# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 50.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 303 12.6414 15.8017 23.7026 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 237 303 13.3640 16.7051 25.0576 87.8820 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 303 13.3123 16.6403 24.9605 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 176 250 12.6418 15.8022 23.7034 87.7035 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 176 314 11.6621 14.5776 21.8664 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 303 13.4991 16.8738 25.3107 85.6452 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 285 12.3216 15.4020 23.1030 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 303 12.9819 16.2274 24.3411 84.8820 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 259 341 11.3503 14.1878 21.2818 84.0375 Constraint 210 341 12.6508 15.8135 23.7203 84.0375 Constraint 182 341 11.2596 14.0745 21.1117 84.0375 Constraint 176 341 15.3244 19.1556 28.7333 84.0375 Constraint 259 330 11.5359 14.4199 21.6298 83.7480 Constraint 210 330 11.0715 13.8394 20.7591 83.7480 Constraint 182 330 8.6896 10.8619 16.2929 83.7480 Constraint 176 330 12.5053 15.6316 23.4475 83.7480 Constraint 242 341 13.0172 16.2715 24.4072 83.0920 Constraint 237 322 11.7486 14.6858 22.0286 82.8770 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 279 13.1785 16.4731 24.7096 82.8523 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 169 267 12.6140 15.7674 23.6512 82.8523 Constraint 169 250 12.3018 15.3772 23.0659 82.8085 Constraint 242 330 12.9573 16.1966 24.2949 82.8025 Constraint 250 322 13.3027 16.6284 24.9426 82.6985 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 429 12.8937 16.1171 24.1756 82.3719 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 297 429 13.3226 16.6532 24.9798 82.3719 Constraint 297 421 9.9428 12.4285 18.6427 82.3719 Constraint 292 429 10.4885 13.1107 19.6660 82.3719 Constraint 292 421 6.8174 8.5217 12.7826 82.3719 Constraint 285 429 12.1290 15.1613 22.7419 82.3719 Constraint 285 421 8.4580 10.5724 15.8587 82.3719 Constraint 259 429 11.0406 13.8008 20.7012 82.3719 Constraint 259 421 7.4615 9.3269 13.9904 82.3719 Constraint 210 429 9.4549 11.8187 17.7280 82.3719 Constraint 210 421 6.5241 8.1551 12.2327 82.3719 Constraint 182 429 12.7309 15.9136 23.8704 82.3719 Constraint 182 421 9.4906 11.8633 17.7949 82.3719 Constraint 176 429 14.3254 17.9067 26.8601 82.3719 Constraint 176 421 11.6616 14.5771 21.8656 82.3719 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 242 429 8.6569 10.8212 16.2317 81.4263 Constraint 242 421 5.6483 7.0603 10.5905 81.4263 Constraint 237 341 16.1986 20.2483 30.3725 81.3793 Constraint 201 341 16.2417 20.3021 30.4531 81.3793 Constraint 190 341 14.7919 18.4899 27.7349 81.3793 Constraint 303 404 13.0759 16.3449 24.5173 81.2632 Constraint 297 404 14.4708 18.0885 27.1328 81.2632 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 285 404 11.5874 14.4842 21.7264 81.2632 Constraint 259 404 10.3703 12.9628 19.4442 81.2632 Constraint 210 404 11.2483 14.0603 21.0905 81.2632 Constraint 182 404 14.4846 18.1058 27.1587 81.2632 Constraint 176 404 16.5479 20.6849 31.0273 81.2632 Constraint 279 341 9.0281 11.2851 16.9276 81.2447 Constraint 272 341 11.5722 14.4652 21.6978 81.2447 Constraint 267 341 11.3047 14.1309 21.1963 81.2447 Constraint 250 341 15.3432 19.1790 28.7685 81.2008 Constraint 237 330 15.3912 19.2390 28.8585 81.0898 Constraint 201 330 14.2101 17.7626 26.6439 81.0898 Constraint 190 330 12.6666 15.8332 23.7498 81.0898 Constraint 285 350 7.5775 9.4719 14.2078 81.0433 Constraint 259 350 10.3451 12.9313 19.3970 81.0433 Constraint 210 350 12.4574 15.5718 23.3577 81.0433 Constraint 182 350 11.9797 14.9746 22.4619 81.0433 Constraint 176 350 15.9196 19.8995 29.8492 81.0433 Constraint 221 341 12.3034 15.3792 23.0689 81.0375 Constraint 267 330 11.2804 14.1004 21.1507 80.9552 Constraint 250 330 15.8265 19.7832 29.6747 80.9113 Constraint 292 355 11.2271 14.0339 21.0508 80.7947 Constraint 285 355 9.7587 12.1983 18.2975 80.7947 Constraint 259 355 12.0846 15.1058 22.6587 80.7947 Constraint 210 355 14.3598 17.9497 26.9246 80.7947 Constraint 182 355 14.4113 18.0141 27.0211 80.7947 Constraint 176 355 18.1998 22.7497 34.1246 80.7947 Constraint 169 330 13.1819 16.4774 24.7161 80.7942 Constraint 221 330 11.2591 14.0739 21.1109 80.7480 Constraint 303 435 14.7652 18.4565 27.6847 80.3872 Constraint 297 435 14.8758 18.5947 27.8921 80.3872 Constraint 292 435 11.5134 14.3917 21.5876 80.3872 Constraint 285 435 12.9189 16.1487 24.2230 80.3872 Constraint 259 435 10.8859 13.6074 20.4111 80.3872 Constraint 210 435 9.6710 12.0887 18.1331 80.3872 Constraint 182 435 13.5707 16.9634 25.4451 80.3872 Constraint 176 435 14.4890 18.1112 27.1669 80.3872 Constraint 242 404 8.4628 10.5785 15.8677 80.3177 Constraint 303 412 11.6876 14.6094 21.9142 80.2786 Constraint 297 412 12.4440 15.5550 23.3325 80.2786 Constraint 292 412 8.9687 11.2109 16.8164 80.2786 Constraint 285 412 9.2274 11.5342 17.3014 80.2786 Constraint 259 412 7.2353 9.0441 13.5661 80.2786 Constraint 210 412 8.5627 10.7034 16.0550 80.2786 Constraint 182 412 11.9103 14.8878 22.3317 80.2786 Constraint 176 412 13.7886 17.2358 25.8536 80.2786 Constraint 242 350 11.8920 14.8650 22.2975 80.0977 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 297 399 12.0253 15.0317 22.5475 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 259 399 9.5368 11.9210 17.8816 79.8809 Constraint 210 399 10.4189 13.0236 19.5354 79.8809 Constraint 182 399 12.8371 16.0464 24.0696 79.8809 Constraint 176 399 15.5734 19.4668 29.2002 79.8809 Constraint 226 322 12.2680 15.3350 23.0025 79.8770 Constraint 242 355 13.2029 16.5036 24.7554 79.8491 Constraint 237 429 10.2333 12.7916 19.1875 79.7136 Constraint 237 421 8.1325 10.1656 15.2484 79.7136 Constraint 201 429 12.8139 16.0174 24.0261 79.7136 Constraint 201 421 10.3541 12.9426 19.4139 79.7136 Constraint 190 429 14.8347 18.5434 27.8151 79.7136 Constraint 190 421 11.6223 14.5279 21.7919 79.7136 Constraint 279 429 15.4916 19.3645 29.0467 79.5790 Constraint 279 421 11.7956 14.7445 22.1168 79.5790 Constraint 272 429 14.4993 18.1241 27.1861 79.5790 Constraint 272 421 10.8405 13.5506 20.3259 79.5790 Constraint 267 429 14.5644 18.2055 27.3083 79.5790 Constraint 267 421 10.8601 13.5751 20.3627 79.5790 Constraint 250 429 11.9332 14.9165 22.3748 79.5351 Constraint 250 421 9.3273 11.6591 17.4886 79.5351 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 169 429 11.3034 14.1293 21.1939 79.4460 Constraint 169 421 9.5254 11.9067 17.8601 79.4460 Constraint 242 435 7.9306 9.9132 14.8698 79.4417 Constraint 221 429 11.9287 14.9109 22.3663 79.3719 Constraint 221 421 8.3665 10.4581 15.6871 79.3719 Constraint 242 412 5.0814 6.3517 9.5276 79.3331 Constraint 169 341 15.6141 19.5176 29.2764 79.1425 Constraint 303 442 13.0089 16.2611 24.3917 79.0538 Constraint 297 442 12.2632 15.3290 22.9935 79.0538 Constraint 292 442 8.8647 11.0809 16.6213 79.0538 Constraint 285 442 11.0579 13.8223 20.7335 79.0538 Constraint 259 442 8.8733 11.0916 16.6374 79.0538 Constraint 210 442 6.2636 7.8295 11.7443 79.0538 Constraint 182 442 10.2804 12.8505 19.2757 79.0538 Constraint 176 442 10.9025 13.6281 20.4422 79.0538 Constraint 242 399 8.5018 10.6273 15.9409 78.9353 Constraint 161 314 15.0348 18.7935 28.1902 78.9048 Constraint 161 303 17.2483 21.5604 32.3405 78.9048 Constraint 161 297 13.9721 17.4651 26.1976 78.9048 Constraint 161 292 12.3803 15.4753 23.2130 78.9048 Constraint 161 285 16.4548 20.5685 30.8528 78.9048 Constraint 161 279 16.8686 21.0858 31.6287 78.9048 Constraint 161 272 13.2272 16.5340 24.8011 78.9048 Constraint 161 267 16.5506 20.6882 31.0324 78.9048 Constraint 161 259 14.9702 18.7127 28.0691 78.9048 Constraint 237 404 10.9242 13.6553 20.4830 78.6050 Constraint 201 404 14.6213 18.2766 27.4149 78.6050 Constraint 190 404 16.1126 20.1407 30.2111 78.6050 Constraint 279 404 15.4358 19.2947 28.9421 78.4704 Constraint 272 404 15.1160 18.8950 28.3425 78.4704 Constraint 267 404 13.9388 17.4234 26.1352 78.4704 Constraint 250 404 10.4191 13.0238 19.5357 78.4265 Constraint 237 350 15.4153 19.2692 28.9037 78.3851 Constraint 201 350 16.2871 20.3589 30.5384 78.3851 Constraint 190 350 15.1958 18.9947 28.4921 78.3851 Constraint 226 341 16.4124 20.5155 30.7732 78.3793 Constraint 322 404 12.6266 15.7832 23.6749 78.3514 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 221 404 12.4143 15.5179 23.2768 78.2633 Constraint 279 350 9.5044 11.8805 17.8208 78.2504 Constraint 272 350 11.8793 