 2.0000 0.0000 Constraint 191 690 0.8000 1.0000 2.0000 0.0000 Constraint 191 682 0.8000 1.0000 2.0000 0.0000 Constraint 191 674 0.8000 1.0000 2.0000 0.0000 Constraint 191 667 0.8000 1.0000 2.0000 0.0000 Constraint 191 659 0.8000 1.0000 2.0000 0.0000 Constraint 191 650 0.8000 1.0000 2.0000 0.0000 Constraint 191 641 0.8000 1.0000 2.0000 0.0000 Constraint 191 633 0.8000 1.0000 2.0000 0.0000 Constraint 191 627 0.8000 1.0000 2.0000 0.0000 Constraint 191 621 0.8000 1.0000 2.0000 0.0000 Constraint 191 614 0.8000 1.0000 2.0000 0.0000 Constraint 191 603 0.8000 1.0000 2.0000 0.0000 Constraint 191 597 0.8000 1.0000 2.0000 0.0000 Constraint 191 590 0.8000 1.0000 2.0000 0.0000 Constraint 191 581 0.8000 1.0000 2.0000 0.0000 Constraint 191 567 0.8000 1.0000 2.0000 0.0000 Constraint 191 560 0.8000 1.0000 2.0000 0.0000 Constraint 191 547 0.8000 1.0000 2.0000 0.0000 Constraint 191 539 0.8000 1.0000 2.0000 0.0000 Constraint 191 531 0.8000 1.0000 2.0000 0.0000 Constraint 191 519 0.8000 1.0000 2.0000 0.0000 Constraint 191 510 0.8000 1.0000 2.0000 0.0000 Constraint 191 505 0.8000 1.0000 2.0000 0.0000 Constraint 191 500 0.8000 1.0000 2.0000 0.0000 Constraint 191 493 0.8000 1.0000 2.0000 0.0000 Constraint 191 486 0.8000 1.0000 2.0000 0.0000 Constraint 191 478 0.8000 1.0000 2.0000 0.0000 Constraint 191 459 0.8000 1.0000 2.0000 0.0000 Constraint 191 445 0.8000 1.0000 2.0000 0.0000 Constraint 191 437 0.8000 1.0000 2.0000 0.0000 Constraint 191 419 0.8000 1.0000 2.0000 0.0000 Constraint 191 411 0.8000 1.0000 2.0000 0.0000 Constraint 191 404 0.8000 1.0000 2.0000 0.0000 Constraint 191 388 0.8000 1.0000 2.0000 0.0000 Constraint 191 352 0.8000 1.0000 2.0000 0.0000 Constraint 191 303 0.8000 1.0000 2.0000 0.0000 Constraint 191 286 0.8000 1.0000 2.0000 0.0000 Constraint 191 253 0.8000 1.0000 2.0000 0.0000 Constraint 191 247 0.8000 1.0000 2.0000 0.0000 Constraint 191 238 0.8000 1.0000 2.0000 0.0000 Constraint 191 232 0.8000 1.0000 2.0000 0.0000 Constraint 191 220 0.8000 1.0000 2.0000 0.0000 Constraint 191 208 0.8000 1.0000 2.0000 0.0000 Constraint 191 199 0.8000 1.0000 2.0000 0.0000 Constraint 184 1051 0.8000 1.0000 2.0000 0.0000 Constraint 184 1043 0.8000 1.0000 2.0000 0.0000 Constraint 184 1033 0.8000 1.0000 2.0000 0.0000 Constraint 184 1026 0.8000 1.0000 2.0000 0.0000 Constraint 184 1019 0.8000 1.0000 2.0000 0.0000 Constraint 184 1011 0.8000 1.0000 2.0000 0.0000 Constraint 184 1003 0.8000 1.0000 2.0000 0.0000 Constraint 184 995 0.8000 1.0000 2.0000 0.0000 Constraint 184 987 0.8000 1.0000 2.0000 0.0000 Constraint 184 980 0.8000 1.0000 2.0000 0.0000 Constraint 184 972 0.8000 1.0000 2.0000 0.0000 Constraint 184 960 0.8000 1.0000 2.0000 0.0000 Constraint 184 951 0.8000 1.0000 2.0000 0.0000 Constraint 184 943 0.8000 1.0000 2.0000 0.0000 Constraint 184 931 0.8000 1.0000 2.0000 0.0000 Constraint 184 919 0.8000 1.0000 2.0000 0.0000 Constraint 184 911 0.8000 1.0000 2.0000 0.0000 Constraint 184 901 0.8000 1.0000 2.0000 0.0000 Constraint 184 891 0.8000 1.0000 2.0000 0.0000 Constraint 184 883 0.8000 1.0000 2.0000 0.0000 Constraint 184 872 0.8000 1.0000 2.0000 0.0000 Constraint 184 866 0.8000 1.0000 2.0000 0.0000 Constraint 184 857 0.8000 1.0000 2.0000 0.0000 Constraint 184 849 0.8000 1.0000 2.0000 0.0000 Constraint 184 840 0.8000 1.0000 2.0000 0.0000 Constraint 184 827 0.8000 1.0000 2.0000 0.0000 Constraint 184 822 0.8000 1.0000 2.0000 0.0000 Constraint 184 814 0.8000 1.0000 2.0000 0.0000 Constraint 184 808 0.8000 1.0000 2.0000 0.0000 Constraint 184 801 0.8000 1.0000 2.0000 0.0000 Constraint 184 792 0.8000 1.0000 2.0000 0.0000 Constraint 184 784 0.8000 1.0000 2.0000 0.0000 Constraint 184 776 0.8000 1.0000 2.0000 0.0000 Constraint 184 768 0.8000 1.0000 2.0000 0.0000 Constraint 184 761 0.8000 1.0000 2.0000 0.0000 Constraint 184 751 0.8000 1.0000 2.0000 0.0000 Constraint 184 743 0.8000 1.0000 2.0000 0.0000 Constraint 184 735 0.8000 1.0000 2.0000 0.0000 Constraint 184 727 0.8000 1.0000 2.0000 0.0000 Constraint 184 719 0.8000 1.0000 2.0000 0.0000 Constraint 184 711 0.8000 1.0000 2.0000 0.0000 Constraint 184 706 0.8000 1.0000 2.0000 0.0000 Constraint 184 698 0.8000 1.0000 2.0000 0.0000 Constraint 184 690 0.8000 1.0000 2.0000 0.0000 Constraint 184 682 0.8000 1.0000 2.0000 0.0000 Constraint 184 674 0.8000 1.0000 2.0000 0.0000 Constraint 184 667 0.8000 1.0000 2.0000 0.0000 Constraint 184 659 0.8000 1.0000 2.0000 0.0000 Constraint 184 650 0.8000 1.0000 2.0000 0.0000 Constraint 184 641 0.8000 1.0000 2.0000 0.0000 Constraint 184 633 0.8000 1.0000 2.0000 0.0000 Constraint 184 627 0.8000 1.0000 2.0000 0.0000 Constraint 184 621 0.8000 1.0000 2.0000 0.0000 Constraint 184 614 0.8000 1.0000 2.0000 0.0000 Constraint 184 590 0.8000 1.0000 2.0000 0.0000 Constraint 184 581 0.8000 1.0000 2.0000 0.0000 Constraint 184 567 0.8000 1.0000 2.0000 0.0000 Constraint 184 560 0.8000 1.0000 2.0000 0.0000 Constraint 184 552 0.8000 1.0000 2.0000 0.0000 Constraint 184 547 0.8000 1.0000 2.0000 0.0000 Constraint 184 539 0.8000 1.0000 2.0000 0.0000 Constraint 184 531 0.8000 1.0000 2.0000 0.0000 Constraint 184 519 0.8000 1.0000 2.0000 0.0000 Constraint 184 510 0.8000 1.0000 2.0000 0.0000 Constraint 184 505 0.8000 1.0000 2.0000 0.0000 Constraint 184 500 0.8000 1.0000 2.0000 0.0000 Constraint 184 493 0.8000 1.0000 2.0000 0.0000 Constraint 184 486 0.8000 1.0000 2.0000 0.0000 Constraint 184 478 0.8000 1.0000 2.0000 0.0000 Constraint 184 471 0.8000 1.0000 2.0000 0.0000 Constraint 184 466 0.8000 1.0000 2.0000 0.0000 Constraint 184 459 0.8000 1.0000 2.0000 0.0000 Constraint 184 445 0.8000 1.0000 2.0000 0.0000 Constraint 184 437 0.8000 1.0000 2.0000 0.0000 Constraint 184 419 0.8000 1.0000 2.0000 0.0000 Constraint 184 411 0.8000 1.0000 2.0000 0.0000 Constraint 184 388 0.8000 1.0000 2.0000 0.0000 Constraint 184 361 0.8000 1.0000 2.0000 0.0000 Constraint 184 352 0.8000 1.0000 2.0000 0.0000 Constraint 184 345 0.8000 1.0000 2.0000 0.0000 Constraint 184 337 0.8000 1.0000 2.0000 0.0000 Constraint 184 309 0.8000 1.0000 2.0000 0.0000 Constraint 184 286 0.8000 1.0000 2.0000 0.0000 Constraint 184 247 0.8000 1.0000 2.0000 0.0000 Constraint 184 238 0.8000 1.0000 2.0000 0.0000 Constraint 184 232 0.8000 1.0000 2.0000 0.0000 Constraint 184 220 0.8000 1.0000 2.0000 0.0000 Constraint 184 208 0.8000 1.0000 2.0000 0.0000 Constraint 184 199 0.8000 1.0000 2.0000 0.0000 Constraint 184 191 0.8000 1.0000 2.0000 0.0000 Constraint 173 1051 0.8000 1.0000 2.0000 0.0000 Constraint 173 1043 0.8000 1.0000 2.0000 0.0000 Constraint 173 1033 0.8000 1.0000 2.0000 0.0000 Constraint 173 1026 0.8000 1.0000 2.0000 0.0000 Constraint 173 1019 0.8000 1.0000 2.0000 0.0000 Constraint 173 1011 0.8000 1.0000 2.0000 0.0000 Constraint 173 1003 0.8000 1.0000 2.0000 0.0000 Constraint 173 995 0.8000 1.0000 2.0000 0.0000 Constraint 173 987 0.8000 1.0000 2.0000 0.0000 Constraint 173 980 0.8000 1.0000 2.0000 0.0000 Constraint 173 972 0.8000 1.0000 2.0000 0.0000 Constraint 173 960 0.8000 1.0000 2.0000 0.0000 Constraint 173 951 0.8000 1.0000 2.0000 0.0000 Constraint 173 943 0.8000 1.0000 2.0000 0.0000 Constraint 173 931 0.8000 1.0000 2.0000 0.0000 Constraint 173 919 0.8000 1.0000 2.0000 0.0000 Constraint 173 911 0.8000 1.0000 2.0000 0.0000 Constraint 173 901 0.8000 1.0000 2.0000 0.0000 Constraint 173 891 0.8000 1.0000 2.0000 0.0000 Constraint 173 883 0.8000 1.0000 2.0000 0.0000 Constraint 173 872 0.8000 1.0000 2.0000 0.0000 Constraint 173 866 0.8000 1.0000 2.0000 0.0000 Constraint 173 857 0.8000 1.0000 2.0000 0.0000 Constraint 173 849 0.8000 1.0000 2.0000 0.0000 Constraint 173 840 0.8000 1.0000 2.0000 0.0000 Constraint 173 827 0.8000 1.0000 2.0000 0.0000 Constraint 173 822 0.8000 1.0000 2.0000 0.0000 Constraint 173 814 0.8000 1.0000 2.0000 0.0000 Constraint 173 808 0.8000 1.0000 2.0000 0.0000 Constraint 173 792 0.8000 1.0000 2.0000 0.0000 Constraint 173 784 0.8000 1.0000 2.0000 0.0000 Constraint 173 768 0.8000 1.0000 2.0000 0.0000 Constraint 173 761 0.8000 1.0000 2.0000 0.0000 Constraint 173 751 0.8000 1.0000 2.0000 0.0000 Constraint 173 743 0.8000 1.0000 2.0000 0.0000 Constraint 173 735 0.8000 1.0000 2.0000 0.0000 Constraint 173 727 0.8000 1.0000 2.0000 0.0000 Constraint 173 719 0.8000 1.0000 2.0000 0.0000 Constraint 173 711 0.8000 1.0000 2.0000 0.0000 Constraint 173 706 0.8000 1.0000 2.0000 0.0000 Constraint 173 698 0.8000 1.0000 2.0000 0.0000 Constraint 173 690 0.8000 1.0000 2.0000 0.0000 Constraint 173 682 0.8000 1.0000 2.0000 0.0000 Constraint 173 674 0.8000 1.0000 2.0000 0.0000 Constraint 173 667 0.8000 1.0000 2.0000 0.0000 Constraint 173 659 0.8000 1.0000 2.0000 0.0000 Constraint 173 650 0.8000 1.0000 2.0000 0.0000 Constraint 173 641 0.8000 1.0000 2.0000 0.0000 Constraint 173 633 0.8000 1.0000 2.0000 0.0000 Constraint 173 627 0.8000 1.0000 2.0000 0.0000 Constraint 173 621 0.8000 1.0000 2.0000 0.0000 Constraint 173 614 0.8000 1.0000 2.0000 0.0000 Constraint 173 603 0.8000 1.0000 2.0000 0.0000 Constraint 173 590 0.8000 1.0000 2.0000 0.0000 Constraint 173 567 0.8000 1.0000 2.0000 0.0000 Constraint 173 560 0.8000 1.0000 2.0000 0.0000 Constraint 173 547 0.8000 1.0000 2.0000 0.0000 Constraint 173 519 0.8000 1.0000 2.0000 0.0000 Constraint 173 505 0.8000 1.0000 2.0000 0.0000 Constraint 173 500 0.8000 1.0000 2.0000 0.0000 Constraint 173 493 0.8000 1.0000 2.0000 0.0000 Constraint 173 486 0.8000 1.0000 2.0000 0.0000 Constraint 173 478 0.8000 1.0000 2.0000 0.0000 Constraint 173 471 0.8000 1.0000 2.0000 0.0000 Constraint 173 466 0.8000 1.0000 2.0000 0.0000 Constraint 173 459 0.8000 1.0000 2.0000 0.0000 Constraint 173 445 0.8000 1.0000 2.0000 0.0000 Constraint 173 437 0.8000 1.0000 2.0000 0.0000 Constraint 173 419 0.8000 1.0000 2.0000 0.0000 Constraint 173 411 0.8000 1.0000 2.0000 0.0000 Constraint 173 404 0.8000 1.0000 2.0000 0.0000 Constraint 173 388 0.8000 1.0000 2.0000 0.0000 Constraint 173 380 0.8000 1.0000 2.0000 0.0000 Constraint 173 361 0.8000 1.0000 2.0000 0.0000 Constraint 173 352 0.8000 1.0000 2.0000 0.0000 Constraint 173 326 0.8000 1.0000 2.0000 0.0000 Constraint 173 317 0.8000 1.0000 2.0000 0.0000 Constraint 173 303 0.8000 1.0000 2.0000 0.0000 Constraint 173 294 0.8000 1.0000 2.0000 0.0000 Constraint 173 286 0.8000 1.0000 2.0000 0.0000 Constraint 173 277 0.8000 1.0000 2.0000 0.0000 Constraint 173 253 0.8000 1.0000 2.0000 0.0000 Constraint 173 247 0.8000 1.0000 2.0000 0.0000 Constraint 173 238 0.8000 1.0000 2.0000 0.0000 Constraint 173 232 0.8000 1.0000 2.0000 0.0000 Constraint 173 220 0.8000 1.0000 2.0000 0.0000 Constraint 173 208 0.8000 1.0000 2.0000 0.0000 Constraint 173 199 0.8000 1.0000 2.0000 0.0000 Constraint 173 191 0.8000 1.0000 2.0000 0.0000 Constraint 173 184 0.8000 1.0000 2.0000 0.0000 Constraint 165 1051 0.8000 1.0000 2.0000 0.0000 Constraint 165 1043 0.8000 1.0000 2.0000 0.0000 Constraint 165 1033 0.8000 1.0000 2.0000 0.0000 Constraint 165 1026 0.8000 1.0000 2.0000 0.0000 Constraint 165 1019 0.8000 1.0000 2.0000 0.0000 Constraint 165 1011 0.8000 1.0000 2.0000 0.0000 Constraint 165 1003 0.8000 1.0000 2.0000 0.0000 Constraint 165 995 0.8000 1.0000 2.0000 0.0000 Constraint 165 987 0.8000 1.0000 2.0000 0.0000 Constraint 165 980 0.8000 1.0000 2.0000 0.0000 Constraint 165 972 0.8000 1.0000 2.0000 0.0000 Constraint 165 960 0.8000 1.0000 2.0000 0.0000 Constraint 165 951 0.8000 1.0000 2.0000 0.0000 Constraint 165 943 0.8000 1.0000 2.0000 0.0000 Constraint 165 931 0.8000 1.0000 2.0000 0.0000 Constraint 165 919 0.8000 1.0000 2.0000 0.0000 Constraint 165 911 0.8000 1.0000 2.0000 0.0000 Constraint 165 901 0.8000 1.0000 2.0000 0.0000 Constraint 165 891 0.8000 1.0000 2.0000 0.0000 Constraint 165 883 0.8000 1.0000 2.0000 0.0000 Constraint 165 872 0.8000 1.0000 2.0000 0.0000 Constraint 165 866 0.8000 1.0000 2.0000 0.0000 Constraint 165 857 0.8000 1.0000 2.0000 0.0000 Constraint 165 849 0.8000 1.0000 2.0000 0.0000 Constraint 165 840 0.8000 1.0000 2.0000 0.0000 Constraint 165 827 0.8000 1.0000 2.0000 0.0000 Constraint 165 822 0.8000 1.0000 2.0000 0.0000 Constraint 165 814 0.8000 1.0000 2.0000 0.0000 Constraint 165 808 0.8000 1.0000 2.0000 0.0000 Constraint 165 801 0.8000 1.0000 2.0000 0.0000 Constraint 165 792 0.8000 1.0000 2.0000 0.0000 Constraint 165 784 0.8000 1.0000 2.0000 0.0000 Constraint 165 776 0.8000 1.0000 2.0000 0.0000 Constraint 165 768 0.8000 1.0000 2.0000 0.0000 Constraint 165 761 0.8000 1.0000 2.0000 0.0000 Constraint 165 751 0.8000 1.0000 2.0000 0.0000 Constraint 165 743 0.8000 1.0000 2.0000 0.0000 Constraint 165 735 0.8000 1.0000 2.0000 0.0000 Constraint 165 727 0.8000 1.0000 2.0000 0.0000 Constraint 165 719 0.8000 1.0000 2.0000 0.0000 Constraint 165 711 0.8000 1.0000 2.0000 0.0000 Constraint 165 706 0.8000 1.0000 2.0000 0.0000 Constraint 165 698 0.8000 1.0000 2.0000 0.0000 Constraint 165 690 0.8000 1.0000 2.0000 0.0000 Constraint 165 682 0.8000 1.0000 2.0000 0.0000 Constraint 165 674 0.8000 1.0000 2.0000 0.0000 Constraint 165 667 0.8000 1.0000 2.0000 0.0000 Constraint 165 659 0.8000 1.0000 2.0000 0.0000 Constraint 165 650 0.8000 1.0000 2.0000 0.0000 Constraint 165 641 0.8000 1.0000 2.0000 0.0000 Constraint 165 633 0.8000 1.0000 2.0000 0.0000 Constraint 165 627 0.8000 1.0000 2.0000 0.0000 Constraint 165 621 0.8000 1.0000 2.0000 0.0000 Constraint 165 614 0.8000 1.0000 2.0000 0.0000 Constraint 165 603 0.8000 1.0000 2.0000 0.0000 Constraint 165 597 0.8000 1.0000 2.0000 0.0000 Constraint 165 590 0.8000 1.0000 2.0000 0.0000 Constraint 165 581 0.8000 1.0000 2.0000 0.0000 Constraint 165 574 0.8000 1.0000 2.0000 0.0000 Constraint 165 567 0.8000 1.0000 2.0000 0.0000 Constraint 165 560 0.8000 1.0000 2.0000 0.0000 Constraint 165 552 0.8000 1.0000 2.0000 0.0000 Constraint 165 547 0.8000 1.0000 2.0000 0.0000 Constraint 165 539 0.8000 1.0000 2.0000 0.0000 Constraint 165 531 0.8000 1.0000 2.0000 0.0000 Constraint 165 519 0.8000 1.0000 2.0000 0.0000 Constraint 165 510 0.8000 1.0000 2.0000 0.0000 Constraint 165 505 0.8000 1.0000 2.0000 0.0000 Constraint 165 500 0.8000 1.0000 2.0000 0.0000 Constraint 165 493 0.8000 1.0000 2.0000 0.0000 Constraint 165 486 0.8000 1.0000 2.0000 0.0000 Constraint 165 478 0.8000 1.0000 2.0000 0.0000 Constraint 165 471 0.8000 1.0000 2.0000 0.0000 Constraint 165 466 0.8000 1.0000 2.0000 0.0000 Constraint 165 459 0.8000 1.0000 2.0000 0.0000 Constraint 165 445 0.8000 1.0000 2.0000 0.0000 Constraint 165 419 0.8000 1.0000 2.0000 0.0000 Constraint 165 411 0.8000 1.0000 2.0000 0.0000 Constraint 165 404 0.8000 1.0000 2.0000 0.0000 Constraint 165 388 0.8000 1.0000 2.0000 0.0000 Constraint 165 380 0.8000 1.0000 2.0000 0.0000 Constraint 165 372 0.8000 1.0000 2.0000 0.0000 Constraint 165 361 0.8000 1.0000 2.0000 0.0000 Constraint 165 352 0.8000 1.0000 2.0000 0.0000 Constraint 165 345 0.8000 1.0000 2.0000 0.0000 Constraint 165 337 0.8000 1.0000 2.0000 0.0000 Constraint 165 317 0.8000 1.0000 2.0000 0.0000 Constraint 165 303 0.8000 1.0000 2.0000 0.0000 Constraint 165 294 0.8000 1.0000 2.0000 0.0000 Constraint 165 286 0.8000 1.0000 2.0000 0.0000 Constraint 165 238 0.8000 1.0000 2.0000 0.0000 Constraint 165 232 0.8000 1.0000 2.0000 0.0000 Constraint 165 220 0.8000 1.0000 2.0000 0.0000 Constraint 165 208 0.8000 1.0000 2.0000 0.0000 Constraint 165 199 0.8000 1.0000 2.0000 0.0000 Constraint 165 191 0.8000 1.0000 2.0000 0.0000 Constraint 165 184 0.8000 1.0000 2.0000 0.0000 Constraint 165 173 0.8000 1.0000 2.0000 0.0000 Constraint 157 1051 0.8000 1.0000 2.0000 0.0000 Constraint 157 1043 0.8000 1.0000 2.0000 0.0000 Constraint 157 1033 0.8000 1.0000 2.0000 0.0000 Constraint 157 1026 0.8000 1.0000 2.0000 0.0000 Constraint 157 1019 0.8000 1.0000 2.0000 0.0000 Constraint 157 1011 0.8000 1.0000 2.0000 0.0000 Constraint 157 1003 0.8000 1.0000 2.0000 0.0000 Constraint 157 995 0.8000 1.0000 2.0000 0.0000 Constraint 157 987 0.8000 1.0000 2.0000 0.0000 Constraint 157 980 0.8000 1.0000 2.0000 0.0000 Constraint 157 972 0.8000 1.0000 2.0000 0.0000 Constraint 157 960 0.8000 1.0000 2.0000 0.0000 Constraint 157 951 0.8000 1.0000 2.0000 0.0000 Constraint 157 943 0.8000 1.0000 2.0000 0.0000 Constraint 157 931 0.8000 1.0000 2.0000 0.0000 Constraint 157 919 0.8000 1.0000 2.0000 0.0000 Constraint 157 911 0.8000 1.0000 2.0000 0.0000 Constraint 157 901 0.8000 1.0000 2.0000 0.0000 Constraint 157 891 0.8000 1.0000 2.0000 0.0000 Constraint 157 883 0.8000 1.0000 2.0000 0.0000 Constraint 157 872 0.8000 1.0000 2.0000 0.0000 Constraint 157 866 0.8000 1.0000 2.0000 0.0000 Constraint 157 857 0.8000 1.0000 2.0000 0.0000 Constraint 157 849 0.8000 1.0000 2.0000 0.0000 Constraint 157 840 0.8000 1.0000 2.0000 0.0000 Constraint 157 827 0.8000 1.0000 2.0000 0.0000 Constraint 157 822 0.8000 1.0000 2.0000 0.0000 Constraint 157 814 0.8000 1.0000 2.0000 0.0000 Constraint 157 808 0.8000 1.0000 2.0000 0.0000 Constraint 157 801 0.8000 1.0000 2.0000 0.0000 Constraint 157 792 0.8000 1.0000 2.0000 0.0000 Constraint 157 784 0.8000 1.0000 2.0000 0.0000 Constraint 157 776 0.8000 1.0000 2.0000 0.0000 Constraint 157 768 0.8000 1.0000 2.0000 0.0000 Constraint 157 761 0.8000 1.0000 2.0000 0.0000 Constraint 157 743 0.8000 1.0000 2.0000 0.0000 Constraint 157 735 0.8000 1.0000 2.0000 0.0000 Constraint 157 719 0.8000 1.0000 2.0000 0.0000 Constraint 157 711 0.8000 1.0000 2.0000 0.0000 Constraint 157 706 0.8000 1.0000 2.0000 0.0000 Constraint 157 698 0.8000 1.0000 2.0000 0.0000 Constraint 157 690 0.8000 1.0000 2.0000 0.0000 Constraint 157 682 0.8000 1.0000 2.0000 0.0000 Constraint 157 674 0.8000 1.0000 2.0000 0.0000 Constraint 157 667 0.8000 1.0000 2.0000 0.0000 Constraint 157 659 0.8000 1.0000 2.0000 0.0000 Constraint 157 650 0.8000 1.0000 2.0000 0.0000 Constraint 157 641 0.8000 1.0000 2.0000 0.0000 Constraint 157 633 0.8000 1.0000 2.0000 0.0000 Constraint 157 627 0.8000 1.0000 2.0000 0.0000 Constraint 157 621 0.8000 1.0000 2.0000 0.0000 Constraint 157 614 0.8000 1.0000 2.0000 0.0000 Constraint 157 603 0.8000 1.0000 2.0000 0.0000 Constraint 157 597 0.8000 1.0000 2.0000 0.0000 Constraint 157 590 0.8000 1.0000 2.0000 0.0000 Constraint 157 574 0.8000 1.0000 2.0000 0.0000 Constraint 157 552 0.8000 1.0000 2.0000 0.0000 Constraint 157 547 0.8000 1.0000 2.0000 0.0000 Constraint 157 539 0.8000 1.0000 2.0000 0.0000 Constraint 157 531 0.8000 1.0000 2.0000 0.0000 Constraint 157 519 0.8000 1.0000 2.0000 0.0000 Constraint 157 505 0.8000 1.0000 2.0000 0.0000 Constraint 157 500 0.8000 1.0000 2.0000 0.0000 Constraint 157 493 0.8000 1.0000 2.0000 0.0000 Constraint 157 486 0.8000 1.0000 2.0000 0.0000 Constraint 157 466 0.8000 1.0000 2.0000 0.0000 Constraint 157 459 0.8000 1.0000 2.0000 0.0000 Constraint 157 445 0.8000 1.0000 2.0000 0.0000 Constraint 157 411 0.8000 1.0000 2.0000 0.0000 Constraint 157 404 0.8000 1.0000 2.0000 0.0000 Constraint 157 380 0.8000 1.0000 2.0000 0.0000 Constraint 157 372 0.8000 1.0000 2.0000 0.0000 Constraint 157 361 0.8000 1.0000 2.0000 0.0000 Constraint 157 352 0.8000 1.0000 2.0000 0.0000 Constraint 157 345 0.8000 1.0000 2.0000 0.0000 Constraint 157 337 0.8000 1.0000 2.0000 0.0000 Constraint 157 326 0.8000 1.0000 2.0000 0.0000 Constraint 157 317 0.8000 1.0000 2.0000 0.0000 Constraint 157 309 0.8000 1.0000 2.0000 0.0000 Constraint 157 294 0.8000 1.0000 2.0000 0.0000 Constraint 157 286 0.8000 1.0000 2.0000 0.0000 Constraint 157 277 0.8000 1.0000 2.0000 0.0000 Constraint 157 262 0.8000 1.0000 2.0000 0.0000 Constraint 157 253 0.8000 1.0000 2.0000 0.0000 Constraint 157 247 0.8000 1.0000 2.0000 0.0000 Constraint 157 238 0.8000 1.0000 2.0000 0.0000 Constraint 157 232 0.8000 1.0000 2.0000 0.0000 Constraint 157 220 0.8000 1.0000 2.0000 0.0000 Constraint 157 208 0.8000 1.0000 2.0000 0.0000 Constraint 157 199 0.8000 1.0000 2.0000 0.0000 Constraint 157 191 0.8000 1.0000 2.0000 0.0000 Constraint 157 184 0.8000 1.0000 2.0000 0.0000 Constraint 157 173 0.8000 1.0000 2.0000 0.0000 Constraint 157 165 0.8000 1.0000 2.0000 0.0000 Constraint 149 1051 0.8000 1.0000 2.0000 0.0000 Constraint 149 1043 0.8000 1.0000 2.0000 0.0000 Constraint 149 1033 0.8000 1.0000 2.0000 0.0000 Constraint 149 1026 0.8000 1.0000 2.0000 0.0000 Constraint 149 1019 0.8000 1.0000 2.0000 0.0000 Constraint 149 1011 0.8000 1.0000 2.0000 0.0000 Constraint 149 1003 0.8000 1.0000 2.0000 0.0000 Constraint 149 995 0.8000 1.0000 2.0000 0.0000 Constraint 149 987 0.8000 1.0000 2.0000 0.0000 Constraint 149 980 0.8000 1.0000 2.0000 0.0000 Constraint 149 972 0.8000 1.0000 2.0000 0.0000 Constraint 149 960 0.8000 1.0000 2.0000 0.0000 Constraint 149 951 0.8000 1.0000 2.0000 0.0000 Constraint 149 943 0.8000 1.0000 2.0000 0.0000 Constraint 149 931 0.8000 1.0000 2.0000 0.0000 Constraint 149 919 0.8000 1.0000 2.0000 0.0000 Constraint 149 911 0.8000 1.0000 2.0000 0.0000 Constraint 149 901 0.8000 1.0000 2.0000 0.0000 Constraint 149 891 0.8000 1.0000 2.0000 0.0000 Constraint 149 883 0.8000 1.0000 2.0000 0.0000 Constraint 149 872 0.8000 1.0000 2.0000 0.0000 Constraint 149 866 0.8000 1.0000 2.0000 0.0000 Constraint 149 857 0.8000 1.0000 2.0000 0.0000 Constraint 149 849 0.8000 1.0000 2.0000 0.0000 Constraint 149 840 0.8000 1.0000 2.0000 0.0000 Constraint 149 827 0.8000 1.0000 2.0000 0.0000 Constraint 149 822 0.8000 1.0000 2.0000 0.0000 Constraint 149 814 0.8000 1.0000 2.0000 0.0000 Constraint 149 808 0.8000 1.0000 2.0000 0.0000 Constraint 149 801 0.8000 1.0000 2.0000 0.0000 Constraint 149 792 0.8000 1.0000 2.0000 0.0000 Constraint 149 784 0.8000 1.0000 2.0000 0.0000 Constraint 149 776 0.8000 1.0000 2.0000 0.0000 Constraint 149 768 0.8000 1.0000 2.0000 0.0000 Constraint 149 761 0.8000 1.0000 2.0000 0.0000 Constraint 149 743 0.8000 1.0000 2.0000 0.0000 Constraint 149 735 0.8000 1.0000 2.0000 0.0000 Constraint 149 727 0.8000 1.0000 2.0000 0.0000 Constraint 149 719 0.8000 1.0000 2.0000 0.0000 Constraint 149 711 0.8000 1.0000 2.0000 0.0000 Constraint 149 706 0.8000 1.0000 2.0000 0.0000 Constraint 149 698 0.8000 1.0000 2.0000 0.0000 Constraint 149 690 0.8000 1.0000 2.0000 0.0000 Constraint 149 682 0.8000 1.0000 2.0000 0.0000 Constraint 149 674 0.8000 1.0000 2.0000 0.0000 Constraint 149 667 0.8000 1.0000 2.0000 0.0000 Constraint 149 659 0.8000 1.0000 2.0000 0.0000 Constraint 149 650 0.8000 1.0000 2.0000 0.0000 Constraint 149 641 0.8000 1.0000 2.0000 0.0000 Constraint 149 633 0.8000 1.0000 2.0000 0.0000 Constraint 149 627 0.8000 1.0000 2.0000 0.0000 Constraint 149 621 0.8000 1.0000 2.0000 0.0000 Constraint 149 614 0.8000 1.0000 2.0000 0.0000 Constraint 149 597 0.8000 1.0000 2.0000 0.0000 Constraint 149 590 0.8000 1.0000 2.0000 0.0000 Constraint 149 560 0.8000 1.0000 2.0000 0.0000 Constraint 149 552 0.8000 1.0000 2.0000 0.0000 Constraint 149 547 0.8000 1.0000 2.0000 0.0000 Constraint 149 539 0.8000 1.0000 2.0000 0.0000 Constraint 149 531 0.8000 1.0000 2.0000 0.0000 Constraint 149 519 0.8000 1.0000 2.0000 0.0000 Constraint 149 510 0.8000 1.0000 2.0000 0.0000 Constraint 149 505 0.8000 1.0000 2.0000 0.0000 Constraint 149 500 0.8000 1.0000 2.0000 0.0000 Constraint 149 493 0.8000 1.0000 2.0000 0.0000 Constraint 149 486 0.8000 1.0000 2.0000 0.0000 Constraint 149 478 0.8000 1.0000 2.0000 0.0000 Constraint 149 466 0.8000 1.0000 2.0000 0.0000 Constraint 149 459 0.8000 1.0000 2.0000 0.0000 Constraint 149 445 0.8000 1.0000 2.0000 0.0000 Constraint 149 437 0.8000 1.0000 2.0000 0.0000 Constraint 149 419 0.8000 1.0000 2.0000 0.0000 Constraint 149 411 0.8000 1.0000 2.0000 0.0000 Constraint 149 404 0.8000 1.0000 2.0000 0.0000 Constraint 149 396 0.8000 1.0000 2.0000 0.0000 Constraint 149 388 0.8000 1.0000 2.0000 0.0000 Constraint 149 380 0.8000 1.0000 2.0000 0.0000 Constraint 149 372 0.8000 1.0000 2.0000 0.0000 Constraint 149 361 0.8000 1.0000 2.0000 0.0000 Constraint 149 352 0.8000 1.0000 2.0000 0.0000 Constraint 149 345 0.8000 1.0000 2.0000 0.0000 Constraint 149 337 0.8000 1.0000 2.0000 0.0000 Constraint 149 326 0.8000 1.0000 2.0000 0.0000 Constraint 149 317 0.8000 1.0000 2.0000 0.0000 Constraint 149 309 0.8000 1.0000 2.0000 0.0000 Constraint 149 286 0.8000 1.0000 2.0000 0.0000 Constraint 149 277 0.8000 1.0000 2.0000 0.0000 Constraint 149 270 0.8000 1.0000 2.0000 0.0000 Constraint 149 262 0.8000 1.0000 2.0000 0.0000 Constraint 149 253 0.8000 1.0000 2.0000 0.0000 Constraint 149 247 0.8000 1.0000 2.0000 0.0000 Constraint 149 238 0.8000 1.0000 2.0000 0.0000 Constraint 149 232 0.8000 1.0000 2.0000 0.0000 Constraint 149 220 0.8000 1.0000 2.0000 0.0000 Constraint 149 208 0.8000 1.0000 2.0000 0.0000 Constraint 149 199 0.8000 1.0000 2.0000 0.0000 Constraint 149 191 0.8000 1.0000 2.0000 0.0000 Constraint 149 184 0.8000 1.0000 2.0000 0.0000 Constraint 149 173 0.8000 1.0000 2.0000 0.0000 Constraint 149 165 0.8000 1.0000 2.0000 0.0000 Constraint 149 157 0.8000 1.0000 2.0000 0.0000 Constraint 143 1051 0.8000 1.0000 2.0000 0.0000 Constraint 143 1043 0.8000 1.0000 2.0000 0.0000 Constraint 143 1033 0.8000 1.0000 2.0000 0.0000 Constraint 143 1026 0.8000 1.0000 2.0000 0.0000 Constraint 143 1019 0.8000 1.0000 2.0000 0.0000 Constraint 143 1011 0.8000 1.0000 2.0000 0.0000 Constraint 143 1003 0.8000 1.0000 2.0000 0.0000 Constraint 143 995 0.8000 1.0000 2.0000 0.0000 Constraint 143 987 0.8000 1.0000 2.0000 0.0000 Constraint 143 972 0.8000 1.0000 2.0000 0.0000 Constraint 143 960 0.8000 1.0000 2.0000 0.0000 Constraint 143 951 0.8000 1.0000 2.0000 0.0000 Constraint 143 943 0.8000 1.0000 2.0000 0.0000 Constraint 143 931 0.8000 1.0000 2.0000 0.0000 Constraint 143 919 0.8000 1.0000 2.0000 0.0000 Constraint 143 911 0.8000 1.0000 2.0000 0.0000 Constraint 143 901 0.8000 1.0000 2.0000 0.0000 Constraint 143 891 0.8000 1.0000 2.0000 0.0000 Constraint 143 883 0.8000 1.0000 2.0000 0.0000 Constraint 143 872 0.8000 1.0000 2.0000 0.0000 Constraint 143 866 0.8000 1.0000 2.0000 0.0000 Constraint 143 857 0.8000 1.0000 2.0000 0.0000 Constraint 143 849 0.8000 1.0000 2.0000 0.0000 Constraint 143 840 0.8000 1.0000 2.0000 0.0000 Constraint 143 827 0.8000 1.0000 2.0000 0.0000 Constraint 143 822 0.8000 1.0000 2.0000 0.0000 Constraint 143 814 0.8000 1.0000 2.0000 0.0000 Constraint 143 808 0.8000 1.0000 2.0000 0.0000 Constraint 143 801 0.8000 1.0000 2.0000 0.0000 Constraint 143 792 0.8000 1.0000 2.0000 0.0000 Constraint 143 784 0.8000 1.0000 2.0000 0.0000 Constraint 143 776 0.8000 1.0000 2.0000 0.0000 Constraint 143 768 0.8000 1.0000 2.0000 0.0000 Constraint 143 761 0.8000 1.0000 2.0000 0.0000 Constraint 143 751 0.8000 1.0000 2.0000 0.0000 Constraint 143 743 0.8000 1.0000 2.0000 0.0000 Constraint 143 735 0.8000 1.0000 2.0000 0.0000 Constraint 143 727 0.8000 1.0000 2.0000 0.0000 Constraint 143 719 0.8000 1.0000 2.0000 0.0000 Constraint 143 711 0.8000 1.0000 2.0000 0.0000 Constraint 143 706 0.8000 1.0000 2.0000 0.0000 Constraint 143 698 0.8000 1.0000 2.0000 0.0000 Constraint 143 690 0.8000 1.0000 2.0000 0.0000 Constraint 143 682 0.8000 1.0000 2.0000 0.0000 Constraint 143 674 0.8000 1.0000 2.0000 0.0000 Constraint 143 667 0.8000 1.0000 2.0000 0.0000 Constraint 143 659 0.8000 1.0000 2.0000 0.0000 Constraint 143 650 0.8000 1.0000 2.0000 0.0000 Constraint 143 633 0.8000 1.0000 2.0000 0.0000 Constraint 143 627 0.8000 1.0000 2.0000 0.0000 Constraint 143 621 0.8000 1.0000 2.0000 0.0000 Constraint 143 614 0.8000 1.0000 2.0000 0.0000 Constraint 143 603 0.8000 1.0000 2.0000 0.0000 Constraint 143 597 0.8000 1.0000 2.0000 0.0000 Constraint 143 560 0.8000 1.0000 2.0000 0.0000 Constraint 143 552 0.8000 1.0000 2.0000 0.0000 Constraint 143 547 0.8000 1.0000 2.0000 0.0000 Constraint 143 539 0.8000 1.0000 2.0000 0.0000 Constraint 143 531 0.8000 1.0000 2.0000 0.0000 Constraint 143 519 0.8000 1.0000 2.0000 0.0000 Constraint 143 510 0.8000 1.0000 2.0000 0.0000 Constraint 143 505 0.8000 1.0000 2.0000 0.0000 Constraint 143 500 0.8000 1.0000 2.0000 0.0000 Constraint 143 493 0.8000 1.0000 2.0000 0.0000 Constraint 143 486 0.8000 1.0000 2.0000 0.0000 Constraint 143 478 0.8000 1.0000 2.0000 0.0000 Constraint 143 471 0.8000 1.0000 2.0000 0.0000 Constraint 143 466 0.8000 1.0000 2.0000 0.0000 Constraint 143 459 0.8000 1.0000 2.0000 0.0000 Constraint 143 445 0.8000 1.0000 2.0000 0.0000 Constraint 143 437 0.8000 1.0000 2.0000 0.0000 Constraint 143 430 0.8000 1.0000 2.0000 0.0000 Constraint 143 419 0.8000 1.0000 2.0000 0.0000 Constraint 143 411 0.8000 1.0000 2.0000 0.0000 Constraint 143 404 0.8000 1.0000 2.0000 0.0000 Constraint 143 396 0.8000 1.0000 2.0000 0.0000 Constraint 143 388 0.8000 1.0000 2.0000 0.0000 Constraint 143 380 0.8000 1.0000 2.0000 0.0000 Constraint 143 361 0.8000 1.0000 2.0000 0.0000 Constraint 143 352 0.8000 1.0000 2.0000 0.0000 Constraint 143 345 0.8000 1.0000 2.0000 0.0000 Constraint 143 337 0.8000 1.0000 2.0000 0.0000 Constraint 143 326 0.8000 1.0000 2.0000 0.0000 Constraint 143 317 0.8000 1.0000 2.0000 0.0000 Constraint 143 309 0.8000 1.0000 2.0000 0.0000 Constraint 143 277 0.8000 1.0000 2.0000 0.0000 Constraint 143 262 0.8000 1.0000 2.0000 0.0000 Constraint 143 238 0.8000 1.0000 2.0000 0.0000 Constraint 143 208 0.8000 1.0000 2.0000 0.0000 Constraint 143 199 0.8000 1.0000 2.0000 0.0000 Constraint 143 191 0.8000 1.0000 2.0000 0.0000 Constraint 143 184 0.8000 1.0000 2.0000 0.0000 Constraint 143 173 0.8000 1.0000 2.0000 0.0000 Constraint 143 165 0.8000 1.0000 2.0000 0.0000 Constraint 143 157 0.8000 1.0000 2.0000 0.0000 Constraint 143 149 0.8000 1.0000 2.0000 0.0000 Constraint 136 1051 0.8000 1.0000 2.0000 0.0000 Constraint 136 1043 0.8000 1.0000 2.0000 0.0000 Constraint 136 1033 0.8000 1.0000 2.0000 0.0000 Constraint 136 1026 0.8000 1.0000 2.0000 0.0000 Constraint 136 1019 0.8000 1.0000 2.0000 0.0000 Constraint 136 1011 0.8000 1.0000 2.0000 0.0000 Constraint 136 1003 0.8000 1.0000 2.0000 0.0000 Constraint 136 995 0.8000 1.0000 2.0000 0.0000 Constraint 136 972 0.8000 1.0000 2.0000 0.0000 Constraint 136 960 0.8000 1.0000 2.0000 0.0000 Constraint 136 951 0.8000 1.0000 2.0000 0.0000 Constraint 136 943 0.8000 1.0000 2.0000 0.0000 Constraint 136 931 0.8000 1.0000 2.0000 0.0000 Constraint 136 919 0.8000 1.0000 2.0000 0.0000 Constraint 