14.8491 22.2737 78.2504 Constraint 267 350 10.8510 13.5638 20.3456 78.2504 Constraint 250 350 14.0617 17.5771 26.3656 78.2066 Constraint 237 355 16.8648 21.0810 31.6215 78.1365 Constraint 201 355 18.3099 22.8874 34.3310 78.1365 Constraint 190 355 17.5142 21.8928 32.8391 78.1365 Constraint 242 442 5.9464 7.4330 11.1495 78.1082 Constraint 226 330 15.3310 19.1638 28.7456 78.0898 Constraint 221 350 12.0854 15.1068 22.6602 78.0433 Constraint 279 355 12.1387 15.1734 22.7601 78.0018 Constraint 272 355 14.4515 18.0643 27.0965 78.0018 Constraint 267 355 13.0818 16.3522 24.5283 78.0018 Constraint 161 242 13.1421 16.4276 24.6413 77.9592 Constraint 250 355 15.2555 19.0694 28.6040 77.9580 Constraint 221 355 14.1529 17.6911 26.5366 77.7947 Constraint 237 435 8.5614 10.7017 16.0525 77.7290 Constraint 201 435 12.1333 15.1666 22.7499 77.7290 Constraint 190 435 14.5325 18.1656 27.2484 77.7290 Constraint 237 412 7.7058 9.6323 14.4484 77.6204 Constraint 201 412 11.6055 14.5068 21.7603 77.6204 Constraint 190 412 12.8694 16.0867 24.1301 77.6204 Constraint 279 435 16.2182 20.2727 30.4091 77.5944 Constraint 272 435 14.7295 18.4119 27.6178 77.5944 Constraint 267 435 14.5283 18.1604 27.2406 77.5944 Constraint 250 435 10.2944 12.8680 19.3021 77.5505 Constraint 279 412 12.8848 16.1060 24.1590 77.4858 Constraint 272 412 12.0613 15.0766 22.6149 77.4858 Constraint 267 412 10.9032 13.6290 20.4436 77.4858 Constraint 314 435 11.4413 14.3017 21.4525 77.4754 Constraint 169 435 11.4649 14.3311 21.4967 77.4614 Constraint 250 412 6.9919 8.7399 13.1098 77.4419 Constraint 221 435 11.7229 14.6536 21.9805 77.3872 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 169 412 11.8530 14.8162 22.2244 77.3528 Constraint 169 404 14.0988 17.6235 26.4353 77.3528 Constraint 221 412 9.1466 11.4333 17.1499 77.2786 Constraint 237 399 11.6225 14.5282 21.7922 77.2226 Constraint 201 399 14.3825 17.9781 26.9672 77.2226 Constraint 190 399 15.2879 19.1099 28.6649 77.2226 Constraint 279 399 13.4741 16.8426 25.2639 77.0880 Constraint 272 399 13.7219 17.1524 25.7286 77.0880 Constraint 267 399 12.7295 15.9119 23.8678 77.0880 Constraint 250 399 11.1765 13.9706 20.9559 77.0441 Constraint 330 399 11.8276 14.7845 22.1767 76.9691 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 221 399 11.5527 14.4409 21.6613 76.8809 Constraint 341 404 14.5172 18.1465 27.2198 76.8538 Constraint 161 322 12.5736 15.7170 23.5756 76.8116 Constraint 226 429 13.3568 16.6960 25.0439 76.7136 Constraint 226 421 10.5117 13.1396 19.7094 76.7136 Constraint 330 404 15.3390 19.1738 28.7607 76.5642 Constraint 128 303 11.5995 14.4993 21.7490 76.5309 Constraint 128 297 9.2039 11.5049 17.2573 76.5309 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 285 11.3731 14.2164 21.3246 76.5309 Constraint 128 279 12.6012 15.7515 23.6272 76.5309 Constraint 128 272 10.0640 12.5799 18.8699 76.5309 Constraint 128 267 12.6754 15.8442 23.7663 76.5309 Constraint 128 259 10.6591 13.3239 19.9858 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 303 10.4289 13.0361 19.5541 76.5309 Constraint 104 297 8.7699 10.9623 16.4435 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 285 11.7606 14.7007 22.0511 76.5309 Constraint 104 279 12.8234 16.0292 24.0438 76.5309 Constraint 104 272 11.5604 14.4505 21.6758 76.5309 Constraint 104 267 13.8683 17.3354 26.0031 76.5309 Constraint 104 259 12.2704 15.3380 23.0069 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 237 442 5.7657 7.2071 10.8106 76.3955 Constraint 201 442 8.6108 10.7635 16.1452 76.3955 Constraint 190 442 11.0853 13.8566 20.7849 76.3955 Constraint 279 442 13.8163 17.2704 25.9056 76.2609 Constraint 272 442 11.7301 14.6626 21.9939 76.2609 Constraint 267 442 12.2904 15.3631 23.0446 76.2609 Constraint 161 237 10.7659 13.4574 20.1860 76.2466 Constraint 250 442 9.0862 11.3578 17.0367 76.2170 Constraint 169 350 15.6452 19.5566 29.3348 76.1483 Constraint 314 442 9.9883 12.4854 18.7281 76.1419 Constraint 169 442 8.1172 10.1466 15.2198 76.1279 Constraint 161 250 16.2246 20.2807 30.4211 76.0680 Constraint 221 442 8.7415 10.9268 16.3903 76.0538 Constraint 169 399 13.5221 16.9026 25.3539 75.9705 Constraint 169 355 17.5890 21.9863 32.9795 75.8997 Constraint 341 429 14.3255 17.9068 26.8602 75.8691 Constraint 341 421 11.4898 14.3622 21.5433 75.8691 Constraint 341 412 13.8049 17.2561 25.8842 75.8691 Constraint 226 404 13.7837 17.2296 25.8444 75.6050 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 104 242 11.4981 14.3726 21.5589 75.5853 Constraint 330 429 13.9294 17.4117 26.1176 75.5796 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 330 412 14.3025 17.8781 26.8172 75.5796 Constraint 136 303 14.4479 18.0599 27.0898 75.5603 Constraint 136 297 11.7726 14.7157 22.0736 75.5603 Constraint 136 292 10.8565 13.5706 20.3559 75.5603 Constraint 136 285 14.8782 18.5977 27.8966 75.5603 Constraint 136 279 15.5712 19.4640 29.1960 75.5603 Constraint 136 272 13.0259 16.2824 24.4236 75.5603 Constraint 136 267 16.0904 20.1130 30.1694 75.5603 Constraint 136 259 14.4178 18.0223 27.0335 75.5603 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 226 350 16.0278 20.0348 30.0522 75.3851 Constraint 322 435 13.1473 16.4341 24.6512 75.3822 Constraint 226 355 17.8265 22.2832 33.4248 75.1365 Constraint 161 330 16.3636 20.4544 30.6817 75.0244 Constraint 350 429 12.6638 15.8298 23.7446 74.8711 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 350 412 11.9101 14.8876 22.3314 74.8711 Constraint 226 435 11.9403 14.9254 22.3880 74.7290 Constraint 355 429 12.5629 15.7036 23.5554 74.6225 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 226 412 10.2311 12.7889 19.1833 74.6204 Constraint 136 242 12.9478 16.1848 24.2771 74.6147 Constraint 226 399 13.9937 17.4922 26.2383 74.2226 Constraint 322 442 10.8722 13.5903 20.3854 74.0487 Constraint 341 435 16.9266 21.1582 31.7373 73.8845 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 303 13.6099 17.0124 25.5186 73.8727 Constraint 122 297 12.1073 15.1341 22.7012 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 285 13.3253 16.6566 24.9849 73.8727 Constraint 122 279 15.3646 19.2057 28.8086 73.8727 Constraint 122 272 13.1702 16.4628 24.6942 73.8727 Constraint 122 267 15.0953 18.8692 28.3037 73.8727 Constraint 122 259 12.3283 15.4103 23.1155 73.8727 Constraint 122 237 9.7652 12.2065 18.3097 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 303 14.0408 17.5510 26.3265 73.8727 Constraint 113 297 12.5651 15.7064 23.5596 73.8727 Constraint 113 292 11.4170 14.2712 21.4068 73.8727 Constraint 113 285 14.8791 18.5989 27.8983 73.8727 Constraint 113 279 16.4215 20.5269 30.7903 73.8727 Constraint 113 272 14.7221 18.4027 27.6040 73.8727 Constraint 113 267 16.9487 21.1859 31.7788 73.8727 Constraint 113 259 14.6934 18.3668 27.5502 73.8727 Constraint 113 237 13.0904 16.3630 24.5445 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 190 14.0933 17.6166 26.4250 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 237 12.3132 15.3916 23.0873 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 104 190 11.6819 14.6023 21.9035 73.8727 Constraint 128 250 13.0108 16.2634 24.3952 73.6941 Constraint 104 250 15.3472 19.1840 28.7760 73.6941 Constraint 136 314 11.9606 14.9507 22.4261 73.6191 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 330 435 16.6111 20.7638 31.1458 73.5950 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 226 442 8.9853 11.2316 16.8474 73.3955 Constraint 122 242 10.0349 12.5437 18.8155 72.9271 Constraint 113 242 12.9781 16.2226 24.3339 72.9271 Constraint 136 237 12.1250 15.1562 22.7344 72.9020 Constraint 350 435 15.0926 18.8657 28.2986 72.8864 Constraint 136 250 16.6952 20.8690 31.3035 72.7235 Constraint 161 435 14.5428 18.1785 27.2677 72.7056 Constraint 161 429 14.3778 17.9722 26.9584 72.7056 Constraint 161 421 13.3310 16.6637 24.9956 72.7056 Constraint 355 435 15.3149 19.1436 28.7155 72.6378 Constraint 136 221 12.1229 15.1536 22.7304 72.5603 Constraint 341 442 15.3100 19.1374 28.7062 72.5510 Constraint 161 341 19.2451 24.0564 36.0845 72.4021 Constraint 128 341 13.1039 16.3799 24.5699 72.3505 Constraint 104 341 10.7662 13.4578 20.1866 72.3505 Constraint 330 442 14.4053 18.0066 27.0100 72.2616 Constraint 350 442 14.0108 17.5136 26.2703 71.5530 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 279 11.9043 14.8803 22.3205 71.4434 Constraint 96 272 10.8873 13.6091 20.4137 71.4434 Constraint 96 267 12.2068 15.2585 22.8877 71.4434 Constraint 96 259 9.8491 12.3114 18.4671 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 303 12.2685 15.3357 23.0035 71.4377 