136 911 0.8000 1.0000 2.0000 0.0000 Constraint 136 901 0.8000 1.0000 2.0000 0.0000 Constraint 136 891 0.8000 1.0000 2.0000 0.0000 Constraint 136 883 0.8000 1.0000 2.0000 0.0000 Constraint 136 872 0.8000 1.0000 2.0000 0.0000 Constraint 136 866 0.8000 1.0000 2.0000 0.0000 Constraint 136 857 0.8000 1.0000 2.0000 0.0000 Constraint 136 849 0.8000 1.0000 2.0000 0.0000 Constraint 136 840 0.8000 1.0000 2.0000 0.0000 Constraint 136 827 0.8000 1.0000 2.0000 0.0000 Constraint 136 822 0.8000 1.0000 2.0000 0.0000 Constraint 136 814 0.8000 1.0000 2.0000 0.0000 Constraint 136 808 0.8000 1.0000 2.0000 0.0000 Constraint 136 801 0.8000 1.0000 2.0000 0.0000 Constraint 136 792 0.8000 1.0000 2.0000 0.0000 Constraint 136 784 0.8000 1.0000 2.0000 0.0000 Constraint 136 776 0.8000 1.0000 2.0000 0.0000 Constraint 136 768 0.8000 1.0000 2.0000 0.0000 Constraint 136 761 0.8000 1.0000 2.0000 0.0000 Constraint 136 751 0.8000 1.0000 2.0000 0.0000 Constraint 136 743 0.8000 1.0000 2.0000 0.0000 Constraint 136 735 0.8000 1.0000 2.0000 0.0000 Constraint 136 727 0.8000 1.0000 2.0000 0.0000 Constraint 136 719 0.8000 1.0000 2.0000 0.0000 Constraint 136 711 0.8000 1.0000 2.0000 0.0000 Constraint 136 706 0.8000 1.0000 2.0000 0.0000 Constraint 136 698 0.8000 1.0000 2.0000 0.0000 Constraint 136 690 0.8000 1.0000 2.0000 0.0000 Constraint 136 682 0.8000 1.0000 2.0000 0.0000 Constraint 136 674 0.8000 1.0000 2.0000 0.0000 Constraint 136 667 0.8000 1.0000 2.0000 0.0000 Constraint 136 659 0.8000 1.0000 2.0000 0.0000 Constraint 136 650 0.8000 1.0000 2.0000 0.0000 Constraint 136 633 0.8000 1.0000 2.0000 0.0000 Constraint 136 627 0.8000 1.0000 2.0000 0.0000 Constraint 136 621 0.8000 1.0000 2.0000 0.0000 Constraint 136 614 0.8000 1.0000 2.0000 0.0000 Constraint 136 603 0.8000 1.0000 2.0000 0.0000 Constraint 136 590 0.8000 1.0000 2.0000 0.0000 Constraint 136 567 0.8000 1.0000 2.0000 0.0000 Constraint 136 560 0.8000 1.0000 2.0000 0.0000 Constraint 136 552 0.8000 1.0000 2.0000 0.0000 Constraint 136 547 0.8000 1.0000 2.0000 0.0000 Constraint 136 539 0.8000 1.0000 2.0000 0.0000 Constraint 136 531 0.8000 1.0000 2.0000 0.0000 Constraint 136 519 0.8000 1.0000 2.0000 0.0000 Constraint 136 510 0.8000 1.0000 2.0000 0.0000 Constraint 136 505 0.8000 1.0000 2.0000 0.0000 Constraint 136 500 0.8000 1.0000 2.0000 0.0000 Constraint 136 493 0.8000 1.0000 2.0000 0.0000 Constraint 136 486 0.8000 1.0000 2.0000 0.0000 Constraint 136 478 0.8000 1.0000 2.0000 0.0000 Constraint 136 471 0.8000 1.0000 2.0000 0.0000 Constraint 136 466 0.8000 1.0000 2.0000 0.0000 Constraint 136 459 0.8000 1.0000 2.0000 0.0000 Constraint 136 445 0.8000 1.0000 2.0000 0.0000 Constraint 136 437 0.8000 1.0000 2.0000 0.0000 Constraint 136 430 0.8000 1.0000 2.0000 0.0000 Constraint 136 419 0.8000 1.0000 2.0000 0.0000 Constraint 136 411 0.8000 1.0000 2.0000 0.0000 Constraint 136 404 0.8000 1.0000 2.0000 0.0000 Constraint 136 380 0.8000 1.0000 2.0000 0.0000 Constraint 136 372 0.8000 1.0000 2.0000 0.0000 Constraint 136 361 0.8000 1.0000 2.0000 0.0000 Constraint 136 352 0.8000 1.0000 2.0000 0.0000 Constraint 136 345 0.8000 1.0000 2.0000 0.0000 Constraint 136 326 0.8000 1.0000 2.0000 0.0000 Constraint 136 262 0.8000 1.0000 2.0000 0.0000 Constraint 136 253 0.8000 1.0000 2.0000 0.0000 Constraint 136 247 0.8000 1.0000 2.0000 0.0000 Constraint 136 238 0.8000 1.0000 2.0000 0.0000 Constraint 136 232 0.8000 1.0000 2.0000 0.0000 Constraint 136 199 0.8000 1.0000 2.0000 0.0000 Constraint 136 191 0.8000 1.0000 2.0000 0.0000 Constraint 136 184 0.8000 1.0000 2.0000 0.0000 Constraint 136 173 0.8000 1.0000 2.0000 0.0000 Constraint 136 165 0.8000 1.0000 2.0000 0.0000 Constraint 136 157 0.8000 1.0000 2.0000 0.0000 Constraint 136 149 0.8000 1.0000 2.0000 0.0000 Constraint 136 143 0.8000 1.0000 2.0000 0.0000 Constraint 128 1051 0.8000 1.0000 2.0000 0.0000 Constraint 128 1033 0.8000 1.0000 2.0000 0.0000 Constraint 128 1026 0.8000 1.0000 2.0000 0.0000 Constraint 128 1019 0.8000 1.0000 2.0000 0.0000 Constraint 128 1011 0.8000 1.0000 2.0000 0.0000 Constraint 128 972 0.8000 1.0000 2.0000 0.0000 Constraint 128 960 0.8000 1.0000 2.0000 0.0000 Constraint 128 951 0.8000 1.0000 2.0000 0.0000 Constraint 128 943 0.8000 1.0000 2.0000 0.0000 Constraint 128 931 0.8000 1.0000 2.0000 0.0000 Constraint 128 919 0.8000 1.0000 2.0000 0.0000 Constraint 128 911 0.8000 1.0000 2.0000 0.0000 Constraint 128 901 0.8000 1.0000 2.0000 0.0000 Constraint 128 891 0.8000 1.0000 2.0000 0.0000 Constraint 128 883 0.8000 1.0000 2.0000 0.0000 Constraint 128 872 0.8000 1.0000 2.0000 0.0000 Constraint 128 866 0.8000 1.0000 2.0000 0.0000 Constraint 128 857 0.8000 1.0000 2.0000 0.0000 Constraint 128 849 0.8000 1.0000 2.0000 0.0000 Constraint 128 840 0.8000 1.0000 2.0000 0.0000 Constraint 128 827 0.8000 1.0000 2.0000 0.0000 Constraint 128 822 0.8000 1.0000 2.0000 0.0000 Constraint 128 814 0.8000 1.0000 2.0000 0.0000 Constraint 128 808 0.8000 1.0000 2.0000 0.0000 Constraint 128 801 0.8000 1.0000 2.0000 0.0000 Constraint 128 792 0.8000 1.0000 2.0000 0.0000 Constraint 128 784 0.8000 1.0000 2.0000 0.0000 Constraint 128 776 0.8000 1.0000 2.0000 0.0000 Constraint 128 768 0.8000 1.0000 2.0000 0.0000 Constraint 128 761 0.8000 1.0000 2.0000 0.0000 Constraint 128 751 0.8000 1.0000 2.0000 0.0000 Constraint 128 743 0.8000 1.0000 2.0000 0.0000 Constraint 128 735 0.8000 1.0000 2.0000 0.0000 Constraint 128 727 0.8000 1.0000 2.0000 0.0000 Constraint 128 719 0.8000 1.0000 2.0000 0.0000 Constraint 128 711 0.8000 1.0000 2.0000 0.0000 Constraint 128 706 0.8000 1.0000 2.0000 0.0000 Constraint 128 698 0.8000 1.0000 2.0000 0.0000 Constraint 128 690 0.8000 1.0000 2.0000 0.0000 Constraint 128 682 0.8000 1.0000 2.0000 0.0000 Constraint 128 674 0.8000 1.0000 2.0000 0.0000 Constraint 128 667 0.8000 1.0000 2.0000 0.0000 Constraint 128 659 0.8000 1.0000 2.0000 0.0000 Constraint 128 650 0.8000 1.0000 2.0000 0.0000 Constraint 128 633 0.8000 1.0000 2.0000 0.0000 Constraint 128 627 0.8000 1.0000 2.0000 0.0000 Constraint 128 621 0.8000 1.0000 2.0000 0.0000 Constraint 128 614 0.8000 1.0000 2.0000 0.0000 Constraint 128 603 0.8000 1.0000 2.0000 0.0000 Constraint 128 597 0.8000 1.0000 2.0000 0.0000 Constraint 128 590 0.8000 1.0000 2.0000 0.0000 Constraint 128 560 0.8000 1.0000 2.0000 0.0000 Constraint 128 552 0.8000 1.0000 2.0000 0.0000 Constraint 128 547 0.8000 1.0000 2.0000 0.0000 Constraint 128 539 0.8000 1.0000 2.0000 0.0000 Constraint 128 531 0.8000 1.0000 2.0000 0.0000 Constraint 128 519 0.8000 1.0000 2.0000 0.0000 Constraint 128 510 0.8000 1.0000 2.0000 0.0000 Constraint 128 505 0.8000 1.0000 2.0000 0.0000 Constraint 128 500 0.8000 1.0000 2.0000 0.0000 Constraint 128 493 0.8000 1.0000 2.0000 0.0000 Constraint 128 486 0.8000 1.0000 2.0000 0.0000 Constraint 128 478 0.8000 1.0000 2.0000 0.0000 Constraint 128 471 0.8000 1.0000 2.0000 0.0000 Constraint 128 466 0.8000 1.0000 2.0000 0.0000 Constraint 128 459 0.8000 1.0000 2.0000 0.0000 Constraint 128 445 0.8000 1.0000 2.0000 0.0000 Constraint 128 437 0.8000 1.0000 2.0000 0.0000 Constraint 128 430 0.8000 1.0000 2.0000 0.0000 Constraint 128 419 0.8000 1.0000 2.0000 0.0000 Constraint 128 411 0.8000 1.0000 2.0000 0.0000 Constraint 128 404 0.8000 1.0000 2.0000 0.0000 Constraint 128 396 0.8000 1.0000 2.0000 0.0000 Constraint 128 388 0.8000 1.0000 2.0000 0.0000 Constraint 128 380 0.8000 1.0000 2.0000 0.0000 Constraint 128 372 0.8000 1.0000 2.0000 0.0000 Constraint 128 361 0.8000 1.0000 2.0000 0.0000 Constraint 128 352 0.8000 1.0000 2.0000 0.0000 Constraint 128 326 0.8000 1.0000 2.0000 0.0000 Constraint 128 317 0.8000 1.0000 2.0000 0.0000 Constraint 128 309 0.8000 1.0000 2.0000 0.0000 Constraint 128 303 0.8000 1.0000 2.0000 0.0000 Constraint 128 294 0.8000 1.0000 2.0000 0.0000 Constraint 128 286 0.8000 1.0000 2.0000 0.0000 Constraint 128 247 0.8000 1.0000 2.0000 0.0000 Constraint 128 238 0.8000 1.0000 2.0000 0.0000 Constraint 128 232 0.8000 1.0000 2.0000 0.0000 Constraint 128 191 0.8000 1.0000 2.0000 0.0000 Constraint 128 184 0.8000 1.0000 2.0000 0.0000 Constraint 128 173 0.8000 1.0000 2.0000 0.0000 Constraint 128 165 0.8000 1.0000 2.0000 0.0000 Constraint 128 157 0.8000 1.0000 2.0000 0.0000 Constraint 128 149 0.8000 1.0000 2.0000 0.0000 Constraint 128 143 0.8000 1.0000 2.0000 0.0000 Constraint 128 136 0.8000 1.0000 2.0000 0.0000 Constraint 122 1051 0.8000 1.0000 2.0000 0.0000 Constraint 122 1043 0.8000 1.0000 2.0000 0.0000 Constraint 122 1033 0.8000 1.0000 2.0000 0.0000 Constraint 122 1026 0.8000 1.0000 2.0000 0.0000 Constraint 122 1019 0.8000 1.0000 2.0000 0.0000 Constraint 122 987 0.8000 1.0000 2.0000 0.0000 Constraint 122 980 0.8000 1.0000 2.0000 0.0000 Constraint 122 972 0.8000 1.0000 2.0000 0.0000 Constraint 122 960 0.8000 1.0000 2.0000 0.0000 Constraint 122 951 0.8000 1.0000 2.0000 0.0000 Constraint 122 943 0.8000 1.0000 2.0000 0.0000 Constraint 122 931 0.8000 1.0000 2.0000 0.0000 Constraint 122 919 0.8000 1.0000 2.0000 0.0000 Constraint 122 911 0.8000 1.0000 2.0000 0.0000 Constraint 122 901 0.8000 1.0000 2.0000 0.0000 Constraint 122 891 0.8000 1.0000 2.0000 0.0000 Constraint 122 883 0.8000 1.0000 2.0000 0.0000 Constraint 122 872 0.8000 1.0000 2.0000 0.0000 Constraint 122 866 0.8000 1.0000 2.0000 0.0000 Constraint 122 857 0.8000 1.0000 2.0000 0.0000 Constraint 122 849 0.8000 1.0000 2.0000 0.0000 Constraint 122 840 0.8000 1.0000 2.0000 0.0000 Constraint 122 827 0.8000 1.0000 2.0000 0.0000 Constraint 122 822 0.8000 1.0000 2.0000 0.0000 Constraint 122 814 0.8000 1.0000 2.0000 0.0000 Constraint 122 808 0.8000 1.0000 2.0000 0.0000 Constraint 122 801 0.8000 1.0000 2.0000 0.0000 Constraint 122 792 0.8000 1.0000 2.0000 0.0000 Constraint 122 784 0.8000 1.0000 2.0000 0.0000 Constraint 122 776 0.8000 1.0000 2.0000 0.0000 Constraint 122 768 0.8000 1.0000 2.0000 0.0000 Constraint 122 761 0.8000 1.0000 2.0000 0.0000 Constraint 122 751 0.8000 1.0000 2.0000 0.0000 Constraint 122 743 0.8000 1.0000 2.0000 0.0000 Constraint 122 735 0.8000 1.0000 2.0000 0.0000 Constraint 122 727 0.8000 1.0000 2.0000 0.0000 Constraint 122 719 0.8000 1.0000 2.0000 0.0000 Constraint 122 711 0.8000 1.0000 2.0000 0.0000 Constraint 122 706 0.8000 1.0000 2.0000 0.0000 Constraint 122 698 0.8000 1.0000 2.0000 0.0000 Constraint 122 690 0.8000 1.0000 2.0000 0.0000 Constraint 122 682 0.8000 1.0000 2.0000 0.0000 Constraint 122 674 0.8000 1.0000 2.0000 0.0000 Constraint 122 667 0.8000 1.0000 2.0000 0.0000 Constraint 122 659 0.8000 1.0000 2.0000 0.0000 Constraint 122 650 0.8000 1.0000 2.0000 0.0000 Constraint 122 641 0.8000 1.0000 2.0000 0.0000 Constraint 122 633 0.8000 1.0000 2.0000 0.0000 Constraint 122 627 0.8000 1.0000 2.0000 0.0000 Constraint 122 621 0.8000 1.0000 2.0000 0.0000 Constraint 122 614 0.8000 1.0000 2.0000 0.0000 Constraint 122 603 0.8000 1.0000 2.0000 0.0000 Constraint 122 597 0.8000 1.0000 2.0000 0.0000 Constraint 122 590 0.8000 1.0000 2.0000 0.0000 Constraint 122 574 0.8000 1.0000 2.0000 0.0000 Constraint 122 539 0.8000 1.0000 2.0000 0.0000 Constraint 122 531 0.8000 1.0000 2.0000 0.0000 Constraint 122 519 0.8000 1.0000 2.0000 0.0000 Constraint 122 510 0.8000 1.0000 2.0000 0.0000 Constraint 122 505 0.8000 1.0000 2.0000 0.0000 Constraint 122 500 0.8000 1.0000 2.0000 0.0000 Constraint 122 493 0.8000 1.0000 2.0000 0.0000 Constraint 122 486 0.8000 1.0000 2.0000 0.0000 Constraint 122 478 0.8000 1.0000 2.0000 0.0000 Constraint 122 471 0.8000 1.0000 2.0000 0.0000 Constraint 122 466 0.8000 1.0000 2.0000 0.0000 Constraint 122 459 0.8000 1.0000 2.0000 0.0000 Constraint 122 445 0.8000 1.0000 2.0000 0.0000 Constraint 122 437 0.8000 1.0000 2.0000 0.0000 Constraint 122 411 0.8000 1.0000 2.0000 0.0000 Constraint 122 404 0.8000 1.0000 2.0000 0.0000 Constraint 122 388 0.8000 1.0000 2.0000 0.0000 Constraint 122 380 0.8000 1.0000 2.0000 0.0000 Constraint 122 352 0.8000 1.0000 2.0000 0.0000 Constraint 122 309 0.8000 1.0000 2.0000 0.0000 Constraint 122 303 0.8000 1.0000 2.0000 0.0000 Constraint 122 294 0.8000 1.0000 2.0000 0.0000 Constraint 122 247 0.8000 1.0000 2.0000 0.0000 Constraint 122 238 0.8000 1.0000 2.0000 0.0000 Constraint 122 184 0.8000 1.0000 2.0000 0.0000 Constraint 122 173 0.8000 1.0000 2.0000 0.0000 Constraint 122 165 0.8000 1.0000 2.0000 0.0000 Constraint 122 157 0.8000 1.0000 2.0000 0.0000 Constraint 122 149 0.8000 1.0000 2.0000 0.0000 Constraint 122 143 0.8000 1.0000 2.0000 0.0000 Constraint 122 136 0.8000 1.0000 2.0000 0.0000 Constraint 122 128 0.8000 1.0000 2.0000 0.0000 Constraint 117 1051 0.8000 1.0000 2.0000 0.0000 Constraint 117 1043 0.8000 1.0000 2.0000 0.0000 Constraint 117 1033 0.8000 1.0000 2.0000 0.0000 Constraint 117 1026 0.8000 1.0000 2.0000 0.0000 Constraint 117 1019 0.8000 1.0000 2.0000 0.0000 Constraint 117 1011 0.8000 1.0000 2.0000 0.0000 Constraint 117 1003 0.8000 1.0000 2.0000 0.0000 Constraint 117 995 0.8000 1.0000 2.0000 0.0000 Constraint 117 987 0.8000 1.0000 2.0000 0.0000 Constraint 117 980 0.8000 1.0000 2.0000 0.0000 Constraint 117 972 0.8000 1.0000 2.0000 0.0000 Constraint 117 960 0.8000 1.0000 2.0000 0.0000 Constraint 117 951 0.8000 1.0000 2.0000 0.0000 Constraint 117 943 0.8000 1.0000 2.0000 0.0000 Constraint 117 931 0.8000 1.0000 2.0000 0.0000 Constraint 117 919 0.8000 1.0000 2.0000 0.0000 Constraint 117 911 0.8000 1.0000 2.0000 0.0000 Constraint 117 901 0.8000 1.0000 2.0000 0.0000 Constraint 117 891 0.8000 1.0000 2.0000 0.0000 Constraint 117 883 0.8000 1.0000 2.0000 0.0000 Constraint 117 872 0.8000 1.0000 2.0000 0.0000 Constraint 117 866 0.8000 1.0000 2.0000 0.0000 Constraint 117 857 0.8000 1.0000 2.0000 0.0000 Constraint 117 849 0.8000 1.0000 2.0000 0.0000 Constraint 117 840 0.8000 1.0000 2.0000 0.0000 Constraint 117 827 0.8000 1.0000 2.0000 0.0000 Constraint 117 822 0.8000 1.0000 2.0000 0.0000 Constraint 117 814 0.8000 1.0000 2.0000 0.0000 Constraint 117 808 0.8000 1.0000 2.0000 0.0000 Constraint 117 801 0.8000 1.0000 2.0000 0.0000 Constraint 117 792 0.8000 1.0000 2.0000 0.0000 Constraint 117 784 0.8000 1.0000 2.0000 0.0000 Constraint 117 776 0.8000 1.0000 2.0000 0.0000 Constraint 117 768 0.8000 1.0000 2.0000 0.0000 Constraint 117 761 0.8000 1.0000 2.0000 0.0000 Constraint 117 751 0.8000 1.0000 2.0000 0.0000 Constraint 117 735 0.8000 1.0000 2.0000 0.0000 Constraint 117 727 0.8000 1.0000 2.0000 0.0000 Constraint 117 719 0.8000 1.0000 2.0000 0.0000 Constraint 117 706 0.8000 1.0000 2.0000 0.0000 Constraint 117 698 0.8000 1.0000 2.0000 0.0000 Constraint 117 690 0.8000 1.0000 2.0000 0.0000 Constraint 117 682 0.8000 1.0000 2.0000 0.0000 Constraint 117 674 0.8000 1.0000 2.0000 0.0000 Constraint 117 667 0.8000 1.0000 2.0000 0.0000 Constraint 117 659 0.8000 1.0000 2.0000 0.0000 Constraint 117 650 0.8000 1.0000 2.0000 0.0000 Constraint 117 641 0.8000 1.0000 2.0000 0.0000 Constraint 117 633 0.8000 1.0000 2.0000 0.0000 Constraint 117 627 0.8000 1.0000 2.0000 0.0000 Constraint 117 621 0.8000 1.0000 2.0000 0.0000 Constraint 117 614 0.8000 1.0000 2.0000 0.0000 Constraint 