Constraint 88 297 12.0961 15.1201 22.6802 71.4377 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 285 13.0498 16.3123 24.4684 71.4377 Constraint 88 279 15.4296 19.2870 28.9305 71.4377 Constraint 88 272 14.5615 18.2019 27.3028 71.4377 Constraint 88 267 15.6937 19.6171 29.4256 71.4377 Constraint 88 259 13.0518 16.3148 24.4722 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 88 182 11.5724 14.4655 21.6983 71.4377 Constraint 88 176 13.2501 16.5626 24.8439 71.4377 Constraint 136 341 15.3226 19.1532 28.7298 71.3799 Constraint 161 442 11.6363 14.5454 21.8181 71.3721 Constraint 355 442 14.9023 18.6279 27.9419 71.3044 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 303 382 12.1960 15.2450 22.8675 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 297 382 14.3908 17.9885 26.9827 71.1209 Constraint 292 391 7.9484 9.9355 14.9032 71.1209 Constraint 292 382 11.5404 14.4255 21.6383 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 285 382 10.2339 12.7924 19.1885 71.1209 Constraint 259 391 6.6353 8.2941 12.4412 71.1209 Constraint 259 382 9.4031 11.7538 17.6308 71.1209 Constraint 237 391 10.3470 12.9338 19.4006 71.1209 Constraint 237 382 12.0519 15.0648 22.5973 71.1209 Constraint 210 391 9.6662 12.0828 18.1242 71.1209 Constraint 210 382 12.6264 15.7830 23.6745 71.1209 Constraint 201 391 13.3673 16.7091 25.0636 71.1209 Constraint 201 382 15.9987 19.9983 29.9975 71.1209 Constraint 190 391 13.4958 16.8698 25.3046 71.1209 Constraint 190 382 16.5549 20.6936 31.0404 71.1209 Constraint 182 391 11.7541 14.6926 22.0389 71.1209 Constraint 182 382 15.2742 19.0928 28.6392 71.1209 Constraint 176 391 14.7426 18.4282 27.6423 71.1209 Constraint 176 382 17.9048 22.3810 33.5715 71.1209 Constraint 122 250 13.9396 17.4245 26.1367 71.0359 Constraint 113 250 16.9112 21.1390 31.7085 71.0359 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 113 314 10.8516 13.5645 20.3467 70.9608 Constraint 128 226 10.2451 12.8064 19.2096 70.8727 Constraint 122 226 12.2553 15.3191 22.9787 70.8727 Constraint 122 221 11.0976 13.8720 20.8080 70.8727 Constraint 113 226 15.1378 18.9223 28.3834 70.8727 Constraint 113 221 13.4325 16.7907 25.1860 70.8727 Constraint 104 226 13.5350 16.9187 25.3781 70.8727 Constraint 303 449 13.1094 16.3868 24.5801 70.7960 Constraint 297 449 12.2309 15.2886 22.9329 70.7960 Constraint 292 449 9.4730 11.8412 17.7618 70.7960 Constraint 285 449 12.3231 15.4039 23.1058 70.7960 Constraint 259 449 10.9593 13.6991 20.5487 70.7960 Constraint 210 449 7.1103 8.8878 13.3318 70.7960 Constraint 182 449 10.4260 13.0326 19.5488 70.7960 Constraint 176 449 11.2144 14.0180 21.0269 70.7960 Constraint 161 412 15.6885 19.6106 29.4159 70.6124 Constraint 161 404 17.6677 22.0846 33.1269 70.6124 Constraint 96 242 8.7861 10.9826 16.4739 70.4979 Constraint 88 242 11.4801 14.3501 21.5251 70.4921 Constraint 144 314 13.8053 17.2566 25.8850 70.3651 Constraint 144 303 16.9080 21.1350 31.7025 70.3651 Constraint 144 297 14.6034 18.2543 27.3815 70.3651 Constraint 144 292 12.8734 16.0918 24.1377 70.3651 Constraint 144 285 16.8376 21.0470 31.5704 70.3651 Constraint 144 279 18.1650 22.7062 34.0593 70.3651 Constraint 144 272 15.3928 19.2410 28.8615 70.3651 Constraint 144 267 18.0944 22.6180 33.9270 70.3651 Constraint 144 259 15.7303 19.6629 29.4944 70.3651 Constraint 144 237 12.1445 15.1806 22.7710 70.3651 Constraint 128 435 11.3295 14.1619 21.2428 70.3317 Constraint 128 429 9.9404 12.4255 18.6383 70.3317 Constraint 128 421 7.9979 9.9974 14.9961 70.3317 Constraint 104 435 13.8044 17.2555 25.8833 70.3317 Constraint 104 429 11.4047 14.2559 21.3838 70.3317 Constraint 104 421 9.4483 11.8104 17.7156 70.3317 Constraint 242 391 6.5818 8.2273 12.3410 70.1753 Constraint 242 382 8.7756 10.9695 16.4543 70.1753 Constraint 136 226 13.3731 16.7164 25.0746 69.9020 Constraint 242 449 8.5889 10.7361 16.1041 69.8504 Constraint 303 375 12.3813 15.4766 23.2149 69.8228 Constraint 297 375 15.0767 18.8458 28.2688 69.8228 Constraint 292 375 12.7174 15.8968 23.8451 69.8228 Constraint 285 375 11.6796 14.5995 21.8993 69.8228 Constraint 259 375 11.6638 14.5798 21.8697 69.8228 Constraint 237 375 14.4052 18.0065 27.0098 69.8228 Constraint 210 375 14.0296 17.5370 26.3055 69.8228 Constraint 201 375 17.8734 22.3417 33.5126 69.8228 Constraint 190 375 18.5430 23.1788 34.7682 69.8228 Constraint 182 375 16.4479 20.5598 30.8397 69.8228 Constraint 176 375 19.3454 24.1817 36.2726 69.8228 Constraint 136 330 12.3760 15.4701 23.2051 69.7387 Constraint 128 330 10.6121 13.2651 19.8977 69.7387 Constraint 104 330 8.1029 10.1287 15.1930 69.7387 Constraint 122 341 14.6955 18.3694 27.5541 69.6923 Constraint 113 341 14.2338 17.7922 26.6884 69.6923 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 144 242 13.4383 16.7979 25.1969 69.4195 Constraint 161 350 19.3191 24.1489 36.2233 69.4078 Constraint 136 435 14.6021 18.2526 27.3789 69.3611 Constraint 136 429 13.0660 16.3325 24.4988 69.3611 Constraint 136 421 11.6968 14.6210 21.9315 69.3611 Constraint 128 350 13.1454 16.4318 24.6477 69.3563 Constraint 104 350 11.5460 14.4326 21.6488 69.3563 Constraint 96 350 9.5716 11.9645 17.9467 69.3563 Constraint 96 341 10.1789 12.7236 19.0855 69.3563 Constraint 88 341 12.3224 15.4031 23.1046 69.3505 Constraint 161 399 17.2702 21.5878 32.3817 69.2300 Constraint 161 355 21.3089 26.6361 39.9541 69.1592 Constraint 128 442 8.3577 10.4471 15.6707 68.9982 Constraint 104 442 11.2918 14.1148 21.1721 68.9982 Constraint 242 375 11.0519 13.8148 20.7222 68.8772 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 169 449 7.7702 9.7127 14.5691 68.8548 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 96 190 11.4113 14.2641 21.3962 68.7852 Constraint 88 237 12.8760 16.0951 24.1426 68.7794 Constraint 88 201 13.3038 16.6297 24.9446 68.7794 Constraint 88 190 14.8554 18.5692 27.8539 68.7794 Constraint 96 250 12.6918 15.8648 23.7972 68.6067 Constraint 88 250 15.2774 19.0967 28.6451 68.6009 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 88 161 13.1158 16.3948 24.5921 68.5258 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 221 12.9491 16.1863 24.2795 68.4377 Constraint 136 350 15.9599 19.9499 29.9249 68.3857 Constraint 279 391 10.9033 13.6291 20.4437 68.3280 Constraint 279 382 14.1760 17.7201 26.5801 68.3280 Constraint 272 391 11.4246 14.2807 21.4211 68.3280 Constraint 272 382 14.7051 18.3813 27.5720 68.3280 Constraint 267 391 9.6439 12.0548 18.0822 68.3280 Constraint 267 382 12.4450 15.5563 23.3344 68.3280 Constraint 250 391 8.3797 10.4747 15.7120 68.2841 Constraint 250 382 9.3891 11.7364 17.6046 68.2841 Constraint 144 322 11.4516 14.3145 21.4717 68.2719 Constraint 128 412 11.3330 14.1662 21.2493 68.2385 Constraint 128 404 13.0213 16.2766 24.4149 68.2385 Constraint 104 412 13.3598 16.6998 25.0496 68.2385 Constraint 104 404 14.4214 18.0267 27.0401 68.2385 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 322 382 13.6503 17.0629 25.5943 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 237 449 8.8369 11.0462 16.5693 68.1377 Constraint 201 449 9.9836 12.4795 18.7192 68.1377 Constraint 190 449 12.4949 15.6186 23.4280 68.1377 Constraint 226 391 11.9097 14.8871 22.3307 68.1209 Constraint 226 382 14.0742 17.5927 26.3891 68.1209 Constraint 221 391 9.3794 11.7243 17.5864 68.1209 Constraint 221 382 12.3923 15.4904 23.2355 68.1209 Constraint 136 442 11.7962 14.7452 22.1178 68.0276 Constraint 279 449 14.9583 18.6978 28.0468 68.0031 Constraint 272 449 13.0684 16.3355 24.5033 68.0031 Constraint 267 449 14.2571 17.8214 26.7321 68.0031 Constraint 250 449 12.3107 15.3884 23.0826 67.9592 Constraint 314 449 9.5514 11.9393 17.9089 67.8842 Constraint 221 449 10.5999 13.2499 19.8748 67.7960 Constraint 122 435 10.5257 13.1572 19.7357 67.6735 Constraint 122 429 8.3417 10.4271 15.6407 67.6735 Constraint 122 421 8.0108 10.0135 15.0202 67.6735 Constraint 113 435 13.9336 17.4170 26.1254 67.6735 Constraint 113 429 11.3022 14.1278 21.1917 67.6735 Constraint 113 421 10.6751 13.3439 20.0158 67.6735 Constraint 144 250 17.1909 21.4886 32.2329 67.5284 Constraint 144 226 14.2558 17.8197 26.7296 67.3651 Constraint 144 221 13.7347 17.1684 25.7526 67.3651 Constraint 136 412 15.1135 18.8919 28.3378 67.2679 Constraint 136 404 16.5409 20.6762 31.0143 67.2679 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 297 368 12.8890 16.1113 24.1669 67.2518 Constraint 297 360 9.7917 12.2396 18.3594 67.2518 Constraint 292 368 10.8154 13.5192 20.2788 67.2518 Constraint 292 360 8.1736 10.2170 15.3256 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 259 368 9.3375 11.6718 17.5077 67.2518 Constraint 259 360 8.5248 10.6561 15.9841 67.2518 Constraint 237 368 13.6639 17.0799 25.6199 67.2518 Constraint 237 360 12.5806 15.7257 23.5886 67.2518 Constraint 210 368 13.0708 16.3385 24.5078 67.2518 Constraint 210 360 10.5815 13.2269 19.8403 67.2518 Constraint 201 368 16.8525 21.0656 31.5984 67.2518 Constraint 201 360 14.6518 18.3148 27.4721 67.2518 Constraint 190 368 16.7140 20.8925 31.3387 67.2518 Constraint 190 360 14.5238 18.1548 27.2322 67.2518 Constraint 182 368 14.8235 18.5294 27.7941 67.2518 Constraint 182 360 11.8307 14.7883 22.1825 67.2518 Constraint 176 368 18.0987 22.6234 33.9351 67.2518 Constraint 176 360 15.2616 19.0770 28.6155 67.2518 Constraint 96 435 10.6424 13.3030 19.9544 67.2404 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 421 5.9672 7.4590 11.1885 67.2404 Constraint 96 412 9.8431 12.3038 18.4557 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 144 330 15.3530 19.1913 28.7869 67.0804 Constraint 122 330 12.7247 15.9059 23.8588 67.0804 Constraint 113 330 11.9235 14.9043 22.3565 67.0804 Constraint 279 375 15.6412 19.5515 29.3273 67.0299 Constraint 272 375 16.5395 20.6744 31.0116 67.0299 Constraint 267 375 14.6461 18.3076 27.4614 67.0299 Constraint 250 375 12.5102 15.6378 23.4567 66.9860 Constraint 341 449 14.6141 18.2677 27.4015 66.9156 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 128 399 11.4464 14.3080 21.4619 66.8561 Constraint 104 399 11.6909 14.6136 21.9205 66.8561 Constraint 226 375 16.6604 20.8255 31.2382 66.8228 Constraint 221 375 14.4295 18.0368 27.0552 66.8228 Constraint 128 355 14.9370 18.6712 28.0068 66.7853 Constraint 104 355 13.1450 16.4313 24.6469 66.7853 Constraint 96 355 10.7045 13.3806 20.0709 66.7853 Constraint 144 341 17.8932 22.3666 33.5498 66.7804 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 88 330 10.9722 13.7153 20.5729 66.7387 Constraint 122 350 14.1910 17.7388 26.6082 66.6980 Constraint 113 350 14.4859 18.1074 27.1611 66.6980 Constraint 88 350 11.8560 14.8200 22.2299 66.3563 Constraint 122 442 8.8749 11.0936 16.6404 66.3400 Constraint 113 442 12.0838 15.1048 22.6572 66.3400 Constraint 242 368 9.8064 12.2580 18.3871 66.3063 Constraint 242 360 8.9070 11.1338 16.7006 66.3063 Constraint 169 391 13.6441 17.0552 25.5827 66.2258 Constraint 169 382 16.3709 20.4636 30.6955 66.2258 Constraint 153 314 13.0488 16.3110 24.4666 66.1384 Constraint 153 303 15.9968 19.9960 29.9940 66.1384 Constraint 153 297 13.4446 16.8058 25.2087 66.1384 Constraint 153 292 11.1345 13.9181 20.8772 66.1384 Constraint 153 285 15.1049 18.8811 28.3217 66.1384 Constraint 153 279 16.4474 20.5593 30.8389 66.1384 Constraint 153 272 13.1853 16.4816 24.7224 66.1384 Constraint 153 267 15.8291 19.7864 29.6795 66.1384 Constraint 153 259 13.4413 16.8017 25.2025 66.1384 Constraint 153 237 9.0638 11.3297 16.9946 66.1384 Constraint 350 449 13.4384 16.7979 25.1969 65.9175 Constraint 96 442 8.7214 10.9017 16.3526 65.9069 Constraint 136 399 14.8506 18.5632 27.8448 65.8855 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 136 355 17.7419 22.1774 33.2661 65.8147 Constraint 322 449 9.5242 11.9052 17.8578 65.7909 Constraint 96 226 12.1570 15.1963 22.7945 65.7852 Constraint 88 226 15.2074 19.0093 28.5140 65.7794 Constraint 122 412 11.4740 14.3425 21.5137 65.5802 Constraint 122 404 11.9539 14.9423 22.4135 65.5802 Constraint 113 412 14.5360 18.1700 27.2550 65.5802 Constraint 113 404 14.8842 18.6053 27.9080 65.5802 Constraint 88 435 12.2472 15.3091 22.9636 65.2385 Constraint 88 429 8.7777 10.9721 16.4582 65.2385 Constraint 88 421 8.6668 10.8336 16.2503 65.2385 Constraint 88 412 12.4138 15.5172 23.2759 65.2385 Constraint 88 404 11.9222 14.9028 22.3542 65.2385 Constraint 153 242 10.9483 13.6854 20.5281 65.1928 Constraint 226 449 11.7395 14.6744 22.0116 65.1377 Constraint 161 449 10.7956 13.4945 20.2418 65.0913 Constraint 128 449 6.6636 8.3295 12.4943 65.0397 Constraint 104 449 9.0695 11.3369 17.0053 65.0397 Constraint 169 375 17.4876 21.8595 32.7892 64.9277 Constraint 279 368 12.6496 15.8119 23.7179 64.4590 Constraint 279 360 10.8108 13.5135 20.2702 64.4590 Constraint 272 368 14.1034 17.6292 26.4438 64.4590 Constraint 272 360 12.0089 15.0111 22.5167 64.4590 Constraint 267 368 11.6605 14.5756 21.8634 64.4590 Constraint 267 360 10.7038 13.3798 20.0697 64.4590 Constraint 250 368 10.7579 13.4474 20.1711 64.4151 Constraint 250 360 11.2648 14.0810 21.1214 64.4151 Constraint 226 368 15.1240 18.9050 28.3575 64.2518 Constraint 226 360 13.9440 17.4300 26.1450 64.2518 Constraint 221 368 12.4653 15.5816 23.3724 64.2518 Constraint 221 360 10.6900 13.3625 20.0438 64.2518 Constraint 122 399 10.4540 13.0675 19.6013 64.1979 Constraint 113 399 12.5923 15.7404 23.6106 64.1979 Constraint 144 435 13.5204 16.9005 25.3508 64.1659 Constraint 144 429 11.9727 14.9659 22.4488 64.1659 Constraint 144 421 11.9171 14.8964 22.3446 64.1659 Constraint 122 355 15.1090 18.8862 28.3294 64.1271 Constraint 113 355 15.4372 19.2965 28.9447 64.1271 Constraint 136 449 9.8028 12.2535 18.3802 64.0691 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 153 341 17.3889 21.7361 32.6042 64.0452 Constraint 153 330 15.1837 18.9796 28.4694 64.0452 Constraint 153 322 11.1467 13.9334 20.9000 64.0452 Constraint 303 467 17.5720 21.9650 32.9475 64.0416 Constraint 303 461 15.6253 19.5316 29.2974 64.0416 Constraint 297 467 17.6355 22.0444 33.0666 64.0416 Constraint 297 461 15.0957 18.8697 28.3045 64.0416 Constraint 292 467 15.1832 18.9791 28.4686 64.0416 Constraint 292 461 12.6116 15.7645 23.6467 64.0416 Constraint 285 467 17.2320 21.5400 32.3099 64.0416 Constraint 285 461 15.2428 19.0535 28.5803 64.0416 Constraint 279 467 20.2160 25.2700 37.9050 64.0416 Constraint 279 461 17.9048 22.3810 33.5715 64.0416 Constraint 272 467 18.9887 23.7359 35.6038 64.0416 Constraint 272 461 16.2829 20.3537 30.5305 64.0416 Constraint 267 467 19.5237 24.4046 36.6069 64.0416 Constraint 267 461 17.3266 21.6583 32.4874 64.0416 Constraint 259 467 16.0548 20.0684 30.1027 64.0416 Constraint 259 461 13.9814 17.4767 26.2151 64.0416 Constraint 210 467 13.6473 17.0591 25.5887 64.0416 Constraint 210 461 10.6273 13.2841 19.9261 64.0416 Constraint 182 467 16.6290 20.7862 31.1793 64.0416 Constraint 182 461 13.6385 17.0481 25.5722 64.0416 Constraint 176 467 17.6442 22.0552 33.0828 64.0416 Constraint 176 461 14.3706 17.9632 26.9448 64.0416 Constraint 128 467 12.4955 15.6194 23.4291 64.0416 Constraint 128 461 9.1306 11.4132 17.1199 64.0416 Constraint 104 467 13.6752 17.0941 25.6411 64.0416 Constraint 104 461 10.7731 13.4664 20.1997 64.0416 Constraint 330 449 13.2472 16.5590 24.8385 64.0038 Constraint 88 442 11.3327 14.1659 21.2488 63.9050 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 144 350 17.8972 22.3715 33.5572 63.7862 Constraint 88 355 12.0749 15.0937 22.6405 63.7853 Constraint 355 449 14.1716 17.7146 26.5718 63.3466 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 153 250 14.4503 18.0628 27.0942 63.3017 Constraint 153 226 11.1331 13.9164 20.8746 63.1384 Constraint 242 467 13.7530 17.1913 25.7869 63.0960 Constraint 242 461 11.5763 14.4704 21.7056 63.0960 Constraint 136 467 14.8584 18.5730 27.8595 63.0710 Constraint 136 461 11.4493 14.3116 21.4674 63.0710 Constraint 144 442 11.5926 14.4908 21.7361 62.8324 Constraint 122 449 5.8624 7.3280 10.9921 62.3815 Constraint 113 449 9.1549 11.4437 17.1655 62.3815 Constraint 169 368 17.1135 21.3919 32.0879 62.3568 Constraint 169 360 14.2884 17.8606 26.7908 62.3568 Constraint 169 467 14.1605 17.7006 26.5509 62.1004 Constraint 169 461 10.5923 13.2403 19.8605 62.1004 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 360 435 10.9784 13.7230 20.5845 62.0836 Constraint 144 412 14.9914 18.7392 28.1088 62.0727 Constraint 144 404 15.7542 19.6928 29.5392 62.0727 Constraint 404 467 8.6062 10.7577 16.1365 61.9484 Constraint 96 467 10.9026 13.6283 20.4424 61.9484 Constraint 96 461 8.2043 10.2554 15.3831 61.9484 Constraint 96 449 6.4940 8.1175 12.1762 61.9484 Constraint 237 467 14.5454 18.1818 27.2726 61.3834 Constraint 237 461 11.9989 14.9986 22.4979 61.3834 Constraint 201 467 16.4573 20.5717 30.8575 61.3834 Constraint 201 461 13.3525 16.6907 25.0360 61.3834 Constraint 190 467 18.9298 23.6622 35.4933 61.3834 Constraint 190 461 15.9409 19.9261 29.8892 61.3834 Constraint 122 467 9.8054 12.2567 18.3851 61.3834 Constraint 122 461 6.6982 8.3728 12.5591 61.3834 Constraint 113 467 12.3540 15.4425 23.1637 61.3834 Constraint 113 461 9.7093 12.1367 18.2050 61.3834 Constraint 144 399 14.7018 18.3772 27.5658 61.2860 Constraint 144 355 19.1630 23.9538 35.9307 61.2153 