117 597 0.8000 1.0000 2.0000 0.0000 Constraint 117 590 0.8000 1.0000 2.0000 0.0000 Constraint 117 581 0.8000 1.0000 2.0000 0.0000 Constraint 117 574 0.8000 1.0000 2.0000 0.0000 Constraint 117 560 0.8000 1.0000 2.0000 0.0000 Constraint 117 539 0.8000 1.0000 2.0000 0.0000 Constraint 117 531 0.8000 1.0000 2.0000 0.0000 Constraint 117 519 0.8000 1.0000 2.0000 0.0000 Constraint 117 510 0.8000 1.0000 2.0000 0.0000 Constraint 117 505 0.8000 1.0000 2.0000 0.0000 Constraint 117 500 0.8000 1.0000 2.0000 0.0000 Constraint 117 493 0.8000 1.0000 2.0000 0.0000 Constraint 117 486 0.8000 1.0000 2.0000 0.0000 Constraint 117 478 0.8000 1.0000 2.0000 0.0000 Constraint 117 471 0.8000 1.0000 2.0000 0.0000 Constraint 117 466 0.8000 1.0000 2.0000 0.0000 Constraint 117 459 0.8000 1.0000 2.0000 0.0000 Constraint 117 445 0.8000 1.0000 2.0000 0.0000 Constraint 117 437 0.8000 1.0000 2.0000 0.0000 Constraint 117 430 0.8000 1.0000 2.0000 0.0000 Constraint 117 419 0.8000 1.0000 2.0000 0.0000 Constraint 117 411 0.8000 1.0000 2.0000 0.0000 Constraint 117 404 0.8000 1.0000 2.0000 0.0000 Constraint 117 396 0.8000 1.0000 2.0000 0.0000 Constraint 117 388 0.8000 1.0000 2.0000 0.0000 Constraint 117 380 0.8000 1.0000 2.0000 0.0000 Constraint 117 372 0.8000 1.0000 2.0000 0.0000 Constraint 117 361 0.8000 1.0000 2.0000 0.0000 Constraint 117 352 0.8000 1.0000 2.0000 0.0000 Constraint 117 326 0.8000 1.0000 2.0000 0.0000 Constraint 117 317 0.8000 1.0000 2.0000 0.0000 Constraint 117 294 0.8000 1.0000 2.0000 0.0000 Constraint 117 270 0.8000 1.0000 2.0000 0.0000 Constraint 117 238 0.8000 1.0000 2.0000 0.0000 Constraint 117 220 0.8000 1.0000 2.0000 0.0000 Constraint 117 173 0.8000 1.0000 2.0000 0.0000 Constraint 117 165 0.8000 1.0000 2.0000 0.0000 Constraint 117 157 0.8000 1.0000 2.0000 0.0000 Constraint 117 149 0.8000 1.0000 2.0000 0.0000 Constraint 117 143 0.8000 1.0000 2.0000 0.0000 Constraint 117 136 0.8000 1.0000 2.0000 0.0000 Constraint 117 128 0.8000 1.0000 2.0000 0.0000 Constraint 117 122 0.8000 1.0000 2.0000 0.0000 Constraint 108 1051 0.8000 1.0000 2.0000 0.0000 Constraint 108 1043 0.8000 1.0000 2.0000 0.0000 Constraint 108 1033 0.8000 1.0000 2.0000 0.0000 Constraint 108 1026 0.8000 1.0000 2.0000 0.0000 Constraint 108 1019 0.8000 1.0000 2.0000 0.0000 Constraint 108 1011 0.8000 1.0000 2.0000 0.0000 Constraint 108 1003 0.8000 1.0000 2.0000 0.0000 Constraint 108 995 0.8000 1.0000 2.0000 0.0000 Constraint 108 987 0.8000 1.0000 2.0000 0.0000 Constraint 108 980 0.8000 1.0000 2.0000 0.0000 Constraint 108 972 0.8000 1.0000 2.0000 0.0000 Constraint 108 960 0.8000 1.0000 2.0000 0.0000 Constraint 108 951 0.8000 1.0000 2.0000 0.0000 Constraint 108 943 0.8000 1.0000 2.0000 0.0000 Constraint 108 931 0.8000 1.0000 2.0000 0.0000 Constraint 108 919 0.8000 1.0000 2.0000 0.0000 Constraint 108 911 0.8000 1.0000 2.0000 0.0000 Constraint 108 901 0.8000 1.0000 2.0000 0.0000 Constraint 108 891 0.8000 1.0000 2.0000 0.0000 Constraint 108 883 0.8000 1.0000 2.0000 0.0000 Constraint 108 872 0.8000 1.0000 2.0000 0.0000 Constraint 108 866 0.8000 1.0000 2.0000 0.0000 Constraint 108 857 0.8000 1.0000 2.0000 0.0000 Constraint 108 849 0.8000 1.0000 2.0000 0.0000 Constraint 108 840 0.8000 1.0000 2.0000 0.0000 Constraint 108 827 0.8000 1.0000 2.0000 0.0000 Constraint 108 822 0.8000 1.0000 2.0000 0.0000 Constraint 108 814 0.8000 1.0000 2.0000 0.0000 Constraint 108 808 0.8000 1.0000 2.0000 0.0000 Constraint 108 801 0.8000 1.0000 2.0000 0.0000 Constraint 108 792 0.8000 1.0000 2.0000 0.0000 Constraint 108 784 0.8000 1.0000 2.0000 0.0000 Constraint 108 776 0.8000 1.0000 2.0000 0.0000 Constraint 108 768 0.8000 1.0000 2.0000 0.0000 Constraint 108 761 0.8000 1.0000 2.0000 0.0000 Constraint 108 751 0.8000 1.0000 2.0000 0.0000 Constraint 108 743 0.8000 1.0000 2.0000 0.0000 Constraint 108 735 0.8000 1.0000 2.0000 0.0000 Constraint 108 727 0.8000 1.0000 2.0000 0.0000 Constraint 108 719 0.8000 1.0000 2.0000 0.0000 Constraint 108 711 0.8000 1.0000 2.0000 0.0000 Constraint 108 706 0.8000 1.0000 2.0000 0.0000 Constraint 108 698 0.8000 1.0000 2.0000 0.0000 Constraint 108 690 0.8000 1.0000 2.0000 0.0000 Constraint 108 682 0.8000 1.0000 2.0000 0.0000 Constraint 108 674 0.8000 1.0000 2.0000 0.0000 Constraint 108 667 0.8000 1.0000 2.0000 0.0000 Constraint 108 659 0.8000 1.0000 2.0000 0.0000 Constraint 108 650 0.8000 1.0000 2.0000 0.0000 Constraint 108 641 0.8000 1.0000 2.0000 0.0000 Constraint 108 633 0.8000 1.0000 2.0000 0.0000 Constraint 108 627 0.8000 1.0000 2.0000 0.0000 Constraint 108 621 0.8000 1.0000 2.0000 0.0000 Constraint 108 614 0.8000 1.0000 2.0000 0.0000 Constraint 108 590 0.8000 1.0000 2.0000 0.0000 Constraint 108 581 0.8000 1.0000 2.0000 0.0000 Constraint 108 574 0.8000 1.0000 2.0000 0.0000 Constraint 108 567 0.8000 1.0000 2.0000 0.0000 Constraint 108 560 0.8000 1.0000 2.0000 0.0000 Constraint 108 531 0.8000 1.0000 2.0000 0.0000 Constraint 108 505 0.8000 1.0000 2.0000 0.0000 Constraint 108 500 0.8000 1.0000 2.0000 0.0000 Constraint 108 493 0.8000 1.0000 2.0000 0.0000 Constraint 108 486 0.8000 1.0000 2.0000 0.0000 Constraint 108 478 0.8000 1.0000 2.0000 0.0000 Constraint 108 471 0.8000 1.0000 2.0000 0.0000 Constraint 108 466 0.8000 1.0000 2.0000 0.0000 Constraint 108 459 0.8000 1.0000 2.0000 0.0000 Constraint 108 437 0.8000 1.0000 2.0000 0.0000 Constraint 108 419 0.8000 1.0000 2.0000 0.0000 Constraint 108 411 0.8000 1.0000 2.0000 0.0000 Constraint 108 388 0.8000 1.0000 2.0000 0.0000 Constraint 108 380 0.8000 1.0000 2.0000 0.0000 Constraint 108 372 0.8000 1.0000 2.0000 0.0000 Constraint 108 303 0.8000 1.0000 2.0000 0.0000 Constraint 108 270 0.8000 1.0000 2.0000 0.0000 Constraint 108 165 0.8000 1.0000 2.0000 0.0000 Constraint 108 157 0.8000 1.0000 2.0000 0.0000 Constraint 108 149 0.8000 1.0000 2.0000 0.0000 Constraint 108 143 0.8000 1.0000 2.0000 0.0000 Constraint 108 136 0.8000 1.0000 2.0000 0.0000 Constraint 108 128 0.8000 1.0000 2.0000 0.0000 Constraint 108 122 0.8000 1.0000 2.0000 0.0000 Constraint 108 117 0.8000 1.0000 2.0000 0.0000 Constraint 101 1051 0.8000 1.0000 2.0000 0.0000 Constraint 101 1043 0.8000 1.0000 2.0000 0.0000 Constraint 101 1033 0.8000 1.0000 2.0000 0.0000 Constraint 101 1026 0.8000 1.0000 2.0000 0.0000 Constraint 101 1019 0.8000 1.0000 2.0000 0.0000 Constraint 101 1011 0.8000 1.0000 2.0000 0.0000 Constraint 101 1003 0.8000 1.0000 2.0000 0.0000 Constraint 101 995 0.8000 1.0000 2.0000 0.0000 Constraint 101 987 0.8000 1.0000 2.0000 0.0000 Constraint 101 980 0.8000 1.0000 2.0000 0.0000 Constraint 101 972 0.8000 1.0000 2.0000 0.0000 Constraint 101 960 0.8000 1.0000 2.0000 0.0000 Constraint 101 951 0.8000 1.0000 2.0000 0.0000 Constraint 101 943 0.8000 1.0000 2.0000 0.0000 Constraint 101 931 0.8000 1.0000 2.0000 0.0000 Constraint 101 919 0.8000 1.0000 2.0000 0.0000 Constraint 101 911 0.8000 1.0000 2.0000 0.0000 Constraint 101 901 0.8000 1.0000 2.0000 0.0000 Constraint 101 891 0.8000 1.0000 2.0000 0.0000 Constraint 101 883 0.8000 1.0000 2.0000 0.0000 Constraint 101 872 0.8000 1.0000 2.0000 0.0000 Constraint 101 866 0.8000 1.0000 2.0000 0.0000 Constraint 101 857 0.8000 1.0000 2.0000 0.0000 Constraint 101 849 0.8000 1.0000 2.0000 0.0000 Constraint 101 840 0.8000 1.0000 2.0000 0.0000 Constraint 101 827 0.8000 1.0000 2.0000 0.0000 Constraint 101 822 0.8000 1.0000 2.0000 0.0000 Constraint 101 814 0.8000 1.0000 2.0000 0.0000 Constraint 101 808 0.8000 1.0000 2.0000 0.0000 Constraint 101 801 0.8000 1.0000 2.0000 0.0000 Constraint 101 792 0.8000 1.0000 2.0000 0.0000 Constraint 101 784 0.8000 1.0000 2.0000 0.0000 Constraint 101 776 0.8000 1.0000 2.0000 0.0000 Constraint 101 768 0.8000 1.0000 2.0000 0.0000 Constraint 101 761 0.8000 1.0000 2.0000 0.0000 Constraint 101 751 0.8000 1.0000 2.0000 0.0000 Constraint 101 743 0.8000 1.0000 2.0000 0.0000 Constraint 101 735 0.8000 1.0000 2.0000 0.0000 Constraint 101 727 0.8000 1.0000 2.0000 0.0000 Constraint 101 719 0.8000 1.0000 2.0000 0.0000 Constraint 101 711 0.8000 1.0000 2.0000 0.0000 Constraint 101 706 0.8000 1.0000 2.0000 0.0000 Constraint 101 698 0.8000 1.0000 2.0000 0.0000 Constraint 101 690 0.8000 1.0000 2.0000 0.0000 Constraint 101 682 0.8000 1.0000 2.0000 0.0000 Constraint 101 674 0.8000 1.0000 2.0000 0.0000 Constraint 101 667 0.8000 1.0000 2.0000 0.0000 Constraint 101 659 0.8000 1.0000 2.0000 0.0000 Constraint 101 650 0.8000 1.0000 2.0000 0.0000 Constraint 101 641 0.8000 1.0000 2.0000 0.0000 Constraint 101 633 0.8000 1.0000 2.0000 0.0000 Constraint 101 627 0.8000 1.0000 2.0000 0.0000 Constraint 101 621 0.8000 1.0000 2.0000 0.0000 Constraint 101 614 0.8000 1.0000 2.0000 0.0000 Constraint 101 603 0.8000 1.0000 2.0000 0.0000 Constraint 101 590 0.8000 1.0000 2.0000 0.0000 Constraint 101 581 0.8000 1.0000 2.0000 0.0000 Constraint 101 574 0.8000 1.0000 2.0000 0.0000 Constraint 101 567 0.8000 1.0000 2.0000 0.0000 Constraint 101 560 0.8000 1.0000 2.0000 0.0000 Constraint 101 519 0.8000 1.0000 2.0000 0.0000 Constraint 101 510 0.8000 1.0000 2.0000 0.0000 Constraint 101 505 0.8000 1.0000 2.0000 0.0000 Constraint 101 500 0.8000 1.0000 2.0000 0.0000 Constraint 101 493 0.8000 1.0000 2.0000 0.0000 Constraint 101 486 0.8000 1.0000 2.0000 0.0000 Constraint 101 478 0.8000 1.0000 2.0000 0.0000 Constraint 101 471 0.8000 1.0000 2.0000 0.0000 Constraint 101 466 0.8000 1.0000 2.0000 0.0000 Constraint 101 459 0.8000 1.0000 2.0000 0.0000 Constraint 101 445 0.8000 1.0000 2.0000 0.0000 Constraint 101 437 0.8000 1.0000 2.0000 0.0000 Constraint 101 430 0.8000 1.0000 2.0000 0.0000 Constraint 101 419 0.8000 1.0000 2.0000 0.0000 Constraint 101 411 0.8000 1.0000 2.0000 0.0000 Constraint 101 404 0.8000 1.0000 2.0000 0.0000 Constraint 101 396 0.8000 1.0000 2.0000 0.0000 Constraint 101 388 0.8000 1.0000 2.0000 0.0000 Constraint 101 380 0.8000 1.0000 2.0000 0.0000 Constraint 101 372 0.8000 1.0000 2.0000 0.0000 Constraint 101 361 0.8000 1.0000 2.0000 0.0000 Constraint 101 352 0.8000 1.0000 2.0000 0.0000 Constraint 101 345 0.8000 1.0000 2.0000 0.0000 Constraint 101 326 0.8000 1.0000 2.0000 0.0000 Constraint 101 317 0.8000 1.0000 2.0000 0.0000 Constraint 101 303 0.8000 1.0000 2.0000 0.0000 Constraint 101 294 0.8000 1.0000 2.0000 0.0000 Constraint 101 286 0.8000 1.0000 2.0000 0.0000 Constraint 101 277 0.8000 1.0000 2.0000 0.0000 Constraint 101 270 0.8000 1.0000 2.0000 0.0000 Constraint 101 262 0.8000 1.0000 2.0000 0.0000 Constraint 101 253 0.8000 1.0000 2.0000 0.0000 Constraint 101 220 0.8000 1.0000 2.0000 0.0000 Constraint 101 208 0.8000 1.0000 2.0000 0.0000 Constraint 101 199 0.8000 1.0000 2.0000 0.0000 Constraint 101 191 0.8000 1.0000 2.0000 0.0000 Constraint 101 157 0.8000 1.0000 2.0000 0.0000 Constraint 101 149 0.8000 1.0000 2.0000 0.0000 Constraint 101 143 0.8000 1.0000 2.0000 0.0000 Constraint 101 136 0.8000 1.0000 2.0000 0.0000 Constraint 101 128 0.8000 1.0000 2.0000 0.0000 Constraint 101 122 0.8000 1.0000 2.0000 0.0000 Constraint 101 117 0.8000 1.0000 2.0000 0.0000 Constraint 101 108 0.8000 1.0000 2.0000 0.0000 Constraint 95 1051 0.8000 1.0000 2.0000 0.0000 Constraint 95 1043 0.8000 1.0000 2.0000 0.0000 Constraint 95 1033 0.8000 1.0000 2.0000 0.0000 Constraint 95 1026 0.8000 1.0000 2.0000 0.0000 Constraint 95 1019 0.8000 1.0000 2.0000 0.0000 Constraint 95 1011 0.8000 1.0000 2.0000 0.0000 Constraint 95 1003 0.8000 1.0000 2.0000 0.0000 Constraint 95 995 0.8000 1.0000 2.0000 0.0000 Constraint 95 987 0.8000 1.0000 2.0000 0.0000 Constraint 95 980 0.8000 1.0000 2.0000 0.0000 Constraint 95 972 0.8000 1.0000 2.0000 0.0000 Constraint 95 960 0.8000 1.0000 2.0000 0.0000 Constraint 95 951 0.8000 1.0000 2.0000 0.0000 Constraint 95 943 0.8000 1.0000 2.0000 0.0000 Constraint 95 931 0.8000 1.0000 2.0000 0.0000 Constraint 95 919 0.8000 1.0000 2.0000 0.0000 Constraint 95 911 0.8000 1.0000 2.0000 0.0000 Constraint 95 901 0.8000 1.0000 2.0000 0.0000 Constraint 95 891 0.8000 1.0000 2.0000 0.0000 Constraint 95 883 0.8000 1.0000 2.0000 0.0000 Constraint 95 872 0.8000 1.0000 2.0000 0.0000 Constraint 95 866 0.8000 1.0000 2.0000 0.0000 Constraint 95 857 0.8000 1.0000 2.0000 0.0000 Constraint 95 849 0.8000 1.0000 2.0000 0.0000 Constraint 95 840 0.8000 1.0000 2.0000 0.0000 Constraint 95 827 0.8000 1.0000 2.0000 0.0000 Constraint 95 822 0.8000 1.0000 2.0000 0.0000 Constraint 95 814 0.8000 1.0000 2.0000 0.0000 Constraint 95 808 0.8000 1.0000 2.0000 0.0000 Constraint 95 801 0.8000 1.0000 2.0000 0.0000 Constraint 95 792 0.8000 1.0000 2.0000 0.0000 Constraint 95 784 0.8000 1.0000 2.0000 0.0000 Constraint 95 776 0.8000 1.0000 2.0000 0.0000 Constraint 95 768 0.8000 1.0000 2.0000 0.0000 Constraint 95 761 0.8000 1.0000 2.0000 0.0000 Constraint 95 751 0.8000 1.0000 2.0000 0.0000 Constraint 95 743 0.8000 1.0000 2.0000 0.0000 Constraint 95 735 0.8000 1.0000 2.0000 0.0000 Constraint 95 727 0.8000 1.0000 2.0000 0.0000 Constraint 95 719 0.8000 1.0000 2.0000 0.0000 Constraint 95 711 0.8000 1.0000 2.0000 0.0000 Constraint 95 706 0.8000 1.0000 2.0000 0.0000 Constraint 95 698 0.8000 1.0000 2.0000 0.0000 Constraint 95 690 0.8000 1.0000 2.0000 0.0000 Constraint 95 682 0.8000 1.0000 2.0000 0.0000 Constraint 95 674 0.8000 1.0000 2.0000 0.0000 Constraint 95 667 0.8000 1.0000 2.0000 0.0000 Constraint 95 659 0.8000 1.0000 2.0000 0.0000 Constraint 95 650 0.8000 1.0000 2.0000 0.0000 Constraint 95 641 0.8000 1.0000 2.0000 0.0000 Constraint 95 633 0.8000 1.0000 2.0000 0.0000 Constraint 95 627 0.8000 1.0000 2.0000 0.0000 Constraint 95 621 0.8000 1.0000 2.0000 0.0000 Constraint 95 614 0.8000 1.0000 2.0000 0.0000 Constraint 95 603 0.8000 1.0000 2.0000 0.0000 Constraint 95 597 0.8000 1.0000 2.0000 0.0000 Constraint 95 590 0.8000 1.0000 2.0000 0.0000 Constraint 95 581 0.8000 1.0000 2.0000 0.0000 Constraint 95 574 0.8000 1.0000 2.0000 0.0000 Constraint 95 567 0.8000 1.0000 2.0000 0.0000 Constraint 95 560 0.8000 1.0000 2.0000 0.0000 Constraint 95 552 0.8000 1.0000 2.0000 0.0000 Constraint 95 547 0.8000 1.0000 2.0000 0.0000 Constraint 95 539 0.8000 1.0000 2.0000 0.0000 Constraint 95 519 0.8000 1.0000 2.0000 0.0000 Constraint 95 510 0.8000 1.0000 2.0000 0.0000 Constraint 95 505 0.8000 1.0000 2.0000 0.0000 Constraint 95 500 0.8000 1.0000 2.0000 0.0000 Constraint 95 493 0.8000 1.0000 2.0000 0.0000 Constraint 95 486 0.8000 1.0000 2.0000 0.0000 Constraint 95 478 0.8000 1.0000 2.0000 0.0000 Constraint 95 471 0.8000 1.0000 2.0000 0.0000 Constraint 95 466 0.8000 1.0000 2.0000 0.0000 Constraint 95 459 0.8000 1.0000 2.0000 0.0000 Constraint 95 445 0.8000 1.0000 2.0000 0.0000 Constraint 95 437 0.8000 1.0000 2.0000 0.0000 Constraint 95 430 0.8000 1.0000 2.0000 0.0000 Constraint 95 419 0.8000 1.0000 2.0000 0.0000 Constraint 95 411 0.8000 1.0000 2.0000 0.0000 Constraint 95 404 0.8000 1.0000 2.0000 0.0000 Constraint 95 396 0.8000 1.0000 2.0000 0.0000 Constraint 95 388 0.8000 1.0000 2.0000 0.0000 Constraint 95 380 0.8000 1.0000 2.0000 0.0000 Constraint 95 372 0.8000 1.0000 2.0000 0.0000 Constraint 95 345 0.8000 1.0000 2.0000 