Constraint 250 467 16.8119 21.0149 31.5224 61.2049 Constraint 250 461 15.0625 18.8282 28.2423 61.2049 Constraint 314 467 13.8978 17.3723 26.0584 61.1298 Constraint 314 461 11.7460 14.6825 22.0237 61.1298 Constraint 161 467 16.1889 20.2361 30.3541 61.1298 Constraint 161 461 12.5624 15.7030 23.5545 61.1298 Constraint 153 350 16.8883 21.1103 31.6655 61.0510 Constraint 221 467 16.6312 20.7890 31.1834 61.0416 Constraint 221 461 14.0084 17.5105 26.2657 61.0416 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 360 442 10.5877 13.2346 19.8519 60.7501 Constraint 399 467 8.9970 11.2463 16.8694 60.1612 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 350 467 16.2382 20.2978 30.4467 60.1612 Constraint 350 461 15.0219 18.7774 28.1660 60.1612 Constraint 341 467 18.3556 22.9445 34.4168 60.1612 Constraint 341 461 16.8026 21.0033 31.5050 60.1612 Constraint 88 449 8.2624 10.3279 15.4919 59.9465 Constraint 153 435 10.5821 13.2276 19.8413 59.9392 Constraint 153 429 10.2938 12.8672 19.3008 59.9392 Constraint 153 421 9.6523 12.0654 18.0981 59.9392 Constraint 161 391 17.7387 22.1733 33.2600 59.4854 Constraint 161 382 20.2850 25.3562 38.0343 59.4854 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 297 11.5214 14.4017 21.6026 59.4573 Constraint 80 292 11.3872 14.2340 21.3511 59.4573 Constraint 80 285 13.7436 17.1796 25.7693 59.4573 Constraint 80 279 15.3431 19.1788 28.7682 59.4573 Constraint 80 272 15.0930 18.8662 28.2993 59.4573 Constraint 80 267 16.5109 20.6386 30.9580 59.4573 Constraint 80 259 14.6814 18.3517 27.5276 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 80 182 11.9628 14.9535 22.4303 59.4573 Constraint 80 176 13.9781 17.4726 26.2090 59.4573 Constraint 80 169 12.2715 15.3394 23.0090 59.4573 Constraint 80 161 14.2582 17.8228 26.7341 59.4573 Constraint 322 467 14.6646 18.3308 27.4962 59.0366 Constraint 322 461 11.7030 14.6288 21.9432 59.0366 Constraint 88 467 9.8977 12.3721 18.5582 58.9484 Constraint 88 461 7.9832 9.9790 14.9685 58.9484 Constraint 144 449 9.0832 11.3540 17.0309 58.8739 Constraint 153 442 7.8647 9.8308 14.7463 58.6058 Constraint 80 242 13.8726 17.3408 26.0111 58.5117 Constraint 153 355 18.3886 22.9857 34.4786 58.4800 Constraint 226 467 17.7242 22.1552 33.2328 58.3834 Constraint 226 461 15.1005 18.8756 28.3135 58.3834 Constraint 80 330 8.8597 11.0746 16.6119 58.2658 Constraint 153 399 13.3627 16.7034 25.0550 58.2508 Constraint 161 375 21.3350 26.6687 40.0030 58.1873 Constraint 80 355 12.3486 15.4358 23.1536 58.1658 Constraint 80 350 11.4497 14.3122 21.4683 58.1658 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 314 473 11.7297 14.6621 21.9932 57.9376 Constraint 303 473 15.3169 19.1461 28.7191 57.9376 Constraint 297 473 16.0638 20.0797 30.1196 57.9376 Constraint 292 473 13.6508 17.0635 25.5952 57.9376 Constraint 285 473 15.0249 18.7811 28.1717 57.9376 Constraint 279 473 18.2944 22.8681 34.3021 57.9376 Constraint 272 473 17.7011 22.1264 33.1896 57.9376 Constraint 267 473 17.6100 22.0125 33.0187 57.9376 Constraint 259 473 14.1766 17.7207 26.5811 57.9376 Constraint 210 473 13.1437 16.4297 24.6445 57.9376 Constraint 182 473 15.8511 19.8138 29.7207 57.9376 Constraint 176 473 17.6982 22.1227 33.1841 57.9376 Constraint 169 473 14.6095 18.2619 27.3928 57.9376 Constraint 161 473 17.4749 21.8437 32.7655 57.9376 Constraint 136 473 15.7564 19.6955 29.5433 57.9376 Constraint 128 473 12.9168 16.1461 24.2191 57.9376 Constraint 104 473 13.6414 17.0517 25.5776 57.9376 Constraint 144 467 12.9489 16.1862 24.2793 57.8758 Constraint 144 461 9.5255 11.9069 17.8603 57.8758 Constraint 153 412 11.9549 14.9436 22.4154 57.8460 Constraint 153 404 13.6982 17.1227 25.6841 57.8460 Constraint 355 467 15.5985 19.4981 29.2472 57.5903 Constraint 355 461 15.0302 18.7877 28.1816 57.5903 Constraint 314 480 13.7995 17.2494 25.8741 57.5533 Constraint 303 480 17.3544 21.6930 32.5396 57.5533 Constraint 297 480 18.1636 22.7045 34.0568 57.5533 Constraint 292 480 16.1858 20.2322 30.3483 57.5533 Constraint 285 480 17.7240 22.1550 33.2325 57.5533 Constraint 279 480 20.7961 25.9952 38.9928 57.5533 Constraint 272 480 20.3156 25.3946 38.0918 57.5533 Constraint 267 480 20.4740 25.5925 38.3887 57.5533 Constraint 259 480 17.2174 21.5217 32.2825 57.5533 Constraint 210 480 15.7047 19.6309 29.4463 57.5533 Constraint 182 480 18.1012 22.6265 33.9397 57.5533 Constraint 176 480 19.9170 24.8962 37.3443 57.5533 Constraint 169 480 16.6425 20.8032 31.2048 57.5533 Constraint 161 480 18.9635 23.7043 35.5565 57.5533 Constraint 136 480 16.6838 20.8548 31.2822 57.5533 Constraint 128 480 14.5714 18.2143 27.3214 57.5533 Constraint 104 480 14.5416 18.1770 27.2655 57.5533 Constraint 330 467 17.9410 22.4262 33.6393 57.2494 Constraint 330 461 15.4076 19.2595 28.8893 57.2494 Constraint 128 391 12.0854 15.1068 22.6602 57.1115 Constraint 128 382 15.1864 18.9830 28.4745 57.1115 Constraint 122 391 12.4687 15.5858 23.3787 57.1115 Constraint 122 382 14.9938 18.7422 28.1133 57.1115 Constraint 113 391 14.6419 18.3024 27.4536 57.1115 Constraint 113 382 17.5753 21.9692 32.9538 57.1115 Constraint 104 391 12.6815 15.8518 23.7778 57.1115 Constraint 104 382 16.1573 20.1966 30.2949 57.1115 Constraint 242 473 12.4348 15.5435 23.3152 56.9920 Constraint 80 237 15.5348 19.4186 29.1278 56.7990 Constraint 80 201 15.0369 18.7961 28.1942 56.7990 Constraint 80 190 15.8660 19.8325 29.7488 56.7990 Constraint 80 250 17.6755 22.0944 33.1416 56.6205 Constraint 242 480 15.5548 19.4435 29.1653 56.6077 Constraint 80 221 14.3677 17.9597 26.9395 56.4573 Constraint 382 449 11.9282 14.9103 22.3654 56.3613 Constraint 136 391 15.8212 19.7765 29.6648 56.1409 Constraint 136 382 18.9301 23.6627 35.4940 56.1409 Constraint 96 391 9.1738 11.4673 17.2009 56.1134 Constraint 96 382 12.4647 15.5809 23.3713 56.1134 Constraint 80 435 15.4644 19.3305 28.9958 56.0639 Constraint 80 429 12.0844 15.1055 22.6582 56.0639 Constraint 80 421 11.1311 13.9138 20.8708 56.0639 Constraint 80 412 15.0555 18.8194 28.2291 56.0639 Constraint 80 404 15.0448 18.8060 28.2090 56.0639 Constraint 322 473 13.2477 16.5596 24.8394 55.8443 Constraint 128 375 15.7178 19.6473 29.4709 55.8134 Constraint 122 375 14.6804 18.3505 27.5258 55.8134 Constraint 113 375 16.8144 21.0180 31.5271 55.8134 Constraint 104 375 15.8625 19.8281 29.7422 55.8134 Constraint 96 375 11.9794 14.9742 22.4613 55.8134 Constraint 161 368 21.2734 26.5917 39.8875 55.6164 Constraint 161 360 18.2380 22.7975 34.1963 55.6164 Constraint 341 480 17.0513 21.3142 31.9713 55.4600 Constraint 330 480 17.1267 21.4084 32.1126 55.4600 Constraint 322 480 14.8543 18.5678 27.8518 55.4600 Constraint 375 449 12.4316 15.5394 23.3092 55.3633 Constraint 421 480 10.4981 13.1226 19.6839 55.3408 Constraint 237 473 14.3567 17.9458 26.9188 55.2793 Constraint 201 473 16.6031 20.7539 31.1308 55.2793 Constraint 190 473 18.3479 22.9349 34.4023 55.2793 Constraint 122 473 11.1544 13.9430 20.9146 55.2793 Constraint 113 473 13.4138 16.7673 25.1510 55.2793 Constraint 250 473 15.3371 19.1714 28.7570 55.1008 Constraint 412 473 8.9148 11.1434 16.7152 55.0347 Constraint 404 473 6.1353 7.6691 11.5037 55.0347 Constraint 153 449 6.3721 7.9651 11.9477 54.9472 Constraint 221 473 15.4242 19.2803 28.9204 54.9376 Constraint 237 480 17.3183 21.6479 32.4718 54.8950 Constraint 201 480 19.1175 23.8968 35.8453 54.8950 Constraint 190 480 20.9392 26.1740 39.2609 54.8950 Constraint 144 480 15.1195 18.8993 28.3490 54.8950 Constraint 122 480 12.0898 15.1122 22.6683 54.8950 Constraint 113 480 13.5867 16.9834 25.4751 54.8950 Constraint 80 399 11.6889 14.6111 21.9166 54.8724 Constraint 96 473 10.2539 12.8174 19.2260 54.8463 Constraint 136 375 19.2055 24.0068 36.0102 54.8428 Constraint 80 442 13.8777 17.3471 26.0207 54.7304 Constraint 250 480 18.6016 23.2520 34.8780 54.7165 Constraint 144 473 14.6662 18.3327 27.4990 54.6836 Constraint 221 480 18.2277 22.7846 34.1769 54.5533 Constraint 144 391 16.5486 20.6857 31.0286 54.1997 Constraint 144 382 18.9871 23.7338 35.6007 54.1997 Constraint 88 391 11.8314 14.7893 22.1839 54.1115 Constraint 88 382 14.4142 18.0178 27.0267 54.1115 Constraint 341 473 15.7503 19.6879 29.5318 54.0572 Constraint 330 473 16.0109 20.0136 30.0204 54.0572 Constraint 153 467 11.9314 14.9143 22.3714 53.9491 Constraint 153 461 8.1479 10.1849 15.2774 53.9491 Constraint 80 226 17.2108 21.5135 32.2703 53.7990 Constraint 399 480 8.8126 11.0157 16.5236 53.6524 Constraint 350 480 15.2320 19.0401 28.5601 53.4639 Constraint 96 480 11.7345 14.6681 22.0022 53.4639 Constraint 412 480 12.4549 15.5686 23.3529 53.2475 Constraint 404 480 9.7235 12.1544 18.2316 53.2475 Constraint 399 473 5.6590 7.0738 10.6107 53.2475 Constraint 128 368 15.3056 19.1320 28.6981 53.2425 Constraint 128 360 11.8528 14.8161 22.2241 53.2425 Constraint 122 368 15.1560 18.9450 28.4175 53.2425 Constraint 122 360 11.8004 14.7506 22.1258 53.2425 Constraint 113 368 17.0331 21.2914 31.9371 53.2425 Constraint 113 360 13.0997 16.3746 24.5619 53.2425 Constraint 104 368 15.2357 19.0447 28.5670 53.2425 Constraint 104 360 11.1395 13.9244 20.8866 53.2425 Constraint 96 368 11.6186 14.5232 21.7848 53.2425 Constraint 96 360 7.7682 9.7103 14.5654 53.2425 Constraint 350 473 13.1449 16.4311 24.6467 53.0591 Constraint 144 375 18.9344 23.6680 35.5021 52.9016 Constraint 88 473 10.4292 13.0365 19.5547 52.8443 Constraint 88 375 12.9312 16.1640 24.2460 52.8134 Constraint 368 449 12.9133 16.1416 24.2124 52.7923 Constraint 360 449 10.3388 12.9234 19.3852 52.7923 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 88 480 10.3759 12.9699 19.4548 52.4600 Constraint 226 473 17.2214 21.5268 32.2902 52.2793 Constraint 136 368 19.0173 23.7716 35.6574 52.2719 Constraint 136 360 15.2613 19.0766 28.6149 52.2719 Constraint 153 480 14.7197 18.3996 27.5995 52.1598 Constraint 226 480 20.1636 25.2045 37.8067 51.8950 Constraint 153 391 14.3310 17.9137 26.8706 51.1644 Constraint 153 382 16.7291 20.9113 31.3670 51.1644 Constraint 80 467 13.6346 17.0433 25.5649 50.9718 Constraint 80 461 11.2689 14.0861 21.1291 50.9718 Constraint 80 449 11.0067 13.7584 20.6376 50.9718 Constraint 355 480 13.8117 17.2646 25.8969 50.8929 Constraint 153 473 13.5545 16.9431 25.4147 50.7569 Constraint 355 473 12.1684 15.2105 22.8158 50.4881 Constraint 144 368 19.5643 24.4554 36.6831 50.3306 Constraint 144 360 16.1658 20.2072 30.3108 50.3306 Constraint 88 368 13.4767 16.8458 25.2687 50.2425 Constraint 88 360 9.7651 12.2064 18.3096 50.2425 Constraint 153 375 17.6199 22.0248 33.0372 50.1663 Constraint 391 467 12.5117 15.6397 23.4595 49.6070 Constraint 391 461 11.5202 14.4002 21.6004 49.6070 Constraint 382 467 12.8879 16.1098 24.1647 49.6070 Constraint 382 461 12.8336 16.0420 24.0629 49.6070 Constraint 375 467 11.7133 14.6416 21.9624 49.6070 Constraint 375 461 12.3793 15.4741 23.2112 49.6070 Constraint 153 368 17.7044 22.1305 33.1957 47.5954 Constraint 153 360 14.6711 18.3388 27.5083 47.5954 Constraint 368 467 14.2511 17.8138 26.7208 47.0360 Constraint 368 461 13.9886 17.4858 26.2286 47.0360 Constraint 360 467 12.6759 15.8448 23.7672 47.0360 Constraint 360 461 11.6849 14.6061 21.9091 47.0360 Constraint 80 391 13.6811 17.1013 25.6520 46.6210 Constraint 80 382 16.8194 21.0243 31.5364 46.6210 Constraint 80 375 15.1809 18.9761 28.4641 46.5210 Constraint 80 368 15.1524 18.9405 28.4108 46.5210 Constraint 80 360 10.9690 13.7112 20.5668 46.5210 Constraint 80 473 13.4264 16.7830 25.1746 46.3767 Constraint 80 480 13.3452 16.6816 25.0223 45.1853 Constraint 391 480 12.7626 15.9533 23.9299 43.9077 Constraint 382 480 13.1898 16.4873 24.7309 43.9077 Constraint 391 473 9.5624 11.9530 17.9296 43.5029 Constraint 382 473 9.9022 12.3778 18.5667 43.5029 Constraint 375 480 10.7807 13.4759 20.2139 42.9096 Constraint 375 473 7.8248 9.7810 14.6715 42.5048 Constraint 368 480 13.5997 16.9996 25.4995 40.3387 Constraint 360 480 12.0384 15.0480 22.5720 40.3387 Constraint 368 473 10.5715 13.2144 19.8216 39.9339 Constraint 360 473 9.4098 11.7622 17.6433 39.9339 Constraint 314 489 12.6650 15.8312 23.7469 39.5726 Constraint 303 489 16.0683 20.0853 30.1280 39.5726 Constraint 297 489 16.1941 20.2427 30.3640 39.5726 Constraint 292 489 14.5203 18.1504 27.2256 39.5726 Constraint 285 489 16.6491 20.8114 31.2171 39.5726 Constraint 279 489 19.2529 24.0661 36.0992 39.5726 Constraint 272 489 18.4910 23.1137 34.6706 39.5726 Constraint 267 489 19.2055 24.0069 36.0104 39.5726 Constraint 259 489 16.1736 20.2170 30.3256 39.5726 Constraint 210 489 13.7490 17.1862 25.7793 39.5726 Constraint 182 489 15.8224 19.7780 29.6670 39.5726 Constraint 176 489 17.4700 21.8375 32.7562 39.5726 Constraint 169 489 14.2552 17.8190 26.7286 39.5726 Constraint 161 489 16.3598 20.4498 30.6747 39.5726 Constraint 136 489 13.9390 17.4238 26.1357 39.5726 Constraint 128 489 11.9907 14.9884 22.4825 39.5726 Constraint 104 489 12.1438 15.1797 22.7696 39.5726 Constraint 242 489 14.5631 18.2039 27.3059 38.6270 Constraint 221 489 16.5342 20.6678 31.0016 38.5726 Constraint 429 489 6.7792 8.4740 12.7110 38.3582 Constraint 421 489 9.0995 11.3744 17.0615 38.3582 Constraint 341 489 16.1817 20.2272 30.3407 37.4794 Constraint 330 489 15.3793 19.2241 28.8362 37.4794 Constraint 322 489 12.8242 16.0302 24.0453 37.4794 Constraint 88 489 8.3492 10.4365 15.6548 37.4794 Constraint 314 613 18.9956 23.7446 35.6168 37.4309 Constraint 303 613 20.5765 25.7207 38.5810 37.4309 Constraint 297 613 21.2661 26.5827 39.8740 37.4309 Constraint 292 613 20.7694 25.9617 38.9426 37.4309 Constraint 285 613 21.7948 27.2435 40.8652 37.4309 Constraint 279 613 23.3415 29.1769 43.7654 37.4309 Constraint 267 613 23.8652 29.8314 44.7472 37.4309 Constraint 259 613 22.2670 27.8337 41.7506 37.4309 Constraint 237 613 22.6110 28.2638 42.3957 37.4309 Constraint 210 613 20.5536 25.6920 38.5379 37.4309 Constraint 314 497 9.8793 12.3492 18.5237 37.3017 Constraint 303 497 13.4302 16.7877 25.1816 37.3017 Constraint 297 497 13.9158 17.3948 26.0921 37.3017 Constraint 292 497 12.0306 15.0382 22.5573 37.3017 Constraint 285 497 13.8922 17.3653 26.0479 37.3017 Constraint 279 497 16.7366 20.9207 31.3811 37.3017 Constraint 272 497 16.2250 20.2812 30.4218 37.3017 Constraint 267 497 16.5513 20.6891 31.0337 37.3017 Constraint 259 497 13.5115 16.8894 25.3341 37.3017 Constraint 210 497 11.9378 14.9223 22.3834 37.3017 Constraint 182 497 14.0605 17.5756 26.3634 37.3017 Constraint 176 497 16.2035 20.2544 30.3816 37.3017 Constraint 169 497 13.3721 16.7151 25.0727 37.3017 Constraint 161 497 16.2200 20.2750 30.4125 37.3017 Constraint 136 497 13.3090 16.6362 24.9544 37.3017 Constraint 128 497 10.8862 13.6078 20.4117 37.3017 Constraint 104 497 10.6700 13.3375 20.0063 37.3017 Constraint 237 489 16.2776 20.3470 30.5205 36.9144 Constraint 201 489 17.0410 21.3013 31.9519 36.9144 Constraint 190 489 18.7923 23.4903 35.2355 36.9144 Constraint 144 489 12.6766 15.8458 23.7686 36.9144 Constraint 122 489 9.7827 12.2283 18.3425 36.9144 Constraint 113 489 11.4139 14.2674 21.4011 36.9144 Constraint 250 489 17.9289 22.4111 33.6166 36.7359 Constraint 399 489 9.1411 11.4264 17.1395 36.6698 Constraint 242 613 20.8446 26.0558 39.0836 36.4853 Constraint 350 489 14.7651 18.4564 27.6846 36.4813 Constraint 96 489 9.2763 11.5954 17.3932 36.4813 Constraint 314 604 16.8527 21.0659 31.5989 36.4431 Constraint 303 604 18.4447 23.0558 34.5837 36.4431 Constraint 297 604 18.8766 23.5957 35.3936 36.4431 Constraint 292 604 18.3145 22.8931 34.3397 36.4431 Constraint 285 604 19.5540 24.4425 36.6637 36.4431 Constraint 279 604 20.9985 26.2481 39.3721 36.4431 Constraint 272 604 20.9621 26.2026 39.3039 36.4431 Constraint 267 604 21.5262 26.9078 40.3617 36.4431 Constraint 259 604 19.9726 24.9657 37.4486 36.4431 Constraint 237 604 20.5568 25.6960 38.5440 36.4431 Constraint 210 604 18.1292 22.6615 33.9922 36.4431 Constraint 182 604 19.1511 23.9389 35.9083 36.4431 Constraint 272 613 22.9557 28.6946 43.0419 36.4328 Constraint 201 613 22.5779 28.2224 42.3336 36.4328 Constraint 190 613 23.7019 29.6274 44.4411 36.4328 Constraint 182 613 21.1253 26.4066 39.6099 36.4328 Constraint 176 613 22.7155 28.3944 42.5915 36.4328 Constraint 242 497 12.1688 15.2110 22.8165 36.3561 Constraint 221 497 14.2691 17.8364 26.7546 36.3017 Constraint 314 622 19.4847 24.3559 36.5338 36.2850 Constraint 303 622 20.8770 26.0962 39.1444 36.2850 Constraint 297 622 21.4303 26.7879 40.1819 36.2850 Constraint 292 622 20.7204 25.9005 38.8507 36.2850 Constraint 285 622 21.6103 27.0129 40.5193 36.2850 Constraint 279 622 23.0701 28.8376 43.2564 36.2850 Constraint 272 622 22.9711 28.7139 43.0709 36.2850 Constraint 267 622 23.3212 29.1515 43.7272 36.2850 Constraint 259 622 21.7649 27.2061 40.8091 36.2850 Constraint 210 622 20.3361 25.4201 38.1301 36.2850 Constraint 182 622 21.4997 26.8746 40.3120 36.2850 Constraint 412 489 11.7543 14.6929 22.0393 36.2650 Constraint 404 489 10.3346 12.9183 19.3774 36.2650 Constraint 435 497 9.0386 11.2982 16.9473 36.0872 Constraint 429 497 5.5055 6.8819 10.3228 36.0872 Constraint 421 497 6.5914 8.2393 12.3589 36.0872 Constraint 226 489 18.6792 23.3491 35.0236 35.9144 Constraint 242 604 18.6393 23.2991 34.9487 35.4975 Constraint 201 604 20.2610 25.3262 37.9894 35.4450 Constraint 190 