0.0000 Constraint 95 326 0.8000 1.0000 2.0000 0.0000 Constraint 95 317 0.8000 1.0000 2.0000 0.0000 Constraint 95 309 0.8000 1.0000 2.0000 0.0000 Constraint 95 303 0.8000 1.0000 2.0000 0.0000 Constraint 95 294 0.8000 1.0000 2.0000 0.0000 Constraint 95 286 0.8000 1.0000 2.0000 0.0000 Constraint 95 277 0.8000 1.0000 2.0000 0.0000 Constraint 95 270 0.8000 1.0000 2.0000 0.0000 Constraint 95 262 0.8000 1.0000 2.0000 0.0000 Constraint 95 253 0.8000 1.0000 2.0000 0.0000 Constraint 95 232 0.8000 1.0000 2.0000 0.0000 Constraint 95 220 0.8000 1.0000 2.0000 0.0000 Constraint 95 208 0.8000 1.0000 2.0000 0.0000 Constraint 95 191 0.8000 1.0000 2.0000 0.0000 Constraint 95 165 0.8000 1.0000 2.0000 0.0000 Constraint 95 157 0.8000 1.0000 2.0000 0.0000 Constraint 95 149 0.8000 1.0000 2.0000 0.0000 Constraint 95 143 0.8000 1.0000 2.0000 0.0000 Constraint 95 136 0.8000 1.0000 2.0000 0.0000 Constraint 95 128 0.8000 1.0000 2.0000 0.0000 Constraint 95 122 0.8000 1.0000 2.0000 0.0000 Constraint 95 117 0.8000 1.0000 2.0000 0.0000 Constraint 95 108 0.8000 1.0000 2.0000 0.0000 Constraint 95 101 0.8000 1.0000 2.0000 0.0000 Constraint 89 1051 0.8000 1.0000 2.0000 0.0000 Constraint 89 1043 0.8000 1.0000 2.0000 0.0000 Constraint 89 1033 0.8000 1.0000 2.0000 0.0000 Constraint 89 1026 0.8000 1.0000 2.0000 0.0000 Constraint 89 1019 0.8000 1.0000 2.0000 0.0000 Constraint 89 1011 0.8000 1.0000 2.0000 0.0000 Constraint 89 1003 0.8000 1.0000 2.0000 0.0000 Constraint 89 995 0.8000 1.0000 2.0000 0.0000 Constraint 89 987 0.8000 1.0000 2.0000 0.0000 Constraint 89 980 0.8000 1.0000 2.0000 0.0000 Constraint 89 972 0.8000 1.0000 2.0000 0.0000 Constraint 89 960 0.8000 1.0000 2.0000 0.0000 Constraint 89 951 0.8000 1.0000 2.0000 0.0000 Constraint 89 943 0.8000 1.0000 2.0000 0.0000 Constraint 89 931 0.8000 1.0000 2.0000 0.0000 Constraint 89 919 0.8000 1.0000 2.0000 0.0000 Constraint 89 911 0.8000 1.0000 2.0000 0.0000 Constraint 89 901 0.8000 1.0000 2.0000 0.0000 Constraint 89 891 0.8000 1.0000 2.0000 0.0000 Constraint 89 883 0.8000 1.0000 2.0000 0.0000 Constraint 89 872 0.8000 1.0000 2.0000 0.0000 Constraint 89 866 0.8000 1.0000 2.0000 0.0000 Constraint 89 857 0.8000 1.0000 2.0000 0.0000 Constraint 89 849 0.8000 1.0000 2.0000 0.0000 Constraint 89 840 0.8000 1.0000 2.0000 0.0000 Constraint 89 827 0.8000 1.0000 2.0000 0.0000 Constraint 89 822 0.8000 1.0000 2.0000 0.0000 Constraint 89 814 0.8000 1.0000 2.0000 0.0000 Constraint 89 808 0.8000 1.0000 2.0000 0.0000 Constraint 89 801 0.8000 1.0000 2.0000 0.0000 Constraint 89 792 0.8000 1.0000 2.0000 0.0000 Constraint 89 784 0.8000 1.0000 2.0000 0.0000 Constraint 89 776 0.8000 1.0000 2.0000 0.0000 Constraint 89 768 0.8000 1.0000 2.0000 0.0000 Constraint 89 761 0.8000 1.0000 2.0000 0.0000 Constraint 89 751 0.8000 1.0000 2.0000 0.0000 Constraint 89 735 0.8000 1.0000 2.0000 0.0000 Constraint 89 727 0.8000 1.0000 2.0000 0.0000 Constraint 89 719 0.8000 1.0000 2.0000 0.0000 Constraint 89 711 0.8000 1.0000 2.0000 0.0000 Constraint 89 706 0.8000 1.0000 2.0000 0.0000 Constraint 89 698 0.8000 1.0000 2.0000 0.0000 Constraint 89 690 0.8000 1.0000 2.0000 0.0000 Constraint 89 682 0.8000 1.0000 2.0000 0.0000 Constraint 89 674 0.8000 1.0000 2.0000 0.0000 Constraint 89 667 0.8000 1.0000 2.0000 0.0000 Constraint 89 633 0.8000 1.0000 2.0000 0.0000 Constraint 89 627 0.8000 1.0000 2.0000 0.0000 Constraint 89 621 0.8000 1.0000 2.0000 0.0000 Constraint 89 614 0.8000 1.0000 2.0000 0.0000 Constraint 89 603 0.8000 1.0000 2.0000 0.0000 Constraint 89 597 0.8000 1.0000 2.0000 0.0000 Constraint 89 590 0.8000 1.0000 2.0000 0.0000 Constraint 89 581 0.8000 1.0000 2.0000 0.0000 Constraint 89 574 0.8000 1.0000 2.0000 0.0000 Constraint 89 567 0.8000 1.0000 2.0000 0.0000 Constraint 89 560 0.8000 1.0000 2.0000 0.0000 Constraint 89 552 0.8000 1.0000 2.0000 0.0000 Constraint 89 547 0.8000 1.0000 2.0000 0.0000 Constraint 89 539 0.8000 1.0000 2.0000 0.0000 Constraint 89 531 0.8000 1.0000 2.0000 0.0000 Constraint 89 519 0.8000 1.0000 2.0000 0.0000 Constraint 89 510 0.8000 1.0000 2.0000 0.0000 Constraint 89 505 0.8000 1.0000 2.0000 0.0000 Constraint 89 500 0.8000 1.0000 2.0000 0.0000 Constraint 89 493 0.8000 1.0000 2.0000 0.0000 Constraint 89 486 0.8000 1.0000 2.0000 0.0000 Constraint 89 478 0.8000 1.0000 2.0000 0.0000 Constraint 89 471 0.8000 1.0000 2.0000 0.0000 Constraint 89 466 0.8000 1.0000 2.0000 0.0000 Constraint 89 459 0.8000 1.0000 2.0000 0.0000 Constraint 89 445 0.8000 1.0000 2.0000 0.0000 Constraint 89 437 0.8000 1.0000 2.0000 0.0000 Constraint 89 430 0.8000 1.0000 2.0000 0.0000 Constraint 89 419 0.8000 1.0000 2.0000 0.0000 Constraint 89 411 0.8000 1.0000 2.0000 0.0000 Constraint 89 396 0.8000 1.0000 2.0000 0.0000 Constraint 89 388 0.8000 1.0000 2.0000 0.0000 Constraint 89 380 0.8000 1.0000 2.0000 0.0000 Constraint 89 361 0.8000 1.0000 2.0000 0.0000 Constraint 89 352 0.8000 1.0000 2.0000 0.0000 Constraint 89 345 0.8000 1.0000 2.0000 0.0000 Constraint 89 326 0.8000 1.0000 2.0000 0.0000 Constraint 89 317 0.8000 1.0000 2.0000 0.0000 Constraint 89 309 0.8000 1.0000 2.0000 0.0000 Constraint 89 303 0.8000 1.0000 2.0000 0.0000 Constraint 89 294 0.8000 1.0000 2.0000 0.0000 Constraint 89 286 0.8000 1.0000 2.0000 0.0000 Constraint 89 277 0.8000 1.0000 2.0000 0.0000 Constraint 89 270 0.8000 1.0000 2.0000 0.0000 Constraint 89 262 0.8000 1.0000 2.0000 0.0000 Constraint 89 253 0.8000 1.0000 2.0000 0.0000 Constraint 89 247 0.8000 1.0000 2.0000 0.0000 Constraint 89 232 0.8000 1.0000 2.0000 0.0000 Constraint 89 165 0.8000 1.0000 2.0000 0.0000 Constraint 89 157 0.8000 1.0000 2.0000 0.0000 Constraint 89 149 0.8000 1.0000 2.0000 0.0000 Constraint 89 143 0.8000 1.0000 2.0000 0.0000 Constraint 89 136 0.8000 1.0000 2.0000 0.0000 Constraint 89 128 0.8000 1.0000 2.0000 0.0000 Constraint 89 122 0.8000 1.0000 2.0000 0.0000 Constraint 89 117 0.8000 1.0000 2.0000 0.0000 Constraint 89 108 0.8000 1.0000 2.0000 0.0000 Constraint 89 101 0.8000 1.0000 2.0000 0.0000 Constraint 89 95 0.8000 1.0000 2.0000 0.0000 Constraint 80 1051 0.8000 1.0000 2.0000 0.0000 Constraint 80 1043 0.8000 1.0000 2.0000 0.0000 Constraint 80 1026 0.8000 1.0000 2.0000 0.0000 Constraint 80 1019 0.8000 1.0000 2.0000 0.0000 Constraint 80 1011 0.8000 1.0000 2.0000 0.0000 Constraint 80 1003 0.8000 1.0000 2.0000 0.0000 Constraint 80 995 0.8000 1.0000 2.0000 0.0000 Constraint 80 987 0.8000 1.0000 2.0000 0.0000 Constraint 80 980 0.8000 1.0000 2.0000 0.0000 Constraint 80 972 0.8000 1.0000 2.0000 0.0000 Constraint 80 960 0.8000 1.0000 2.0000 0.0000 Constraint 80 951 0.8000 1.0000 2.0000 0.0000 Constraint 80 943 0.8000 1.0000 2.0000 0.0000 Constraint 80 931 0.8000 1.0000 2.0000 0.0000 Constraint 80 919 0.8000 1.0000 2.0000 0.0000 Constraint 80 911 0.8000 1.0000 2.0000 0.0000 Constraint 80 901 0.8000 1.0000 2.0000 0.0000 Constraint 80 891 0.8000 1.0000 2.0000 0.0000 Constraint 80 883 0.8000 1.0000 2.0000 0.0000 Constraint 80 872 0.8000 1.0000 2.0000 0.0000 Constraint 80 866 0.8000 1.0000 2.0000 0.0000 Constraint 80 857 0.8000 1.0000 2.0000 0.0000 Constraint 80 849 0.8000 1.0000 2.0000 0.0000 Constraint 80 840 0.8000 1.0000 2.0000 0.0000 Constraint 80 827 0.8000 1.0000 2.0000 0.0000 Constraint 80 822 0.8000 1.0000 2.0000 0.0000 Constraint 80 814 0.8000 1.0000 2.0000 0.0000 Constraint 80 808 0.8000 1.0000 2.0000 0.0000 Constraint 80 801 0.8000 1.0000 2.0000 0.0000 Constraint 80 792 0.8000 1.0000 2.0000 0.0000 Constraint 80 784 0.8000 1.0000 2.0000 0.0000 Constraint 80 776 0.8000 1.0000 2.0000 0.0000 Constraint 80 768 0.8000 1.0000 2.0000 0.0000 Constraint 80 761 0.8000 1.0000 2.0000 0.0000 Constraint 80 751 0.8000 1.0000 2.0000 0.0000 Constraint 80 743 0.8000 1.0000 2.0000 0.0000 Constraint 80 735 0.8000 1.0000 2.0000 0.0000 Constraint 80 727 0.8000 1.0000 2.0000 0.0000 Constraint 80 719 0.8000 1.0000 2.0000 0.0000 Constraint 80 711 0.8000 1.0000 2.0000 0.0000 Constraint 80 706 0.8000 1.0000 2.0000 0.0000 Constraint 80 698 0.8000 1.0000 2.0000 0.0000 Constraint 80 690 0.8000 1.0000 2.0000 0.0000 Constraint 80 682 0.8000 1.0000 2.0000 0.0000 Constraint 80 674 0.8000 1.0000 2.0000 0.0000 Constraint 80 667 0.8000 1.0000 2.0000 0.0000 Constraint 80 659 0.8000 1.0000 2.0000 0.0000 Constraint 80 641 0.8000 1.0000 2.0000 0.0000 Constraint 80 633 0.8000 1.0000 2.0000 0.0000 Constraint 80 627 0.8000 1.0000 2.0000 0.0000 Constraint 80 621 0.8000 1.0000 2.0000 0.0000 Constraint 80 614 0.8000 1.0000 2.0000 0.0000 Constraint 80 603 0.8000 1.0000 2.0000 0.0000 Constraint 80 597 0.8000 1.0000 2.0000 0.0000 Constraint 80 590 0.8000 1.0000 2.0000 0.0000 Constraint 80 581 0.8000 1.0000 2.0000 0.0000 Constraint 80 574 0.8000 1.0000 2.0000 0.0000 Constraint 80 567 0.8000 1.0000 2.0000 0.0000 Constraint 80 560 0.8000 1.0000 2.0000 0.0000 Constraint 80 552 0.8000 1.0000 2.0000 0.0000 Constraint 80 547 0.8000 1.0000 2.0000 0.0000 Constraint 80 539 0.8000 1.0000 2.0000 0.0000 Constraint 80 531 0.8000 1.0000 2.0000 0.0000 Constraint 80 519 0.8000 1.0000 2.0000 0.0000 Constraint 80 510 0.8000 1.0000 2.0000 0.0000 Constraint 80 505 0.8000 1.0000 2.0000 0.0000 Constraint 80 500 0.8000 1.0000 2.0000 0.0000 Constraint 80 493 0.8000 1.0000 2.0000 0.0000 Constraint 80 486 0.8000 1.0000 2.0000 0.0000 Constraint 80 478 0.8000 1.0000 2.0000 0.0000 Constraint 80 471 0.8000 1.0000 2.0000 0.0000 Constraint 80 466 0.8000 1.0000 2.0000 0.0000 Constraint 80 459 0.8000 1.0000 2.0000 0.0000 Constraint 80 445 0.8000 1.0000 2.0000 0.0000 Constraint 80 437 0.8000 1.0000 2.0000 0.0000 Constraint 80 430 0.8000 1.0000 2.0000 0.0000 Constraint 80 419 0.8000 1.0000 2.0000 0.0000 Constraint 80 411 0.8000 1.0000 2.0000 0.0000 Constraint 80 404 0.8000 1.0000 2.0000 0.0000 Constraint 80 396 0.8000 1.0000 2.0000 0.0000 Constraint 80 388 0.8000 1.0000 2.0000 0.0000 Constraint 80 380 0.8000 1.0000 2.0000 0.0000 Constraint 80 326 0.8000 1.0000 2.0000 0.0000 Constraint 80 317 0.8000 1.0000 2.0000 0.0000 Constraint 80 309 0.8000 1.0000 2.0000 0.0000 Constraint 80 303 0.8000 1.0000 2.0000 0.0000 Constraint 80 294 0.8000 1.0000 2.0000 0.0000 Constraint 80 286 0.8000 1.0000 2.0000 0.0000 Constraint 80 277 0.8000 1.0000 2.0000 0.0000 Constraint 80 270 0.8000 1.0000 2.0000 0.0000 Constraint 80 262 0.8000 1.0000 2.0000 0.0000 Constraint 80 253 0.8000 1.0000 2.0000 0.0000 Constraint 80 247 0.8000 1.0000 2.0000 0.0000 Constraint 80 232 0.8000 1.0000 2.0000 0.0000 Constraint 80 184 0.8000 1.0000 2.0000 0.0000 Constraint 80 173 0.8000 1.0000 2.0000 0.0000 Constraint 80 165 0.8000 1.0000 2.0000 0.0000 Constraint 80 157 0.8000 1.0000 2.0000 0.0000 Constraint 80 149 0.8000 1.0000 2.0000 0.0000 Constraint 80 143 0.8000 1.0000 2.0000 0.0000 Constraint 80 136 0.8000 1.0000 2.0000 0.0000 Constraint 80 128 0.8000 1.0000 2.0000 0.0000 Constraint 80 122 0.8000 1.0000 2.0000 0.0000 Constraint 80 117 0.8000 1.0000 2.0000 0.0000 Constraint 80 108 0.8000 1.0000 2.0000 0.0000 Constraint 80 101 0.8000 1.0000 2.0000 0.0000 Constraint 80 95 0.8000 1.0000 2.0000 0.0000 Constraint 80 89 0.8000 1.0000 2.0000 0.0000 Constraint 72 1051 0.8000 1.0000 2.0000 0.0000 Constraint 72 1043 0.8000 1.0000 2.0000 0.0000 Constraint 72 1026 0.8000 1.0000 2.0000 0.0000 Constraint 72 1019 0.8000 1.0000 2.0000 0.0000 Constraint 72 1011 0.8000 1.0000 2.0000 0.0000 Constraint 72 1003 0.8000 1.0000 2.0000 0.0000 Constraint 72 995 0.8000 1.0000 2.0000 0.0000 Constraint 72 987 0.8000 1.0000 2.0000 0.0000 Constraint 72 980 0.8000 1.0000 2.0000 0.0000 Constraint 72 972 0.8000 1.0000 2.0000 0.0000 Constraint 72 960 0.8000 1.0000 2.0000 0.0000 Constraint 72 951 0.8000 1.0000 2.0000 0.0000 Constraint 72 943 0.8000 1.0000 2.0000 0.0000 Constraint 72 931 0.8000 1.0000 2.0000 0.0000 Constraint 72 919 0.8000 1.0000 2.0000 0.0000 Constraint 72 911 0.8000 1.0000 2.0000 0.0000 Constraint 72 901 0.8000 1.0000 2.0000 0.0000 Constraint 72 891 0.8000 1.0000 2.0000 0.0000 Constraint 72 883 0.8000 1.0000 2.0000 0.0000 Constraint 72 872 0.8000 1.0000 2.0000 0.0000 Constraint 72 866 0.8000 1.0000 2.0000 0.0000 Constraint 72 857 0.8000 1.0000 2.0000 0.0000 Constraint 72 849 0.8000 1.0000 2.0000 0.0000 Constraint 72 840 0.8000 1.0000 2.0000 0.0000 Constraint 72 827 0.8000 1.0000 2.0000 0.0000 Constraint 72 822 0.8000 1.0000 2.0000 0.0000 Constraint 72 814 0.8000 1.0000 2.0000 0.0000 Constraint 72 808 0.8000 1.0000 2.0000 0.0000 Constraint 72 801 0.8000 1.0000 2.0000 0.0000 Constraint 72 792 0.8000 1.0000 2.0000 0.0000 Constraint 72 784 0.8000 1.0000 2.0000 0.0000 Constraint 72 776 0.8000 1.0000 2.0000 0.0000 Constraint 72 768 0.8000 1.0000 2.0000 0.0000 Constraint 72 761 0.8000 1.0000 2.0000 0.0000 Constraint 72 751 0.8000 1.0000 2.0000 0.0000 Constraint 72 743 0.8000 1.0000 2.0000 0.0000 Constraint 72 735 0.8000 1.0000 2.0000 0.0000 Constraint 72 727 0.8000 1.0000 2.0000 0.0000 Constraint 72 719 0.8000 1.0000 2.0000 0.0000 Constraint 72 711 0.8000 1.0000 2.0000 0.0000 Constraint 72 706 0.8000 1.0000 2.0000 0.0000 Constraint 72 698 0.8000 1.0000 2.0000 0.0000 Constraint 72 690 0.8000 1.0000 2.0000 0.0000 Constraint 72 682 0.8000 1.0000 2.0000 0.0000 Constraint 72 674 0.8000 1.0000 2.0000 0.0000 Constraint 72 667 0.8000 1.0000 2.0000 0.0000 Constraint 72 659 0.8000 1.0000 2.0000 0.0000 Constraint 72 621 0.8000 1.0000 2.0000 0.0000 Constraint 72 614 0.8000 1.0000 2.0000 0.0000 Constraint 72 603 0.8000 1.0000 2.0000 0.0000 Constraint 72 597 0.8000 1.0000 2.0000 0.0000 Constraint 72 590 0.8000 1.0000 2.0000 0.0000 Constraint 72 581 0.8000 1.0000 2.0000 0.0000 Constraint 72 574 0.8000 1.0000 2.0000 0.0000 Constraint 72 567 0.8000 1.0000 2.0000 0.0000 Constraint 72 560 0.8000 1.0000 2.0000 0.0000 Constraint 72 552 0.8000 1.0000 2.0000 0.0000 Constraint 72 547 0.8000 1.0000 2.0000 0.0000 Constraint 72 539 0.8000 1.0000 2.0000 0.0000 Constraint 72 531 0.8000 1.0000 2.0000 0.0000 Constraint 72 519 0.8000 1.0000 2.0000 0.0000 Constraint 72 510 0.8000 1.0000 2.0000 0.0000 Constraint 72 505 0.8000 1.0000 2.0000 0.0000 Constraint 72 500 0.8000 1.0000 2.0000 0.0000 Constraint 72 493 0.8000 1.0000 2.0000 0.0000 Constraint 72 486 0.8000 1.0000 2.0000 0.0000 Constraint 72 478 0.8000 1.0000 2.0000 0.0000 Constraint 72 466 0.8000 1.0000 2.0000 0.0000 Constraint 72 459 0.8000 1.0000 2.0000 0.0000 Constraint 72 445 0.8000 1.0000 2.0000 0.0000 Constraint 72 437 0.8000 1.0000 2.0000 0.0000 Constraint 72 430 0.8000 1.0000 2.0000 0.0000 Constraint 72 419 0.8000 1.0000 2.0000 0.0000 Constraint 72 411 0.8000 1.0000 2.0000 0.0000 Constraint 72 396 0.8000 1.0000 2.0000 0.0000 Constraint 72 388 0.8000 1.0000 2.0000 0.0000 Constraint 72 380 0.8000 1.0000 2.0000 0.0000 Constraint 72 352 0.8000 1.0000 2.0000 0.0000 Constraint 72 345 0.8000 1.0000 2.0000 0.0000 Constraint 72 337 0.8000 1.0000 2.0000 0.0000 Constraint 72 326 0.8000 1.0000 2.0000 0.0000 Constraint 72 317 0.8000 1.0000 2.0000 0.0000 Constraint 72 309 0.8000 1.0000 2.0000 0.0000 Constraint 72 303 0.8000 