604 21.2841 26.6051 39.9077 35.4450 Constraint 176 604 20.2721 25.3402 38.0103 35.4450 Constraint 242 622 20.3005 25.3756 38.0634 35.3394 Constraint 322 613 18.9145 23.6432 35.4647 35.3377 Constraint 201 622 21.9194 27.3993 41.0989 35.2869 Constraint 176 622 22.3507 27.9384 41.9076 35.2869 Constraint 330 497 13.0412 16.3015 24.4522 35.2084 Constraint 322 497 10.5037 13.1297 19.6945 35.2084 Constraint 88 497 7.4750 9.3437 14.0156 35.2084 Constraint 341 497 13.2970 16.6213 24.9319 34.9084 Constraint 237 497 14.4712 18.0890 27.1334 34.6434 Constraint 201 497 15.6746 19.5933 29.3899 34.6434 Constraint 190 497 17.1161 21.3951 32.0927 34.6434 Constraint 144 497 12.9513 16.1892 24.2837 34.6434 Constraint 122 497 9.3894 11.7367 17.6051 34.6434 Constraint 113 497 10.9198 13.6498 20.4747 34.6434 Constraint 250 613 23.0497 28.8121 43.2182 34.5942 Constraint 314 629 19.0633 23.8292 35.7437 34.4876 Constraint 303 629 20.4308 25.5384 38.3077 34.4876 Constraint 297 629 20.8038 26.0047 39.0071 34.4876 Constraint 292 629 20.0703 25.0879 37.6318 34.4876 Constraint 285 629 21.0534 26.3168 39.4752 34.4876 Constraint 279 629 22.4005 28.0006 42.0009 34.4876 Constraint 259 629 21.2279 26.5349 39.8024 34.4876 Constraint 210 629 19.6887 24.6108 36.9162 34.4876 Constraint 201 629 21.6925 27.1157 40.6735 34.4876 Constraint 182 629 20.7766 25.9708 38.9562 34.4876 Constraint 176 629 22.0893 27.6117 41.4175 34.4876 Constraint 250 497 15.5550 19.4438 29.1657 34.4649 Constraint 226 604 22.3606 27.9507 41.9261 34.4431 Constraint 221 604 20.1839 25.2299 37.8448 34.4431 Constraint 221 613 22.6741 28.3426 42.5139 34.4309 Constraint 399 497 6.1548 7.6934 11.5402 34.3988 Constraint 322 604 16.5075 20.6344 30.9516 34.3498 Constraint 96 497 7.2143 9.0179 13.5269 34.2104 Constraint 322 622 19.4237 24.2796 36.4194 34.1917 Constraint 153 489 12.0555 15.0693 22.6040 34.1791 Constraint 412 497 9.3652 11.7065 17.5597 33.9940 Constraint 404 497 8.2217 10.2772 15.4158 33.9940 Constraint 355 497 10.3835 12.9794 19.4690 33.9104 Constraint 355 489 13.5930 16.9913 25.4869 33.9104 Constraint 350 497 11.5111 14.3889 21.5833 33.9104 Constraint 314 599 16.9550 21.1938 31.7907 33.8932 Constraint 314 590 18.3982 22.9977 34.4966 33.8932 Constraint 303 599 18.2150 22.7688 34.1532 33.8932 Constraint 303 590 19.6444 24.5555 36.8332 33.8932 Constraint 297 599 18.7230 23.4037 35.1056 33.8932 Constraint 297 590 20.3513 25.4391 38.1586 33.8932 Constraint 292 599 18.1659 22.7073 34.0610 33.8932 Constraint 292 590 20.0797 25.0996 37.6494 33.8932 Constraint 285 599 19.0787 23.8484 35.7726 33.8932 Constraint 285 590 20.9160 26.1449 39.2174 33.8932 Constraint 279 599 20.4080 25.5100 38.2650 33.8932 Constraint 279 590 22.2692 27.8365 41.7548 33.8932 Constraint 272 599 20.4329 25.5411 38.3116 33.8932 Constraint 267 599 20.7973 25.9967 38.9950 33.8932 Constraint 267 590 22.8297 28.5371 42.8057 33.8932 Constraint 259 599 19.3616 24.2020 36.3030 33.8932 Constraint 259 590 21.4020 26.7525 40.1288 33.8932 Constraint 237 599 20.0983 25.1228 37.6842 33.8932 Constraint 237 590 22.1945 27.7431 41.6146 33.8932 Constraint 210 599 18.0521 22.5651 33.8477 33.8932 Constraint 210 590 20.0898 25.1122 37.6683 33.8932 Constraint 201 599 20.5869 25.7337 38.6005 33.8932 Constraint 190 599 21.2868 26.6086 39.9128 33.8932 Constraint 182 599 18.9504 23.6880 35.5321 33.8932 Constraint 176 599 20.7067 25.8833 38.8250 33.8932 Constraint 226 497 16.7226 20.9032 31.3548 33.6434 Constraint 250 604 20.9384 26.1730 39.2595 33.6063 Constraint 330 613 20.1501 25.1876 37.7815 33.5505 Constraint 242 629 19.7895 24.7369 37.1053 33.5420 Constraint 169 613 21.8112 27.2640 40.8960 33.4790 Constraint 250 622 22.0005 27.5006 41.2509 33.4482 Constraint 237 622 20.1772 25.2214 37.8322 33.4482 Constraint 226 613 24.0984 30.1230 45.1846 33.4328 Constraint 169 622 22.3477 27.9346 41.9019 33.3312 Constraint 221 622 22.2470 27.8087 41.7131 33.2850 Constraint 341 613 19.5220 24.4025 36.6037 33.2505 Constraint 242 599 18.0669 22.5836 33.8755 32.9476 Constraint 242 590 20.1603 25.2003 37.8005 32.9476 Constraint 272 590 21.9380 27.4224 41.1337 32.8951 Constraint 201 590 22.0600 27.5750 41.3625 32.8951 Constraint 190 590 22.8072 28.5090 42.7635 32.8951 Constraint 182 590 20.2639 25.3299 37.9948 32.8951 Constraint 176 590 21.9932 27.4915 41.2373 32.8951 Constraint 330 604 18.0891 22.6114 33.9171 32.5627 Constraint 169 604 19.4356 24.2945 36.4417 32.4912 Constraint 190 622 21.5137 26.8921 40.3381 32.4501 Constraint 330 622 20.8104 26.0130 39.0196 32.4046 Constraint 322 629 18.7075 23.3844 35.0766 32.3943 Constraint 341 604 17.6855 22.1069 33.1604 32.2627 Constraint 429 613 17.5494 21.9368 32.9051 32.2511 Constraint 421 613 18.0323 22.5404 33.8106 32.2511 Constraint 341 622 20.5441 25.6801 38.5202 32.1046 Constraint 169 599 19.9688 24.9610 37.4414 31.9240 Constraint 226 599 21.8744 27.3430 41.0145 31.8932 Constraint 221 599 19.8069 24.7587 37.1380 31.8932 Constraint 221 590 21.8969 27.3711 41.0566 31.8932 Constraint 322 599 16.8683 21.0853 31.6280 31.8000 Constraint 322 590 18.4059 23.0074 34.5111 31.8000 Constraint 272 629 20.5858 25.7322 38.5983 31.6508 Constraint 267 629 21.1064 26.3830 39.5745 31.6508 Constraint 250 629 21.4254 26.7818 40.1727 31.6508 Constraint 237 629 19.6353 24.5442 36.8163 31.6508 Constraint 190 629 21.1499 26.4374 39.6561 31.6508 Constraint 153 497 11.8973 14.8716 22.3074 31.6082 Constraint 391 613 19.4261 24.2827 36.4240 31.5544 Constraint 382 613 20.8234 26.0292 39.0438 31.5544 Constraint 169 629 21.8373 27.2967 40.9450 31.5337 Constraint 314 585 17.5653 21.9567 32.9350 31.5037 Constraint 303 585 18.9013 23.6266 35.4399 31.5037 Constraint 297 585 19.5111 24.3889 36.5833 31.5037 Constraint 292 585 19.4388 24.2985 36.4478 31.5037 Constraint 285 585 20.5282 25.6603 38.4904 31.5037 Constraint 279 585 21.7708 27.2135 40.8202 31.5037 Constraint 267 585 22.5874 28.2342 42.3513 31.5037 Constraint 259 585 21.2573 26.5716 39.8574 31.5037 Constraint 237 585 22.1398 27.6747 41.5120 31.5037 Constraint 210 585 19.5144 24.3930 36.5895 31.5037 Constraint 221 629 21.6719 27.0899 40.6349 31.4876 Constraint 80 497 10.1617 12.7022 19.0533 31.3027 Constraint 429 604 15.6757 19.5946 29.3919 31.2633 Constraint 421 604 15.9442 19.9302 29.8953 31.2633 Constraint 80 489 11.3108 14.1384 21.2077 31.2027 Constraint 404 613 18.7570 23.4462 35.1693 31.1425 Constraint 429 622 18.5602 23.2002 34.8003 31.1052 Constraint 421 622 18.5498 23.1872 34.7808 31.1052 Constraint 250 599 20.1090 25.1362 37.7043 31.0564 Constraint 250 590 22.3466 27.9333 41.8999 31.0564 Constraint 169 590 21.0317 26.2896 39.4344 30.9259 Constraint 226 590 23.4029 29.2536 43.8804 30.8951 Constraint 330 629 20.2412 25.3015 37.9523 30.6072 Constraint 391 604 17.6776 22.0970 33.1455 30.5665 Constraint 382 604 19.4891 24.3614 36.5422 30.5665 Constraint 242 585 20.1414 25.1767 37.7650 30.5582 Constraint 272 585 21.3746 26.7183 40.0774 30.5057 Constraint 201 585 21.5147 26.8933 40.3400 30.5057 Constraint 190 585 22.3266 27.9082 41.8623 30.5057 Constraint 182 585 19.4127 24.2659 36.3988 30.5057 Constraint 176 585 21.1942 26.4927 39.7391 30.5057 Constraint 161 613 24.4124 30.5154 45.7732 30.5021 Constraint 226 622 22.1959 27.7449 41.6174 30.4482 Constraint 391 622 19.6578 24.5723 36.8585 30.4084 Constraint 382 622 20.8871 26.1089 39.1633 30.4084 Constraint 341 629 20.1997 25.2496 37.8745 30.3072 Constraint 435 613 20.2372 25.2965 37.9448 30.2665 Constraint 375 613 19.2818 24.1023 36.1534 30.2563 Constraint 368 613 20.0456 25.0570 37.5854 30.2563 Constraint 360 613 18.5864 23.2331 34.8496 30.2563 Constraint 355 613 19.8424 24.8030 37.2045 30.2563 Constraint 350 613 20.4520 25.5650 38.3475 30.2563 Constraint 412 613 19.6171 24.5214 36.7821 30.1579 Constraint 404 604 17.2118 21.5147 32.2721 30.1547 Constraint 429 629 18.0905 22.6132 33.9198 30.1174 Constraint 421 629 17.9703 22.4628 33.6943 30.1174 Constraint 330 599 18.3156 22.8946 34.3418 30.0128 Constraint 330 590 19.4551 24.3189 36.4783 30.0128 Constraint 404 622 19.1942 23.9928 35.9891 29.9966 Constraint 399 613 18.0975 22.6218 33.9328 29.7601 Constraint 341 599 17.8495 22.3118 33.4677 29.7128 Constraint 341 590 18.8046 23.5057 35.2586 29.7128 Constraint 330 511 14.9977 18.7471 28.1206 29.6490 Constraint 322 511 13.3048 16.6310 24.9464 29.6490 Constraint 314 511 12.0551 15.0689 22.6033 29.6490 Constraint 303 511 15.4257 19.2821 28.9232 29.6490 Constraint 297 511 16.8170 21.0212 31.5319 29.6490 Constraint 292 511 15.0834 18.8542 28.2813 29.6490 Constraint 285 511 16.0820 20.1025 30.1538 29.6490 Constraint 279 511 19.2747 24.0934 36.1401 29.6490 Constraint 272 511 19.4231 24.2789 36.4184 29.6490 Constraint 267 511 18.9419 23.6774 35.5161 29.6490 Constraint 259 511 16.0482 20.0603 30.0904 29.6490 Constraint 221 511 17.2772 21.5965 32.3947 29.6490 Constraint 210 511 15.4774 19.3468 29.0202 29.6490 Constraint 182 511 17.5673 21.9591 32.9387 29.6490 Constraint 176 511 19.9642 24.9553 37.4329 29.6490 Constraint 169 511 17.2563 21.5704 32.3556 29.6490 Constraint 161 511 20.0664 25.0829 37.6244 29.6490 Constraint 136 511 16.7738 20.9672 31.4508 29.6490 Constraint 128 511 14.6358 18.2948 27.4422 29.6490 Constraint 104 511 13.8958 17.3698 26.0546 29.6490 Constraint 88 511 10.1698 12.7122 19.0683 29.6490 Constraint 136 613 23.2751 29.0939 43.6408 29.5245 Constraint 128 613 22.5272 28.1591 42.2386 29.5245 Constraint 122 613 22.2803 27.8504 41.7756 29.5245 Constraint 113 613 21.6149 27.0187 40.5280 29.5245 Constraint 104 613 21.1919 26.4898 39.7348 29.5245 Constraint 136 604 20.6748 25.8435 38.7653 29.5245 Constraint 128 604 19.8244 24.7805 37.1708 29.5245 Constraint 122 604 19.5054 24.3818 36.5727 29.5245 Constraint 113 604 19.2059 24.0074 36.0111 29.5245 Constraint 104 604 18.8853 23.6066 35.4099 29.5245 Constraint 161 604 21.9012 27.3766 41.0648 29.5142 Constraint 221 585 21.4555 26.8194 40.2291 29.5037 Constraint 322 585 17.3353 21.6691 32.5037 29.4105 Constraint 161 622 24.6183 30.7728 46.1592 29.3561 Constraint 341 511 14.4054 18.0067 27.0100 29.3490 Constraint 435 604 18.5734 23.2168 34.8252 29.2787 Constraint 375 604 18.0396 22.5495 33.8243 29.2685 Constraint 368 604 18.6355 23.2944 34.9416 29.2685 Constraint 360 604 16.8382 21.0477 31.5715 29.2685 Constraint 355 604 18.3022 22.8777 34.3166 29.2685 Constraint 350 604 18.6192 23.2740 34.9110 29.2685 Constraint 412 604 17.8802 22.3503 33.5254 29.1701 Constraint 435 622 20.6567 25.8209 38.7313 29.1206 Constraint 375 622 19.8048 24.7559 37.1339 29.1103 Constraint 368 622 20.3933 25.4916 38.2374 29.1103 Constraint 360 622 19.3807 24.2258 36.3387 29.1103 Constraint 355 622 20.7917 25.9896 38.9844 29.1103 Constraint 350 622 21.3135 26.6419 39.9628 29.1103 Constraint 412 622 19.5833 24.4791 36.7186 29.0120 Constraint 404 629 18.6133 23.2667 34.9000 29.0088 Constraint 136 599 20.6853 25.8566 38.7849 28.9515 Constraint 136 590 21.7043 27.1304 40.6955 28.9515 Constraint 128 599 19.5185 24.3981 36.5972 28.9515 Constraint 128 590 20.8203 26.0254 39.0380 28.9515 Constraint 122 599 19.4988 24.3735 36.5603 28.9515 Constraint 122 590 20.7704 25.9630 38.9446 28.9515 Constraint 113 599 19.4500 24.3125 36.4687 28.9515 Constraint 113 590 20.3527 25.4409 38.1613 28.9515 Constraint 104 599 18.7336 23.4170 35.1256 28.9515 Constraint 104 590 19.7242 24.6553 36.9830 28.9515 Constraint 161 599 21.5957 26.9947 40.4920 28.9413 Constraint 161 590 22.9691 28.7113 43.0670 28.9413 Constraint 442 613 19.9287 24.9109 37.3663 28.9330 Constraint 144 613 23.6719 29.5899 44.3848 28.9288 Constraint 144 604 20.8562 26.0703 39.1055 28.9288 Constraint 399 511 7.5655 9.4569 14.1853 28.8394 Constraint 399 604 16.2944 20.3680 30.5520 28.7723 Constraint 429 599 16.3897 20.4871 30.7306 28.7134 Constraint 429 590 17.6503 22.0629 33.0944 28.7134 Constraint 421 599 16.0022 20.0027 30.0040 28.7134 Constraint 421 590 17.6852 22.1065 33.1597 28.7134 Constraint 242 511 14.7663 18.4579 27.6868 28.7035 Constraint 250 585 22.7275 28.4094 42.6140 28.6670 Constraint 96 511 10.6356 13.2945 19.9418 28.6510 Constraint 226 629 21.5756 26.9695 40.4543 28.6508 Constraint 399 622 18.9174 23.6468 35.4701 28.6142 Constraint 391 629 19.0752 23.8440 35.7660 28.6110 Constraint 382 629 20.5533 25.6916 38.5375 28.6110 Constraint 136 585 19.8435 24.8044 37.2066 28.5467 Constraint 128 585 19.0385 23.7982 35.6973 28.5467 Constraint 122 585 18.7311 23.4139 35.1209 28.5467 Constraint 113 585 18.2151 22.7688 34.1533 28.5467 Constraint 104 585 17.8341 22.2926 33.4389 28.5467 Constraint 169 585 19.9884 24.9854 37.4782 28.5365 Constraint 161 585 21.2346 26.5433 39.8149 28.5365 Constraint 226 585 23.1316 28.9145 43.3717 28.5057 Constraint 322 636 19.4875 24.3594 36.5390 28.4497 Constraint 314 636 19.3993 24.2492 36.3737 28.4497 Constraint 303 636 21.0304 26.2880 39.4321 28.4497 Constraint 297 636 21.5640 26.9550 40.4325 28.4497 Constraint 292 636 20.7775 25.9718 38.9577 28.4497 Constraint 285 636 21.7786 27.2232 40.8348 28.4497 Constraint 259 636 22.0647 27.5809 41.3713 28.4497 Constraint 242 636 20.8830 26.1037 39.1556 28.4497 Constraint 210 636 20.3821 25.4777 38.2165 28.4497 Constraint 201 636 22.5169 28.1461 42.2191 28.4497 Constraint 182 636 21.4288 26.7860 40.1789 28.4497 Constraint 176 636 22.6390 28.2988 42.4482 28.4497 Constraint 435 511 11.3719 14.2149 21.3224 28.4346 Constraint 429 511 8.1092 10.1365 15.2047 28.4346 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 412 511 11.6291 14.5364 21.8046 28.4346 Constraint 404 511 9.7793 12.2241 18.3362 28.4346 Constraint 136 622 23.9781 29.9726 44.9589 28.3786 Constraint 128 622 23.0079 28.7599 43.1399 28.3786 Constraint 122 622 23.0031 28.7539 43.1308 28.3786 Constraint 113 622 22.6240 28.2800 42.4200 28.3786 Constraint 104 622 21.9173 27.3966 41.0949 28.3786 Constraint 144 599 20.8885 26.1107 39.1660 28.3558 Constraint 144 590 22.0119 27.5149 41.2723 28.3558 Constraint 355 511 10.4991 13.1239 19.6859 28.3510 Constraint 350 511 12.6694 15.8367 23.7551 28.3510 Constraint 435 629 20.2846 25.3557 38.0336 28.1328 Constraint 412 629 18.9927 23.7409 35.6113 28.0242 Constraint 391 599 17.1348 21.4185 32.1278 28.0166 Constraint 391 590 18.6822 23.3528 35.0292 28.0166 Constraint 382 599 18.9721 23.7152 35.5728 28.0166 Constraint 382 590 20.2515 25.3144 37.9716 28.0166 Constraint 144 585 20.0903 25.1129 37.6694 27.9510 Constraint 442 604 17.9973 22.4966 33.7449 27.9452 Constraint 442 622 20.0817 25.1021 37.6531 27.7871 Constraint 144 622 24.3442 30.4303 45.6454 27.7829 Constraint 80 511 12.3230 15.4038 23.1057 27.6413 Constraint 399 629 18.2741 22.8426 34.2640 27.6264 Constraint 330 585 18.3753 22.9691 34.4536 27.6234 Constraint 404 599 17.2711 21.5889 32.3834 27.6048 Constraint 404 590 18.6233 23.2791 34.9187 27.6048 Constraint 136 629 23.2951 29.1189 43.6783 27.5690 Constraint 128 629 22.4105 28.0132 42.0197 27.5690 Constraint 122 629 22.1768 27.7210 41.5814 27.5690 Constraint 113 629 21.8456 27.3070 40.9605 27.5690 Constraint 104 629 21.3347 26.6684 40.0026 27.5690 Constraint 161 629 24.4361 30.5452 45.8178 27.5587 Constraint 322 644 21.3009 26.6261 39.9392 27.5276 Constraint 314 644 21.0921 26.3652 39.5477 27.5276 Constraint 303 644 22.0957 27.6197 41.4295 27.5276 Constraint 297 644 22.6872 28.3590 42.5385 27.5276 Constraint 292 644 22.3904 27.9880 41.9820 27.5276 Constraint 285 644 22.8915 28.6144 42.9216 27.5276 Constraint 279 644 23.9964 29.9955 44.9933 27.5276 Constraint 272 644 24.3011 30.3764 45.5646 27.5276 Constraint 267 644 24.4396 30.5495 45.8243 27.5276 Constraint 259 644 23.5273 29.4091 44.1136 27.5276 Constraint 242 644 22.9038 28.6297 42.9446 27.5276 Constraint 237 644 24.3427 30.4283 45.6425 27.5276 Constraint 210 644 22.6788 28.3485 42.5228 27.5276 Constraint 182 644 22.9815 28.7269 43.0903 27.5276 Constraint 88 613 20.4851 25.6063 38.4095 27.4313 Constraint 88 604 17.9339 22.4173 33.6260 27.4313 Constraint 341 585 17.7451 22.1814 33.2721 27.3234 Constraint 375 629 19.4314 24.2893 36.4339 27.3129 Constraint 368 629 20.0105 25.0131 37.5197 27.3129 Constraint 360 629 18.8175 23.5218 35.2828 27.3129 Constraint 355 629 20.3295 25.4119 38.1178 27.3129 Constraint 350 629 20.6983 25.8729 38.8093 27.3129 Constraint 250 644 25.1145 31.3932 47.0898 27.2276 Constraint 322 651 20.8677 26.0846 39.1269 27.1228 Constraint 314 651 20.4905 25.6131 38.4197 27.1228 Constraint 303 651 21.3515 26.6894 40.0341 27.1228 Constraint 297 651 21.9857 27.4821 41.2231 27.1228 Constraint 292 651 21.7276 27.1595 40.7393 27.1228 Constraint 285 651 21.9986 27.4983 41.2474 27.1228 Constraint 279 651 23.0167 28.7709 43.1563 27.1228 Constraint 272 651 23.4684 29.3355 44.0033 27.1228 Constraint 267 651 23.4262 29.2827 43.9241 27.1228 Constraint 259 651 22.6134 28.2668 42.4002 27.1228 Constraint 242 651 22.1280 27.6600 41.4901 27.1228 Constraint 210 651 22.2166 27.7708 41.6561 27.1228 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 237 511 17.5274 21.9093 32.8639 26.9908 Constraint 226 511 19.8134 24.7668 37.1502 26.9908 Constraint 201 511 19.2602 24.0752 36.1129 26.9908 Constraint