1.0000 2.0000 0.0000 Constraint 72 294 0.8000 1.0000 2.0000 0.0000 Constraint 72 286 0.8000 1.0000 2.0000 0.0000 Constraint 72 277 0.8000 1.0000 2.0000 0.0000 Constraint 72 270 0.8000 1.0000 2.0000 0.0000 Constraint 72 262 0.8000 1.0000 2.0000 0.0000 Constraint 72 253 0.8000 1.0000 2.0000 0.0000 Constraint 72 247 0.8000 1.0000 2.0000 0.0000 Constraint 72 232 0.8000 1.0000 2.0000 0.0000 Constraint 72 184 0.8000 1.0000 2.0000 0.0000 Constraint 72 173 0.8000 1.0000 2.0000 0.0000 Constraint 72 165 0.8000 1.0000 2.0000 0.0000 Constraint 72 157 0.8000 1.0000 2.0000 0.0000 Constraint 72 149 0.8000 1.0000 2.0000 0.0000 Constraint 72 143 0.8000 1.0000 2.0000 0.0000 Constraint 72 128 0.8000 1.0000 2.0000 0.0000 Constraint 72 122 0.8000 1.0000 2.0000 0.0000 Constraint 72 117 0.8000 1.0000 2.0000 0.0000 Constraint 72 108 0.8000 1.0000 2.0000 0.0000 Constraint 72 101 0.8000 1.0000 2.0000 0.0000 Constraint 72 95 0.8000 1.0000 2.0000 0.0000 Constraint 72 89 0.8000 1.0000 2.0000 0.0000 Constraint 72 80 0.8000 1.0000 2.0000 0.0000 Constraint 61 1051 0.8000 1.0000 2.0000 0.0000 Constraint 61 1043 0.8000 1.0000 2.0000 0.0000 Constraint 61 1033 0.8000 1.0000 2.0000 0.0000 Constraint 61 1026 0.8000 1.0000 2.0000 0.0000 Constraint 61 1019 0.8000 1.0000 2.0000 0.0000 Constraint 61 1011 0.8000 1.0000 2.0000 0.0000 Constraint 61 1003 0.8000 1.0000 2.0000 0.0000 Constraint 61 995 0.8000 1.0000 2.0000 0.0000 Constraint 61 987 0.8000 1.0000 2.0000 0.0000 Constraint 61 980 0.8000 1.0000 2.0000 0.0000 Constraint 61 972 0.8000 1.0000 2.0000 0.0000 Constraint 61 960 0.8000 1.0000 2.0000 0.0000 Constraint 61 951 0.8000 1.0000 2.0000 0.0000 Constraint 61 943 0.8000 1.0000 2.0000 0.0000 Constraint 61 931 0.8000 1.0000 2.0000 0.0000 Constraint 61 919 0.8000 1.0000 2.0000 0.0000 Constraint 61 911 0.8000 1.0000 2.0000 0.0000 Constraint 61 901 0.8000 1.0000 2.0000 0.0000 Constraint 61 891 0.8000 1.0000 2.0000 0.0000 Constraint 61 883 0.8000 1.0000 2.0000 0.0000 Constraint 61 872 0.8000 1.0000 2.0000 0.0000 Constraint 61 866 0.8000 1.0000 2.0000 0.0000 Constraint 61 857 0.8000 1.0000 2.0000 0.0000 Constraint 61 849 0.8000 1.0000 2.0000 0.0000 Constraint 61 840 0.8000 1.0000 2.0000 0.0000 Constraint 61 827 0.8000 1.0000 2.0000 0.0000 Constraint 61 822 0.8000 1.0000 2.0000 0.0000 Constraint 61 814 0.8000 1.0000 2.0000 0.0000 Constraint 61 808 0.8000 1.0000 2.0000 0.0000 Constraint 61 801 0.8000 1.0000 2.0000 0.0000 Constraint 61 792 0.8000 1.0000 2.0000 0.0000 Constraint 61 784 0.8000 1.0000 2.0000 0.0000 Constraint 61 776 0.8000 1.0000 2.0000 0.0000 Constraint 61 768 0.8000 1.0000 2.0000 0.0000 Constraint 61 761 0.8000 1.0000 2.0000 0.0000 Constraint 61 751 0.8000 1.0000 2.0000 0.0000 Constraint 61 743 0.8000 1.0000 2.0000 0.0000 Constraint 61 735 0.8000 1.0000 2.0000 0.0000 Constraint 61 727 0.8000 1.0000 2.0000 0.0000 Constraint 61 719 0.8000 1.0000 2.0000 0.0000 Constraint 61 711 0.8000 1.0000 2.0000 0.0000 Constraint 61 706 0.8000 1.0000 2.0000 0.0000 Constraint 61 698 0.8000 1.0000 2.0000 0.0000 Constraint 61 690 0.8000 1.0000 2.0000 0.0000 Constraint 61 682 0.8000 1.0000 2.0000 0.0000 Constraint 61 674 0.8000 1.0000 2.0000 0.0000 Constraint 61 667 0.8000 1.0000 2.0000 0.0000 Constraint 61 659 0.8000 1.0000 2.0000 0.0000 Constraint 61 614 0.8000 1.0000 2.0000 0.0000 Constraint 61 603 0.8000 1.0000 2.0000 0.0000 Constraint 61 597 0.8000 1.0000 2.0000 0.0000 Constraint 61 590 0.8000 1.0000 2.0000 0.0000 Constraint 61 581 0.8000 1.0000 2.0000 0.0000 Constraint 61 574 0.8000 1.0000 2.0000 0.0000 Constraint 61 567 0.8000 1.0000 2.0000 0.0000 Constraint 61 560 0.8000 1.0000 2.0000 0.0000 Constraint 61 552 0.8000 1.0000 2.0000 0.0000 Constraint 61 547 0.8000 1.0000 2.0000 0.0000 Constraint 61 531 0.8000 1.0000 2.0000 0.0000 Constraint 61 519 0.8000 1.0000 2.0000 0.0000 Constraint 61 510 0.8000 1.0000 2.0000 0.0000 Constraint 61 505 0.8000 1.0000 2.0000 0.0000 Constraint 61 500 0.8000 1.0000 2.0000 0.0000 Constraint 61 493 0.8000 1.0000 2.0000 0.0000 Constraint 61 486 0.8000 1.0000 2.0000 0.0000 Constraint 61 478 0.8000 1.0000 2.0000 0.0000 Constraint 61 471 0.8000 1.0000 2.0000 0.0000 Constraint 61 466 0.8000 1.0000 2.0000 0.0000 Constraint 61 459 0.8000 1.0000 2.0000 0.0000 Constraint 61 445 0.8000 1.0000 2.0000 0.0000 Constraint 61 437 0.8000 1.0000 2.0000 0.0000 Constraint 61 430 0.8000 1.0000 2.0000 0.0000 Constraint 61 419 0.8000 1.0000 2.0000 0.0000 Constraint 61 411 0.8000 1.0000 2.0000 0.0000 Constraint 61 404 0.8000 1.0000 2.0000 0.0000 Constraint 61 388 0.8000 1.0000 2.0000 0.0000 Constraint 61 380 0.8000 1.0000 2.0000 0.0000 Constraint 61 352 0.8000 1.0000 2.0000 0.0000 Constraint 61 345 0.8000 1.0000 2.0000 0.0000 Constraint 61 337 0.8000 1.0000 2.0000 0.0000 Constraint 61 326 0.8000 1.0000 2.0000 0.0000 Constraint 61 317 0.8000 1.0000 2.0000 0.0000 Constraint 61 309 0.8000 1.0000 2.0000 0.0000 Constraint 61 303 0.8000 1.0000 2.0000 0.0000 Constraint 61 294 0.8000 1.0000 2.0000 0.0000 Constraint 61 286 0.8000 1.0000 2.0000 0.0000 Constraint 61 270 0.8000 1.0000 2.0000 0.0000 Constraint 61 253 0.8000 1.0000 2.0000 0.0000 Constraint 61 247 0.8000 1.0000 2.0000 0.0000 Constraint 61 199 0.8000 1.0000 2.0000 0.0000 Constraint 61 191 0.8000 1.0000 2.0000 0.0000 Constraint 61 184 0.8000 1.0000 2.0000 0.0000 Constraint 61 165 0.8000 1.0000 2.0000 0.0000 Constraint 61 149 0.8000 1.0000 2.0000 0.0000 Constraint 61 143 0.8000 1.0000 2.0000 0.0000 Constraint 61 136 0.8000 1.0000 2.0000 0.0000 Constraint 61 128 0.8000 1.0000 2.0000 0.0000 Constraint 61 122 0.8000 1.0000 2.0000 0.0000 Constraint 61 117 0.8000 1.0000 2.0000 0.0000 Constraint 61 108 0.8000 1.0000 2.0000 0.0000 Constraint 61 101 0.8000 1.0000 2.0000 0.0000 Constraint 61 95 0.8000 1.0000 2.0000 0.0000 Constraint 61 89 0.8000 1.0000 2.0000 0.0000 Constraint 61 80 0.8000 1.0000 2.0000 0.0000 Constraint 61 72 0.8000 1.0000 2.0000 0.0000 Constraint 53 1051 0.8000 1.0000 2.0000 0.0000 Constraint 53 1043 0.8000 1.0000 2.0000 0.0000 Constraint 53 1026 0.8000 1.0000 2.0000 0.0000 Constraint 53 1019 0.8000 1.0000 2.0000 0.0000 Constraint 53 1011 0.8000 1.0000 2.0000 0.0000 Constraint 53 1003 0.8000 1.0000 2.0000 0.0000 Constraint 53 995 0.8000 1.0000 2.0000 0.0000 Constraint 53 987 0.8000 1.0000 2.0000 0.0000 Constraint 53 980 0.8000 1.0000 2.0000 0.0000 Constraint 53 972 0.8000 1.0000 2.0000 0.0000 Constraint 53 960 0.8000 1.0000 2.0000 0.0000 Constraint 53 951 0.8000 1.0000 2.0000 0.0000 Constraint 53 943 0.8000 1.0000 2.0000 0.0000 Constraint 53 931 0.8000 1.0000 2.0000 0.0000 Constraint 53 919 0.8000 1.0000 2.0000 0.0000 Constraint 53 911 0.8000 1.0000 2.0000 0.0000 Constraint 53 901 0.8000 1.0000 2.0000 0.0000 Constraint 53 891 0.8000 1.0000 2.0000 0.0000 Constraint 53 883 0.8000 1.0000 2.0000 0.0000 Constraint 53 872 0.8000 1.0000 2.0000 0.0000 Constraint 53 866 0.8000 1.0000 2.0000 0.0000 Constraint 53 857 0.8000 1.0000 2.0000 0.0000 Constraint 53 849 0.8000 1.0000 2.0000 0.0000 Constraint 53 840 0.8000 1.0000 2.0000 0.0000 Constraint 53 827 0.8000 1.0000 2.0000 0.0000 Constraint 53 822 0.8000 1.0000 2.0000 0.0000 Constraint 53 814 0.8000 1.0000 2.0000 0.0000 Constraint 53 808 0.8000 1.0000 2.0000 0.0000 Constraint 53 801 0.8000 1.0000 2.0000 0.0000 Constraint 53 792 0.8000 1.0000 2.0000 0.0000 Constraint 53 784 0.8000 1.0000 2.0000 0.0000 Constraint 53 776 0.8000 1.0000 2.0000 0.0000 Constraint 53 768 0.8000 1.0000 2.0000 0.0000 Constraint 53 761 0.8000 1.0000 2.0000 0.0000 Constraint 53 751 0.8000 1.0000 2.0000 0.0000 Constraint 53 743 0.8000 1.0000 2.0000 0.0000 Constraint 53 735 0.8000 1.0000 2.0000 0.0000 Constraint 53 727 0.8000 1.0000 2.0000 0.0000 Constraint 53 719 0.8000 1.0000 2.0000 0.0000 Constraint 53 711 0.8000 1.0000 2.0000 0.0000 Constraint 53 706 0.8000 1.0000 2.0000 0.0000 Constraint 53 698 0.8000 1.0000 2.0000 0.0000 Constraint 53 690 0.8000 1.0000 2.0000 0.0000 Constraint 53 682 0.8000 1.0000 2.0000 0.0000 Constraint 53 674 0.8000 1.0000 2.0000 0.0000 Constraint 53 667 0.8000 1.0000 2.0000 0.0000 Constraint 53 659 0.8000 1.0000 2.0000 0.0000 Constraint 53 650 0.8000 1.0000 2.0000 0.0000 Constraint 53 641 0.8000 1.0000 2.0000 0.0000 Constraint 53 614 0.8000 1.0000 2.0000 0.0000 Constraint 53 597 0.8000 1.0000 2.0000 0.0000 Constraint 53 590 0.8000 1.0000 2.0000 0.0000 Constraint 53 581 0.8000 1.0000 2.0000 0.0000 Constraint 53 574 0.8000 1.0000 2.0000 0.0000 Constraint 53 567 0.8000 1.0000 2.0000 0.0000 Constraint 53 560 0.8000 1.0000 2.0000 0.0000 Constraint 53 552 0.8000 1.0000 2.0000 0.0000 Constraint 53 547 0.8000 1.0000 2.0000 0.0000 Constraint 53 539 0.8000 1.0000 2.0000 0.0000 Constraint 53 519 0.8000 1.0000 2.0000 0.0000 Constraint 53 510 0.8000 1.0000 2.0000 0.0000 Constraint 53 505 0.8000 1.0000 2.0000 0.0000 Constraint 53 486 0.8000 1.0000 2.0000 0.0000 Constraint 53 478 0.8000 1.0000 2.0000 0.0000 Constraint 53 466 0.8000 1.0000 2.0000 0.0000 Constraint 53 459 0.8000 1.0000 2.0000 0.0000 Constraint 53 445 0.8000 1.0000 2.0000 0.0000 Constraint 53 437 0.8000 1.0000 2.0000 0.0000 Constraint 53 430 0.8000 1.0000 2.0000 0.0000 Constraint 53 419 0.8000 1.0000 2.0000 0.0000 Constraint 53 411 0.8000 1.0000 2.0000 0.0000 Constraint 53 404 0.8000 1.0000 2.0000 0.0000 Constraint 53 396 0.8000 1.0000 2.0000 0.0000 Constraint 53 388 0.8000 1.0000 2.0000 0.0000 Constraint 53 380 0.8000 1.0000 2.0000 0.0000 Constraint 53 361 0.8000 1.0000 2.0000 0.0000 Constraint 53 352 0.8000 1.0000 2.0000 0.0000 Constraint 53 345 0.8000 1.0000 2.0000 0.0000 Constraint 53 337 0.8000 1.0000 2.0000 0.0000 Constraint 53 326 0.8000 1.0000 2.0000 0.0000 Constraint 53 317 0.8000 1.0000 2.0000 0.0000 Constraint 53 309 0.8000 1.0000 2.0000 0.0000 Constraint 53 303 0.8000 1.0000 2.0000 0.0000 Constraint 53 294 0.8000 1.0000 2.0000 0.0000 Constraint 53 286 0.8000 1.0000 2.0000 0.0000 Constraint 53 277 0.8000 1.0000 2.0000 0.0000 Constraint 53 270 0.8000 1.0000 2.0000 0.0000 Constraint 53 262 0.8000 1.0000 2.0000 0.0000 Constraint 53 253 0.8000 1.0000 2.0000 0.0000 Constraint 53 247 0.8000 1.0000 2.0000 0.0000 Constraint 53 208 0.8000 1.0000 2.0000 0.0000 Constraint 53 199 0.8000 1.0000 2.0000 0.0000 Constraint 53 191 0.8000 1.0000 2.0000 0.0000 Constraint 53 184 0.8000 1.0000 2.0000 0.0000 Constraint 53 173 0.8000 1.0000 2.0000 0.0000 Constraint 53 165 0.8000 1.0000 2.0000 0.0000 Constraint 53 157 0.8000 1.0000 2.0000 0.0000 Constraint 53 149 0.8000 1.0000 2.0000 0.0000 Constraint 53 143 0.8000 1.0000 2.0000 0.0000 Constraint 53 136 0.8000 1.0000 2.0000 0.0000 Constraint 53 128 0.8000 1.0000 2.0000 0.0000 Constraint 53 122 0.8000 1.0000 2.0000 0.0000 Constraint 53 117 0.8000 1.0000 2.0000 0.0000 Constraint 53 108 0.8000 1.0000 2.0000 0.0000 Constraint 53 101 0.8000 1.0000 2.0000 0.0000 Constraint 53 95 0.8000 1.0000 2.0000 0.0000 Constraint 53 89 0.8000 1.0000 2.0000 0.0000 Constraint 53 80 0.8000 1.0000 2.0000 0.0000 Constraint 53 72 0.8000 1.0000 2.0000 0.0000 Constraint 53 61 0.8000 1.0000 2.0000 0.0000 Constraint 46 1051 0.8000 1.0000 2.0000 0.0000 Constraint 46 1043 0.8000 1.0000 2.0000 0.0000 Constraint 46 1033 0.8000 1.0000 2.0000 0.0000 Constraint 46 1026 0.8000 1.0000 2.0000 0.0000 Constraint 46 1019 0.8000 1.0000 2.0000 0.0000 Constraint 46 1011 0.8000 1.0000 2.0000 0.0000 Constraint 46 1003 0.8000 1.0000 2.0000 0.0000 Constraint 46 995 0.8000 1.0000 2.0000 0.0000 Constraint 46 987 0.8000 1.0000 2.0000 0.0000 Constraint 46 980 0.8000 1.0000 2.0000 0.0000 Constraint 46 972 0.8000 1.0000 2.0000 0.0000 Constraint 46 960 0.8000 1.0000 2.0000 0.0000 Constraint 46 951 0.8000 1.0000 2.0000 0.0000 Constraint 46 943 0.8000 1.0000 2.0000 0.0000 Constraint 46 931 0.8000 1.0000 2.0000 0.0000 Constraint 46 919 0.8000 1.0000 2.0000 0.0000 Constraint 46 911 0.8000 1.0000 2.0000 0.0000 Constraint 46 901 0.8000 1.0000 2.0000 0.0000 Constraint 46 891 0.8000 1.0000 2.0000 0.0000 Constraint 46 883 0.8000 1.0000 2.0000 0.0000 Constraint 46 872 0.8000 1.0000 2.0000 0.0000 Constraint 46 866 0.8000 1.0000 2.0000 0.0000 Constraint 46 857 0.8000 1.0000 2.0000 0.0000 Constraint 46 849 0.8000 1.0000 2.0000 0.0000 Constraint 46 840 0.8000 1.0000 2.0000 0.0000 Constraint 46 827 0.8000 1.0000 2.0000 0.0000 Constraint 46 822 0.8000 1.0000 2.0000 0.0000 Constraint 46 814 0.8000 1.0000 2.0000 0.0000 Constraint 46 808 0.8000 1.0000 2.0000 0.0000 Constraint 46 801 0.8000 1.0000 2.0000 0.0000 Constraint 46 792 0.8000 1.0000 2.0000 0.0000 Constraint 46 784 0.8000 1.0000 2.0000 0.0000 Constraint 46 776 0.8000 1.0000 2.0000 0.0000 Constraint 46 768 0.8000 1.0000 2.0000 0.0000 Constraint 46 761 0.8000 1.0000 2.0000 0.0000 Constraint 46 751 0.8000 1.0000 2.0000 0.0000 Constraint 46 743 0.8000 1.0000 2.0000 0.0000 Constraint 46 735 0.8000 1.0000 2.0000 0.0000 Constraint 46 727 0.8000 1.0000 2.0000 0.0000 Constraint 46 719 0.8000 1.0000 2.0000 0.0000 Constraint 46 711 0.8000 1.0000 2.0000 0.0000 Constraint 46 706 0.8000 1.0000 2.0000 0.0000 Constraint 46 698 0.8000 1.0000 2.0000 0.0000 Constraint 46 690 0.8000 1.0000 2.0000 0.0000 Constraint 46 682 0.8000 1.0000 2.0000 0.0000 Constraint 46 674 0.8000 1.0000 2.0000 0.0000 Constraint 46 667 0.8000 1.0000 2.0000 0.0000 Constraint 46 659 0.8000 1.0000 2.0000 0.0000 Constraint 46 650 0.8000 1.0000 2.0000 0.0000 Constraint 46 641 0.8000 1.0000 2.0000 0.0000 Constraint 46 597 0.8000 1.0000 2.0000 0.0000 Constraint 46 590 0.8000 1.0000 2.0000 0.0000 Constraint 46 581 0.8000 1.0000 2.0000 0.0000 Constraint 46 574 0.8000 1.0000 2.0000 0.0000 Constraint 46 567 0.8000 1.0000 2.0000 0.0000 Constraint 46 560 0.8000 1.0000 2.0000 0.0000 Constraint 46 552 0.8000 1.0000 2.0000 0.0000 Constraint 46 547 0.8000 1.0000 2.0000 0.0000 Constraint 46 539 0.8000 1.0000 2.0000 0.0000 Constraint 46 531 0.8000 1.0000 2.0000 0.0000 Constraint 46 519 0.8000 1.0000 2.0000 0.0000 Constraint 46 510 0.8000 1.0000 2.0000 0.0000 Constraint 46 505 0.8000 1.0000 2.0000 0.0000 Constraint 46 500 0.8000 1.0000 2.0000 0.0000 Constraint 46 493 0.8000 1.0000 2.0000 0.0000 Constraint 46 486 0.8000 1.0000 2.0000 0.0000 Constraint 46 478 0.8000 1.0000 2.0000 0.0000 Constraint 46 471 0.8000 1.0000 2.0000 0.0000 Constraint 46 466 0.8000 1.0000 2.0000 0.0000 Constraint 46 459 0.8000 1.0000 2.0000 0.0000 Constraint 46 445 0.8000 1.0000 2.0000 0.0000 Constraint 46 437 0.8000 1.0000 2.0000 0.0000 Constraint 46 419 0.8000 1.0000 2.0000 0.0000 Constraint 46 411 0.8000 1.0000 2.0000 0.0000 Constraint 46 388 0.8000 1.0000 2.0000 0.0000 Constraint 46 380 0.8000 1.0000 2.0000 0.0000 Constraint 46 361 0.8000 1.0000 2.0000 0.0000 Constraint 46 352 0.8000 1.0000 2.0000 0.0000 Constraint 46 345 0.8000 1.0000 2.0000 0.0000 Constraint 46 337 0.8000 1.0000 2.0000 0.0000 Constraint 46 326 0.8000 1.0000 2.0000 0.0000 Constraint 46 317 0.8000 1.0000 2.0000 0.0000 Constraint 46 309 0.8000 1.0000 2.0000 0.0000 Constraint 46 303 0.8000 1.0000 2.0000 0.0000 Constraint 46 294 0.8000 1.0000 2.0000 0.0000 Constraint 46 286 0.8000 1.0000 2.0000 0.0000 Constraint 46 277 0.8000 1.0000 2.0000 0.0000 Constraint 46 270 0.8000 1.0000 2.0000 0.0000 Constraint 46 262 0.8000 1.0000 2.0000 0.0000 Constraint 46 253 0.8000 1.0000 2.0000 0.0000 Constraint 46 247 0.8000 1.0000 2.0000 0.0000 Constraint 46 238 0.8000 1.0000 2.0000 0.0000 Constraint 46 232 0.8000 1.0000 2.0000 0.0000 Constraint 46 220 0.8000 1.0000 2.0000 0.0000 Constraint 46 208 0.8000 1.0000 2.0000 0.0000 Constraint 46 199 0.8000 1.0000 2.0000 0.0000 Constraint 46 191 0.8000 1.0000 2.0000 0.0000 Constraint 46 184 0.8000 1.0000 2.0000 0.0000 Constraint 46 173 0.8000 1.0000 2.0000 0.0000 Constraint 46 165 0.8000 1.0000 2.0000 0.0000 Constraint 46 157 0.8000 1.0000 2.0000 0.0000 Constraint 46 149 0.8000 1.0000 2.0000 0.0000 Constraint 46 143 0.8000 1.0000 2.0000 0.0000 Constraint 46 136 0.8000 1.0000 2.0000 0.0000 Constraint 46 128 0.8000 1.0000 2.0000 0.0000 Constraint 46 122 0.8000 1.0000 2.0000 0.0000 Constraint 46 117 0.8000 1.0000 2.0000 0.0000 Constraint 46 108 0.8000 1.0000 2.0000 0.0000 Constraint 46 101 0.8000 1.0000 2.0000 0.0000 Constraint 46 95 0.8000 1.0000 2.0000 0.0000 Constraint 46 89 0.8000 1.0000 2.0000 0.0000 Constraint 46 80 0.8000 1.0000 2.0000 0.0000 Constraint 46 72 0.8000 1.0000 2.0000 0.0000 Constraint 46 61 0.8000 1.0000 2.0000 0.0000 Constraint 46 53 0.8000 1.0000 2.0000 0.0000 Constraint 39 1051 0.8000 1.0000 2.0000 0.0000 Constraint 39 1043 0.8000 1.0000 2.0000 0.0000 Constraint 39 1033 0.8000 1.0000 2.0000 0.0000 Constraint 39 1026 0.8000 1.0000 2.0000 0.0000 Constraint 39 1019 0.8000 1.0000 2.0000 0.0000 Constraint 39 1011 0.8000 1.0000 2.0000 0.0000 Constraint 39 1003 0.8000 1.0000 2.0000 0.0000 Constraint 39 995 0.8000 1.0000 2.0000 0.0000 Constraint 39 987 0.8000 1.0000 2.0000 0.0000 Constraint 39 980 0.8000 1.0000 2.0000 0.0000 Constraint 39 972 0.8000 1.0000 2.0000 0.0000 Constraint 39 960 0.8000 1.0000 2.0000 0.0000 Constraint 39 951 0.8000 1.0000 2.0000 0.0000 Constraint 39 943 0.8000 1.0000 2.0000 0.0000 Constraint 39 931 0.8000 1.0000 2.0000 0.0000 Constraint 39 919 0.8000 1.0000 2.0000 0.0000 Constraint 39 911 0.8000 1.0000 2.0000 0.0000 Constraint 39 901 0.8000 1.0000 2.0000 0.0000 Constraint 39 891 0.8000 1.0000 2.0000 0.0000 Constraint 39 883 0.8000 1.0000 2.0000 0.0000 Constraint 39 872 0.8000 1.0000 2.0000 0.0000 Constraint 39 866 0.8000 1.0000 2.0000 0.0000 Constraint 39 857 0.8000 1.0000 2.0000 0.0000 Constraint 39 849 0.8000 1.0000 2.0000 0.0000 Constraint 39 840 0.8000 1.0000 2.0000 0.0000 Constraint 39 827 0.8000 1.0000 2.0000 0.0000 Constraint 39 822 0.8000 1.0000 2.0000 0.0000 Constraint 39 814 0.8000 1.0000 2.0000 0.0000 Constraint 39 808 0.8000 1.0000 2.0000 0.0000 Constraint 39 801 0.8000 1.0000 2.0000 0.0000 Constraint 39 792 0.8000 1.0000 2.0000 0.0000 Constraint 39 784 0.8000 1.0000 2.0000 0.0000 Constraint 39 776 0.8000 1.0000 2.0000 0.0000 Constraint 39 768 0.8000 1.0000 2.0000 0.0000 Constraint 39 761 0.8000 1.0000 2.0000 0.0000 Constraint 39 751 0.8000 1.0000 2.0000 0.0000 Constraint 39 743 0.8000 1.0000 2.0000 0.0000 Constraint 39 735 0.8000 1.0000 2.0000 0.0000 Constraint 39 727 0.8000 1.0000 2.0000 0.0000 Constraint 39 719 0.8000 1.0000 2.0000 0.0000 Constraint 39 711 0.8000 1.0000 2.0000 0.0000 Constraint 39 706 0.8000 1.0000 2.0000 0.0000 Constraint 39 698 0.8000 1.0000 2.0000 0.0000 Constraint 39 690 0.8000 1.0000 2.0000 0.0000 Constraint 39 682 0.8000 1.0000 2.0000 0.0000 Constraint 39 674 0.8000 1.0000 2.0000 0.0000 Constraint 39 667 0.8000 1.0000 2.0000 0.0000 Constraint 39 659 0.8000 1.0000 2.0000 0.0000 Constraint 39 650 0.8000 1.0000 2.0000 0.0000 Constraint 39 641 0.8000 1.0000 2.0000 0.0000 Constraint 39 633 0.8000 1.0000 2.0000 0.0000 Constraint 39 627 0.8000 1.0000 2.0000 0.0000 Constraint 39 590 0.8000 1.0000 2.0000 0.0000 Constraint 39 581 0.8000 1.0000 2.0000 0.0000 Constraint 39 574 0.8000 1.0000 2.0000 0.0000 Constraint 39 567 0.8000 1.0000 2.0000 0.0000 Constraint 39 560 0.8000 1.0000 2.0000 0.0000 Constraint 39 547 0.8000 1.0000 2.0000 0.0000 Constraint 39 539 0.8000 1.0000 2.0000 0.0000 Constraint 39 531 0.8000 1.0000 2.0000 0.0000 Constraint 39 510 0.8000 1.0000 2.0000 0.0000 Constraint 39 505 0.8000 1.0000 2.0000 0.0000 Constraint 39 486 0.8000 1.0000 2.0000 0.0000 Constraint 39 478 0.8000 1.0000 2.0000 0.0000 Constraint 39 466 0.8000 1.0000 2.0000 0.0000 Constraint 39 459 0.8000 1.0000 2.0000 0.0000 Constraint 39 445 0.8000 1.0000 2.0000 0.0000 Constraint 39 437 0.8000 1.0000 2.0000 0.0000 Constraint 39 430 0.8000 1.0000 2.0000 0.0000 Constraint 39 419 0.8000 1.0000 2.0000 0.0000 Constraint 39 411 0.8000 1.0000 2.0000 0.0000 Constraint 39 404 0.8000 1.0000 2.0000 0.0000 Constraint 39 396 0.8000 1.0000 2.0000 0.0000 Constraint 39 388 0.8000 1.0000 2.0000 0.0000 Constraint 39 380 0.8000 1.0000 2.0000 0.0000 Constraint 39 372 0.8000 1.0000 2.0000 0.0000 Constraint 39 361 0.8000 1.0000 2.0000 0.0000 Constraint 39 352 0.8000 1.0000 2.0000 0.0000 Constraint 39 345 0.8000 1.0000 2.0000 0.0000 Constraint 39 337 0.8000 1.0000 2.0000 0.0000 Constraint 39 326 0.8000 1.0000 2.0000 0.0000 Constraint 39 317 0.8000 1.0000 2.0000 0.0000 Constraint 39 309 0.8000 1.0000 2.0000 0.0000 Constraint 39 303 0.8000 1.0000 2.0000 0.0000 Constraint 39 294 0.8000 1.0000 2.0000 0.0000 Constraint 39 286 0.8000 1.0000 2.0000 0.0000 Constraint 39 277 0.8000 1.0000 2.0000 0.0000 Constraint 39 270 0.8000 1.0000 2.0000 0.0000 Constraint 39 262 0.8000 1.0000 2.0000 0.0000 Constraint 39 253 0.8000 1.0000 2.0000 0.0000 Constraint 39 247 0.8000 1.0000 2.0000 0.0000 Constraint 39 238 0.8000 1.0000 2.0000 0.0000 Constraint 39 232 0.8000 1.0000 2.0000 0.0000 Constraint 39 220 0.8000 1.0000 2.0000 0.0000 Constraint 39 208 0.8000 1.0000 2.0000 0.0000 Constraint 39 199 0.8000 1.0000 2.0000 0.0000 Constraint 39 191 0.8000 1.0000 2.0000 0.0000 Constraint 39 184 0.8000 1.0000 2.0000 0.0000 Constraint 39 173 0.8000 1.0000 2.0000 0.0000 Constraint 39 165 0.8000 1.0000 2.0000 0.0000 Constraint 39 157 0.8000 1.0000 2.0000 0.0000 Constraint 39 149 0.8000 1.0000 2.0000 0.0000 Constraint 39 143 0.8000 1.0000 2.0000 0.0000 Constraint 39 101 0.8000 1.0000 2.0000 0.0000 Constraint 39 95 0.8000 1.0000 2.0000 0.0000 Constraint 39 89 0.8000 1.0000 2.0000 0.0000 Constraint 39 80 0.8000 1.0000 2.0000 0.0000 Constraint 39 72 0.8000 1.0000 2.0000 0.0000 Constraint 39 61 0.8000 1.0000 2.0000 0.0000 Constraint 39 53 0.8000 1.0000 2.0000 0.0000 Constraint 39 46 0.8000 1.0000 2.0000 0.0000 Constraint 31 1051 0.8000 1.0000 2.0000 0.0000 Constraint 31 1043 0.8000 1.0000 2.0000 0.0000 Constraint 31 1033 0.8000 1.0000 2.0000 0.0000 Constraint 31 1026 0.8000 1.0000 2.0000 0.0000 Constraint 31 1019 0.8000 1.0000 2.0000 0.0000 Constraint 31 1011 0.8000 1.0000 2.0000 0.0000 Constraint 31 1003 0.8000 1.0000 2.0000 0.0000 Constraint 31 995 0.8000 1.0000 2.0000 0.0000 Constraint 31 987 0.8000 1.0000 2.0000 0.0000 Constraint 31 980 0.8000 1.0000 2.0000 0.0000 Constraint 31 972 0.8000 1.0000 2.0000 0.0000 Constraint 31 960 0.8000 1.0000 2.0000 0.0000 Constraint 31 951 0.8000 1.0000 2.0000 0.0000 Constraint 31 943 0.8000 1.0000 2.0000 0.0000 Constraint 31 931 0.8000 1.0000 2.0000 0.0000 Constraint 31 919 0.8000 1.0000 2.0000 0.0000 Constraint 31 911 0.8000 1.0000 2.0000 0.0000 Constraint 31 901 0.8000 1.0000 2.0000 0.0000 Constraint 31 891 0.8000 1.0000 2.0000 0.0000 Constraint 31 883 0.8000 1.0000 2.0000 0.0000 Constraint 31 872 0.8000 1.0000 2.0000 0.0000 Constraint 31 866 0.8000 1.0000 2.0000 0.0000 Constraint 31 857 0.8000 1.0000 2.0000 0.0000 Constraint 31 849 0.8000 1.0000 2.0000 0.0000 Constraint 31 840 0.8000 1.0000 2.0000 0.0000 Constraint 31 827 0.8000 1.0000 2.0000 0.0000 Constraint 31 822 0.8000 1.0000 2.0000 0.0000 Constraint 31 814 0.8000 1.0000 2.0000 0.0000 Constraint 31 808 0.8000 1.0000 2.0000 0.0000 Constraint 31 801 0.8000 1.0000 2.0000 0.0000 Constraint 31 792 0.8000 1.0000 2.0000 0.0000 Constraint 31 784 0.8000 1.0000 2.0000 0.0000 Constraint 31 776 0.8000 1.0000 2.0000 0.0000 Constraint 31 768 0.8000 1.0000 2.0000 0.0000 Constraint 31 761 0.8000 1.0000 2.0000 0.0000 Constraint 31 751 0.8000 1.0000 2.0000 0.0000 Constraint 31 743 0.8000 1.0000 2.0000 0.0000 Constraint 31 735 0.8000 1.0000 2.0000 0.0000 Constraint 31 727 0.8000 1.0000 2.0000 0.0000 Constraint 31 719 0.8000 1.0000 2.0000 0.0000 Constraint 31 711 0.8000 1.0000 2.0000 0.0000 Constraint 31 706 0.8000 1.0000 2.0000 0.0000 Constraint 31 698 0.8000 1.0000 2.0000 0.0000 Constraint 31 690 0.8000 1.0000 2.0000 0.0000 Constraint 31 682 0.8000 1.0000 2.0000 0.0000 Constraint 31 674 0.8000 1.0000 2.0000 0.0000 Constraint 31 667 0.8000 1.0000 2.0000 0.0000 Constraint 31 659 0.8000 1.0000 2.0000 0.0000 Constraint 31 650 0.8000 1.0000 2.0000 0.0000 Constraint 31 641 0.8000 1.0000 2.0000 0.0000 Constraint 31 633 0.8000 1.0000 2.0000 0.0000 Constraint 31 627 0.8000 1.0000 2.0000 0.0000 Constraint 31 603 0.8000 1.0000 2.0000 0.0000 Constraint 31 597 0.8000 1.0000 2.0000 0.0000 Constraint 31 590 0.8000 1.0000 2.0000 0.0000 Constraint 31 581 0.8000 1.0000 2.0000 0.0000 Constraint 31 574 0.8000 1.0000 2.0000 0.0000 Constraint 31 567 0.8000 1.0000 2.0000 0.0000 Constraint 31 560 0.8000 1.0000 2.0000 0.0000 Constraint 31 547 0.8000 1.0000 2.0000 0.0000 Constraint 31 539 0.8000 1.0000 2.0000 0.0000 Constraint 31 531 0.8000 1.0000 2.0000 0.0000 Constraint 31 519 0.8000 1.0000 2.0000 0.0000 Constraint 31 510 0.8000 1.0000 2.0000 0.0000 Constraint 31 505 0.8000 1.0000 2.0000 0.0000 Constraint 31 500 0.8000 1.0000 2.0000 0.0000 Constraint 31 493 0.8000 1.0000 2.0000 0.0000 Constraint 31 486 0.8000 1.0000 2.0000 0.0000 Constraint 31 478 0.8000 1.0000 2.0000 0.0000 Constraint 31 471 0.8000 1.0000 2.0000 0.0000 Constraint 31 466 0.8000 1.0000 2.0000 0.0000 Constraint 31 459 0.8000 1.0000 2.0000 0.0000 Constraint 31 445 0.8000 1.0000 2.0000 0.0000 Constraint 31 437 0.8000 1.0000 2.0000 0.0000 Constraint 31 419 0.8000 1.0000 2.0000 0.0000 Constraint 31 411 0.8000 1.0000 2.0000 0.0000 Constraint 31 404 0.8000 1.0000 2.0000 0.0000 Constraint 31 396 0.8000 1.0000 2.0000 0.0000 Constraint 31 388 0.8000 1.0000 2.0000 0.0000 Constraint 31 380 0.8000 1.0000 2.0000 0.0000 Constraint 31 372 0.8000 1.0000 2.0000 0.0000 Constraint 31 361 0.8000 1.0000 2.0000 0.0000 Constraint 31 352 0.8000 1.0000 2.0000 0.0000 Constraint 31 345 0.8000 1.0000 2.0000 0.0000 Constraint 31 337 0.8000 1.0000 2.0000 0.0000 Constraint 31 326 0.8000 1.0000 2.0000 0.0000 Constraint 31 317 0.8000 1.0000 2.0000 0.0000 Constraint 31 309 0.8000 1.0000 2.0000 0.0000 Constraint 31 303 0.8000 1.0000 2.0000 0.0000 Constraint 31 294 0.8000 1.0000 2.0000 0.0000 Constraint 31 286 0.8000 1.0000 2.0000 0.0000 Constraint 31 277 0.8000 1.0000 2.0000 0.0000 Constraint 31 270 0.8000 1.0000 2.0000 0.0000 Constraint 31 262 0.8000 1.0000 2.0000 0.0000 Constraint 31 253 0.8000 1.0000 2.0000 0.0000 Constraint 31 247 0.8000 1.0000 2.0000 0.0000 Constraint 31 238 0.8000 1.0000 2.0000 0.0000 Constraint 31 232 0.8000 1.0000 2.0000 0.0000 Constraint 31 220 0.8000 1.0000 2.0000 0.0000 Constraint 31 208 0.8000 1.0000 2.0000 0.0000 Constraint 31 199 0.8000 1.0000 2.0000 0.0000 Constraint 31 191 0.8000 1.0000 2.0000 0.0000 Constraint 31 184 0.8000 1.0000 2.0000 0.0000 Constraint 31 173 0.8000 1.0000 2.0000 0.0000 Constraint 31 165 0.8000 1.0000 2.0000 0.0000 Constraint 31 157 0.8000 1.0000 2.0000 0.0000 Constraint 31 149 0.8000 1.0000 2.0000 0.0000 Constraint 31 143 0.8000 1.0000 2.0000 0.0000 Constraint 31 128 0.8000 1.0000 2.0000 0.0000 Constraint 31 117 0.8000 1.0000 2.0000 0.0000 Constraint 31 108 0.8000 1.0000 2.0000 0.0000 Constraint 31 95 0.8000 1.0000 2.0000 0.0000 Constraint 31 89 0.8000 1.0000 2.0000 0.0000 Constraint 31 80 0.8000 1.0000 2.0000 0.0000 Constraint 31 72 0.8000 1.0000 2.0000 0.0000 Constraint 31 61 0.8000 1.0000 2.0000 0.0000 Constraint 31 53 0.8000 1.0000 2.0000 0.0000 Constraint 31 46 0.8000 1.0000 2.0000 0.0000 Constraint 31 39 0.8000 1.0000 2.0000 0.0000 Constraint 20 1051 0.8000 1.0000 2.0000 0.0000 Constraint 20 1043 0.8000 1.0000 2.0000 0.0000 Constraint 20 1033 0.8000 1.0000 2.0000 0.0000 Constraint 20 1026 0.8000 1.0000 2.0000 0.0000 Constraint 20 1019 0.8000 1.0000 2.0000 0.0000 Constraint 20 1011 0.8000 1.0000 2.0000 0.0000 Constraint 20 1003 0.8000 1.0000 2.0000 0.0000 Constraint 20 995 0.8000 1.0000 2.0000 0.0000 Constraint 20 987 0.8000 1.0000 2.0000 0.0000 Constraint 20 980 0.8000 1.0000 2.0000 0.0000 Constraint 20 972 0.8000 1.0000 2.0000 0.0000 Constraint 20 960 0.8000 1.0000 2.0000 0.0000 Constraint 20 951 0.8000 1.0000 2.0000 0.0000 Constraint 20 943 0.8000 1.0000 2.0000 0.0000 Constraint 20 931 0.8000 1.0000 2.0000 0.0000 Constraint 20 919 0.8000 1.0000 2.0000 0.0000 Constraint 20 911 0.8000 1.0000 2.0000 0.0000 Constraint 20 901 0.8000 1.0000 2.0000 0.0000 Constraint 20 891 0.8000 1.0000 2.0000 0.0000 Constraint 20 883 0.8000 1.0000 2.0000 0.0000 Constraint 20 872 0.8000 1.0000 2.0000 0.0000 Constraint 20 866 0.8000 1.0000 2.0000 0.0000 Constraint 20 857 0.8000 1.0000 2.0000 0.0000 Constraint 20 849 0.8000 1.0000 2.0000 0.0000 Constraint 20 840 0.8000 1.0000 2.0000 0.0000 Constraint 20 827 0.8000 1.0000 2.0000 0.0000 Constraint 20 822 0.8000 1.0000 2.0000 0.0000 Constraint 20 814 0.8000 1.0000 2.0000 0.0000 Constraint 20 808 0.8000 1.0000 2.0000 0.0000 Constraint 20 801 0.8000 1.0000 2.0000 0.0000 Constraint 20 792 0.8000 1.0000 2.0000 0.0000 Constraint 20 784 0.8000 1.0000 2.0000 0.0000 Constraint 20 776 0.8000 1.0000 2.0000 0.0000 Constraint 20 768 0.8000 1.0000 2.0000 0.0000 Constraint 20 761 0.8000 1.0000 2.0000 0.0000 Constraint 20 751 0.8000 1.0000 2.0000 0.0000 Constraint 20 743 0.8000 1.0000 2.0000 0.0000 Constraint 20 735 0.8000 1.0000 2.0000 0.0000 Constraint 20 727 0.8000 1.0000 2.0000 0.0000 Constraint 20 719 0.8000 1.0000 2.0000 0.0000 Constraint 20 711 0.8000 1.0000 2.0000 0.0000 Constraint 20 706 0.8000 1.0000 2.0000 0.0000 Constraint 20 698 0.8000 1.0000 2.0000 0.0000 Constraint 20 690 0.8000 1.0000 2.0000 0.0000 Constraint 20 682 0.8000 1.0000 2.0000 0.0000 Constraint 20 674 0.8000 1.0000 2.0000 0.0000 Constraint 20 667 0.8000 1.0000 2.0000 0.0000 Constraint 20 659 0.8000 1.0000 2.0000 0.0000 Constraint 20 650 0.8000 1.0000 2.0000 0.0000 Constraint 20 641 0.8000 1.0000 2.0000 0.0000 Constraint 20 633 0.8000 1.0000 2.0000 0.0000 Constraint 20 627 0.8000 1.0000 2.0000 0.0000 Constraint 20 621 0.8000 1.0000 2.0000 0.0000 Constraint 20 614 0.8000 1.0000 2.0000 0.0000 Constraint 20 603 0.8000 1.0000 2.0000 0.0000 Constraint 20 597 0.8000 1.0000 2.0000 0.0000 Constraint 20 590 0.8000 1.0000 2.0000 0.0000 Constraint 20 581 0.8000 1.0000 2.0000 0.0000 Constraint 20 574 0.8000 1.0000 2.0000 0.0000 Constraint 20 567 0.8000 1.0000 2.0000 0.0000 Constraint 20 560 0.8000 1.0000 2.0000 0.0000 Constraint 20 552 0.8000 1.0000 2.0000 0.0000 Constraint 20 547 0.8000 1.0000 2.0000 0.0000 Constraint 20 539 0.8000 1.0000 2.0000 0.0000 Constraint 20 531 0.8000 1.0000 2.0000 0.0000 Constraint 20 510 0.8000 1.0000 2.0000 0.0000 Constraint 20 505 0.8000 1.0000 2.0000 0.0000 Constraint 20 500 0.8000 1.0000 2.0000 0.0000 Constraint 20 493 0.8000 1.0000 2.0000 0.0000 Constraint 20 486 0.8000 1.0000 2.0000 0.0000 Constraint 20 478 0.8000 1.0000 2.0000 0.0000 Constraint 20 471 0.8000 1.0000 2.0000 0.0000 Constraint 20 466 0.8000 1.0000 2.0000 0.0000 Constraint 20 459 0.8000 1.0000 2.0000 0.0000 Constraint 20 445 0.8000 1.0000 2.0000 0.0000 Constraint 20 437 0.8000 1.0000 2.0000 0.0000 Constraint 20 430 0.8000 1.0000 2.0000 0.0000 Constraint 20 419 0.8000 1.0000 2.0000 0.0000 Constraint 20 411 0.8000 1.0000 2.0000 0.0000 Constraint 20 404 0.8000 1.0000 2.0000 0.0000 Constraint 20 396 0.8000 1.0000 2.0000 0.0000 Constraint 20 388 0.8000 1.0000 2.0000 0.0000 Constraint 20 380 0.8000 1.0000 2.0000 0.0000 Constraint 20 372 0.8000 1.0000 2.0000 0.0000 Constraint 20 361 0.8000 1.0000 2.0000 0.0000 Constraint 20 352 0.8000 1.0000 2.0000 0.0000 Constraint 20 345 0.8000 1.0000 2.0000 0.0000 Constraint 20 337 0.8000 1.0000 2.0000 0.0000 Constraint 20 326 0.8000 1.0000 2.0000 0.0000 Constraint 20 317 0.8000 1.0000 2.0000 0.0000 Constraint 20 309 0.8000 1.0000 2.0000 0.0000 Constraint 20 303 0.8000 1.0000 2.0000 0.0000 Constraint 20 294 0.8000 1.0000 2.0000 0.0000 Constraint 20 286 0.8000 1.0000 2.0000 0.0000 Constraint 20 277 0.8000 1.0000 2.0000 0.0000 Constraint 20 270 0.8000 1.0000 2.0000 0.0000 Constraint 20 262 0.8000 1.0000 2.0000 0.0000 Constraint 20 253 0.8000 1.0000 2.0000 0.0000 Constraint 20 247 0.8000 1.0000 2.0000 0.0000 Constraint 20 238 0.8000 1.0000 2.0000 0.0000 Constraint 20 232 0.8000 1.0000 2.0000 0.0000 Constraint 20 220 0.8000 1.0000 2.0000 0.0000 Constraint 20 208 0.8000 1.0000 2.0000 0.0000 Constraint 20 199 0.8000 1.0000 2.0000 0.0000 Constraint 20 191 0.8000 1.0000 2.0000 0.0000 Constraint 20 184 0.8000 1.0000 2.0000 0.0000 Constraint 20 173 0.8000 1.0000 2.0000 0.0000 Constraint 20 165 0.8000 1.0000 2.0000 0.0000 Constraint 20 157 0.8000 1.0000 2.0000 0.0000 Constraint 20 149 0.8000 1.0000 2.0000 0.0000 Constraint 20 143 0.8000 1.0000 2.0000 0.0000 Constraint 20 136 0.8000 1.0000 2.0000 0.0000 Constraint 20 128 0.8000 1.0000 2.0000 0.0000 Constraint 20 122 0.8000 1.0000 2.0000 0.0000 Constraint 20 117 0.8000 1.0000 2.0000 0.0000 Constraint 20 108 0.8000 1.0000 2.0000 0.0000 Constraint 20 101 0.8000 1.0000 2.0000 0.0000 Constraint 20 95 0.8000 1.0000 2.0000 0.0000 Constraint 20 89 0.8000 1.0000 2.0000 0.0000 Constraint 20 80 0.8000 1.0000 2.0000 0.0000 Constraint 20 72 0.8000 1.0000 2.0000 0.0000 Constraint 20 61 0.8000 1.0000 2.0000 0.0000 Constraint 20 53 0.8000 1.0000 2.0000 0.0000 Constraint 20 46 0.8000 1.0000 2.0000 0.0000 Constraint 20 39 0.8000 1.0000 2.0000 0.0000 Constraint 20 31 0.8000 1.0000 2.0000 0.0000 Constraint 11 1051 0.8000 1.0000 2.0000 0.0000 Constraint 11 1043 0.8000 1.0000 2.0000 0.0000 Constraint 11 1033 0.8000 1.0000 2.0000 0.0000 Constraint 11 1026 0.8000 1.0000 2.0000 0.0000 Constraint 11 1019 0.8000 1.0000 2.0000 0.0000 Constraint 11 1011 0.8000 1.0000 2.0000 0.0000 Constraint 11 1003 0.8000 1.0000 2.0000 0.0000 Constraint 11 995 0.8000 1.0000 2.0000 0.0000 Constraint 11 987 0.8000 1.0000 2.0000 0.0000 Constraint 11 980 0.8000 1.0000 2.0000 0.0000 Constraint 11 972 0.8000 1.0000 2.0000 0.0000 Constraint 11 960 0.8000 1.0000 2.0000 0.0000 Constraint 11 951 0.8000 1.0000 2.0000 0.0000 Constraint 11 943 0.8000 1.0000 2.0000 0.0000 Constraint 11 931 0.8000 1.0000 2.0000 0.0000 Constraint 11 919 0.8000 1.0000 2.0000 0.0000 Constraint 11 911 0.8000 1.0000 2.0000 0.0000 Constraint 11 901 0.8000 1.0000 2.0000 0.0000 Constraint 11 891 0.8000 1.0000 2.0000 0.0000 Constraint 11 883 0.8000 1.0000 2.0000 0.0000 Constraint 11 872 0.8000 1.0000 2.0000 0.0000 Constraint 11 866 0.8000 1.0000 2.0000 0.0000 Constraint 11 857 0.8000 1.0000 2.0000 0.0000 Constraint 11 849 0.8000 1.0000 2.0000 0.0000 Constraint 11 840 0.8000 1.0000 2.0000 0.0000 Constraint 11 827 0.8000 1.0000 2.0000 0.0000 Constraint 11 822 0.8000 1.0000 2.0000 0.0000 Constraint 11 814 0.8000 1.0000 2.0000 0.0000 Constraint 11 808 0.8000 1.0000 2.0000 0.0000 Constraint 11 801 0.8000 1.0000 2.0000 0.0000 Constraint 11 792 0.8000 1.0000 2.0000 0.0000 Constraint 11 784 0.8000 1.0000 2.0000 0.0000 Constraint 11 776 0.8000 1.0000 2.0000 0.0000 Constraint 11 768 0.8000 1.0000 2.0000 0.0000 Constraint 11 761 0.8000 1.0000 2.0000 0.0000 Constraint 11 751 0.8000 1.0000 2.0000 0.0000 Constraint 11 743 0.8000 1.0000 2.0000 0.0000 Constraint 11 735 0.8000 1.0000 2.0000 0.0000 Constraint 11 727 0.8000 1.0000 2.0000 0.0000 Constraint 11 719 0.8000 1.0000 2.0000 0.0000 Constraint 11 711 0.8000 1.0000 2.0000 0.0000 Constraint 11 706 0.8000 1.0000 2.0000 0.0000 Constraint 11 698 0.8000 1.0000 2.0000 0.0000 Constraint 11 690 0.8000 1.0000 2.0000 0.0000 Constraint 11 682 0.8000 1.0000 2.0000 0.0000 Constraint 11 674 0.8000 1.0000 2.0000 0.0000 Constraint 11 667 0.8000 1.0000 2.0000 0.0000 Constraint 11 659 0.8000 1.0000 2.0000 0.0000 Constraint 11 650 0.8000 1.0000 2.0000 0.0000 Constraint 11 641 0.8000 1.0000 2.0000 0.0000 Constraint 11 633 0.8000 1.0000 2.0000 0.0000 Constraint 11 627 0.8000 1.0000 2.0000 0.0000 Constraint 11 621 0.8000 1.0000 2.0000 0.0000 Constraint 11 614 0.8000 1.0000 2.0000 0.0000 Constraint 11 603 0.8000 1.0000 2.0000 0.0000 Constraint 11 597 0.8000 1.0000 2.0000 0.0000 Constraint 11 590 0.8000 1.0000 2.0000 0.0000 Constraint 11 581 0.8000 1.0000 2.0000 0.0000 Constraint 11 574 0.8000 1.0000 2.0000 0.0000 Constraint 11 567 0.8000 1.0000 2.0000 0.0000 Constraint 11 560 0.8000 1.0000 2.0000 0.0000 Constraint 11 552 0.8000 1.0000 2.0000 0.0000 Constraint 11 547 0.8000 1.0000 2.0000 0.0000 Constraint 11 539 0.8000 1.0000 2.0000 0.0000 Constraint 11 531 0.8000 1.0000 2.0000 0.0000 Constraint 11 519 0.8000 1.0000 2.0000 0.0000 Constraint 11 510 0.8000 1.0000 2.0000 0.0000 Constraint 11 505 0.8000 1.0000 2.0000 0.0000 Constraint 11 500 0.8000 1.0000 2.0000 0.0000 Constraint 11 493 0.8000 1.0000 2.0000 0.0000 Constraint 11 486 0.8000 1.0000 2.0000 0.0000 Constraint 11 478 0.8000 1.0000 2.0000 0.0000 Constraint 11 471 0.8000 1.0000 2.0000 0.0000 Constraint 11 466 0.8000 1.0000 2.0000 0.0000 Constraint 11 459 0.8000 1.0000 2.0000 0.0000 Constraint 11 445 0.8000 1.0000 2.0000 0.0000 Constraint 11 437 0.8000 1.0000 2.0000 0.0000 Constraint 11 430 0.8000 1.0000 2.0000 0.0000 Constraint 11 419 0.8000 1.0000 2.0000 0.0000 Constraint 11 411 0.8000 1.0000 2.0000 0.0000 Constraint 11 404 0.8000 1.0000 2.0000 0.0000 Constraint 11 396 0.8000 1.0000 2.0000 0.0000 Constraint 11 388 0.8000 1.0000 2.0000 0.0000 Constraint 11 380 0.8000 1.0000 2.0000 0.0000 Constraint 11 372 0.8000 1.0000 2.0000 0.0000 Constraint 11 361 0.8000 1.0000 2.0000 0.0000 Constraint 11 352 0.8000 1.0000 2.0000 0.0000 Constraint 11 345 0.8000 1.0000 2.0000 0.0000 Constraint 11 337 0.8000 1.0000 2.0000 0.0000 Constraint 11 326 0.8000 1.0000 2.0000 0.0000 Constraint 11 317 0.8000 1.0000 2.0000 0.0000 Constraint 11 309 0.8000 1.0000 2.0000 0.0000 Constraint 11 303 0.8000 1.0000 2.0000 0.0000 Constraint 11 294 0.8000 1.0000 2.0000 0.0000 Constraint 11 286 0.8000 1.0000 2.0000 0.0000 Constraint 11 277 0.8000 1.0000 2.0000 0.0000 Constraint 11 270 0.8000 1.0000 2.0000 0.0000 Constraint 11 262 0.8000 1.0000 2.0000 0.0000 Constraint 11 253 0.8000 1.0000 2.0000 0.0000 Constraint 11 247 0.8000 1.0000 2.0000 0.0000 Constraint 11 238 0.8000 1.0000 2.0000 0.0000 Constraint 11 232 0.8000 1.0000 2.0000 0.0000 Constraint 11 220 0.8000 1.0000 2.0000 0.0000 Constraint 11 208 0.8000 1.0000 2.0000 0.0000 Constraint 11 199 0.8000 1.0000 2.0000 0.0000 Constraint 11 191 0.8000 1.0000 2.0000 0.0000 Constraint 11 184 0.8000 1.0000 2.0000 0.0000 Constraint 11 173 0.8000 1.0000 2.0000 0.0000 Constraint 11 165 0.8000 1.0000 2.0000 0.0000 Constraint 11 157 0.8000 1.0000 2.0000 0.0000 Constraint 11 149 0.8000 1.0000 2.0000 0.0000 Constraint 11 143 0.8000 1.0000 2.0000 0.0000 Constraint 11 136 0.8000 1.0000 2.0000 0.0000 Constraint 11 128 0.8000 1.0000 2.0000 0.0000 Constraint 11 122 0.8000 1.0000 2.0000 0.0000 Constraint 11 117 0.8000 1.0000 2.0000 0.0000 Constraint 11 108 0.8000 1.0000 2.0000 0.0000 Constraint 11 101 0.8000 1.0000 2.0000 0.0000 Constraint 11 95 0.8000 1.0000 2.0000 0.0000 Constraint 11 89 0.8000 1.0000 2.0000 0.0000 Constraint 11 80 0.8000 1.0000 2.0000 0.0000 Constraint 11 72 0.8000 1.0000 2.0000 0.0000 Constraint 11 61 0.8000 1.0000 2.0000 0.0000 Constraint 11 53 0.8000 1.0000 2.0000 0.0000 Constraint 11 46 0.8000 1.0000 2.0000 0.0000 Constraint 11 39 0.8000 1.0000 2.0000 0.0000 Constraint 11 31 0.8000 1.0000 2.0000 0.0000 Constraint 11 20 0.8000 1.0000 2.0000 0.0000 Constraint 3 1051 0.8000 1.0000 2.0000 0.0000 Constraint 3 1043 0.8000 1.0000 2.0000 0.0000 Constraint 3 1033 0.8000 1.0000 2.0000 0.0000 Constraint 3 1026 0.8000 1.0000 2.0000 0.0000 Constraint 3 1019 0.8000 1.0000 2.0000 0.0000 Constraint 3 1011 0.8000 1.0000 2.0000 0.0000 Constraint 3 1003 0.8000 1.0000 2.0000 0.0000 Constraint 3 995 0.8000 1.0000 2.0000 0.0000 Constraint 3 987 0.8000 1.0000 2.0000 0.0000 Constraint 3 980 0.8000 1.0000 2.0000 0.0000 Constraint 3 972 0.8000 1.0000 2.0000 0.0000 Constraint 3 960 0.8000 1.0000 2.0000 0.0000 Constraint 3 951 0.8000 1.0000 2.0000 0.0000 Constraint 3 943 0.8000 1.0000 2.0000 0.0000 Constraint 3 931 0.8000 1.0000 2.0000 0.0000 Constraint 3 919 0.8000 1.0000 2.0000 0.0000 Constraint 3 911 0.8000 1.0000 2.0000 0.0000 Constraint 3 901 0.8000 1.0000 2.0000 0.0000 Constraint 3 891 0.8000 1.0000 2.0000 0.0000 Constraint 3 883 0.8000 1.0000 2.0000 0.0000 Constraint 3 872 0.8000 1.0000 2.0000 0.0000 Constraint 3 866 0.8000 1.0000 2.0000 0.0000 Constraint 3 857 0.8000 1.0000 2.0000 0.0000 Constraint 3 849 0.8000 1.0000 2.0000 0.0000 Constraint 3 840 0.8000 1.0000 2.0000 0.0000 Constraint 3 827 0.8000 1.0000 2.0000 0.0000 Constraint 3 822 0.8000 1.0000 2.0000 0.0000 Constraint 3 814 0.8000 1.0000 2.0000 0.0000 Constraint 3 808 0.8000 1.0000 2.0000 0.0000 Constraint 3 801 0.8000 1.0000 2.0000 0.0000 Constraint 3 792 0.8000 1.0000 2.0000 0.0000 Constraint 3 784 0.8000 1.0000 2.0000 0.0000 Constraint 3 776 0.8000 1.0000 2.0000 0.0000 Constraint 3 768 0.8000 1.0000 2.0000 0.0000 Constraint 3 761 0.8000 1.0000 2.0000 0.0000 Constraint 3 751 0.8000 1.0000 2.0000 0.0000 Constraint 3 743 0.8000 1.0000 2.0000 0.0000 Constraint 3 735 0.8000 1.0000 2.0000 0.0000 Constraint 3 727 0.8000 1.0000 2.0000 0.0000 Constraint 3 719 0.8000 1.0000 2.0000 0.0000 Constraint 3 711 0.8000 1.0000 2.0000 0.0000 Constraint 3 706 0.8000 1.0000 2.0000 0.0000 Constraint 3 698 0.8000 1.0000 2.0000 0.0000 Constraint 3 690 0.8000 1.0000 2.0000 0.0000 Constraint 3 682 0.8000 1.0000 2.0000 0.0000 Constraint 3 674 0.8000 1.0000 2.0000 0.0000 Constraint 3 667 0.8000 1.0000 2.0000 0.0000 Constraint 3 659 0.8000 1.0000 2.0000 0.0000 Constraint 3 650 0.8000 1.0000 2.0000 0.0000 Constraint 3 641 0.8000 1.0000 2.0000 0.0000 Constraint 3 633 0.8000 1.0000 2.0000 0.0000 Constraint 3 627 0.8000 1.0000 2.0000 0.0000 Constraint 3 621 0.8000 1.0000 2.0000 0.0000 Constraint 3 614 0.8000 1.0000 2.0000 0.0000 Constraint 3 603 0.8000 1.0000 2.0000 0.0000 Constraint 3 597 0.8000 1.0000 2.0000 0.0000 Constraint 3 590 0.8000 1.0000 2.0000 0.0000 Constraint 3 581 0.8000 1.0000 2.0000 0.0000 Constraint 3 574 0.8000 1.0000 2.0000 0.0000 Constraint 3 567 0.8000 1.0000 2.0000 0.0000 Constraint 3 560 0.8000 1.0000 2.0000 0.0000 Constraint 3 552 0.8000 1.0000 2.0000 0.0000 Constraint 3 547 0.8000 1.0000 2.0000 0.0000 Constraint 3 539 0.8000 1.0000 2.0000 0.0000 Constraint 3 531 0.8000 1.0000 2.0000 0.0000 Constraint 3 519 0.8000 1.0000 2.0000 0.0000 Constraint 3 510 0.8000 1.0000 2.0000 0.0000 Constraint 3 505 0.8000 1.0000 2.0000 0.0000 Constraint 3 500 0.8000 1.0000 2.0000 0.0000 Constraint 3 493 0.8000 1.0000 2.0000 0.0000 Constraint 3 486 0.8000 1.0000 2.0000 0.0000 Constraint 3 478 0.8000 1.0000 2.0000 0.0000 Constraint 3 471 0.8000 1.0000 2.0000 0.0000 Constraint 3 466 0.8000 1.0000 2.0000 0.0000 Constraint 3 459 0.8000 1.0000 2.0000 0.0000 Constraint 3 445 0.8000 1.0000 2.0000 0.0000 Constraint 3 437 0.8000 1.0000 2.0000 0.0000 Constraint 3 430 0.8000 1.0000 2.0000 0.0000 Constraint 3 419 0.8000 1.0000 2.0000 0.0000 Constraint 3 411 0.8000 1.0000 2.0000 0.0000 Constraint 3 404 0.8000 1.0000 2.0000 0.0000 Constraint 3 396 0.8000 1.0000 2.0000 0.0000 Constraint 3 388 0.8000 1.0000 2.0000 0.0000 Constraint 3 380 0.8000 1.0000 2.0000 0.0000 Constraint 3 372 0.8000 1.0000 2.0000 0.0000 Constraint 3 361 0.8000 1.0000 2.0000 0.0000 Constraint 3 352 0.8000 1.0000 2.0000 0.0000 Constraint 3 345 0.8000 1.0000 2.0000 0.0000 Constraint 3 337 0.8000 1.0000 2.0000 0.0000 Constraint 3 326 0.8000 1.0000 2.0000 0.0000 Constraint 3 317 0.8000 1.0000 2.0000 0.0000 Constraint 3 309 0.8000 1.0000 2.0000 0.0000 Constraint 3 303 0.8000 1.0000 2.0000 0.0000 Constraint 3 294 0.8000 1.0000 2.0000 0.0000 Constraint 3 286 0.8000 1.0000 2.0000 0.0000 Constraint 3 277 0.8000 1.0000 2.0000 0.0000 Constraint 3 270 0.8000 1.0000 2.0000 0.0000 Constraint 3 262 0.8000 1.0000 2.0000 0.0000 Constraint 3 253 0.8000 1.0000 2.0000 0.0000 Constraint 3 247 0.8000 1.0000 2.0000 0.0000 Constraint 3 238 0.8000 1.0000 2.0000 0.0000 Constraint 3 232 0.8000 1.0000 2.0000 0.0000 Constraint 3 220 0.8000 1.0000 2.0000 0.0000 Constraint 3 208 0.8000 1.0000 2.0000 0.0000 Constraint 3 199 0.8000 1.0000 2.0000 0.0000 Constraint 3 191 0.8000 1.0000 2.0000 0.0000 Constraint 3 184 0.8000 1.0000 2.0000 0.0000 Constraint 3 173 0.8000 1.0000 2.0000 0.0000 Constraint 3 165 0.8000 1.0000 2.0000 0.0000 Constraint 3 157 0.8000 1.0000 2.0000 0.0000 Constraint 3 149 0.8000 1.0000 2.0000 0.0000 Constraint 3 143 0.8000 1.0000 2.0000 0.0000 Constraint 3 136 0.8000 1.0000 2.0000 0.0000 Constraint 3 128 0.8000 1.0000 2.0000 0.0000 Constraint 3 122 0.8000 1.0000 2.0000 0.0000 Constraint 3 117 0.8000 1.0000 2.0000 0.0000 Constraint 3 108 0.8000 1.0000 2.0000 0.0000 Constraint 3 101 0.8000 1.0000 2.0000 0.0000 Constraint 3 95 0.8000 1.0000 2.0000 0.0000 Constraint 3 89 0.8000 1.0000 2.0000 0.0000 Constraint 3 80 0.8000 1.0000 2.0000 0.0000 Constraint 3 72 0.8000 1.0000 2.0000 0.0000 Constraint 3 61 0.8000 1.0000 2.0000 0.0000 Constraint 3 53 0.8000 1.0000 2.0000 0.0000 Constraint 3 46 0.8000 1.0000 2.0000 0.0000 Constraint 3 39 0.8000 1.0000 2.0000 0.0000 Constraint 3 31 0.8000 1.0000 2.0000 0.0000 Constraint 3 20 0.8000 1.0000 2.0000 0.0000 Constraint 3 11 0.8000 1.0000 2.0000 0.0000 Done printing distance constraints # command: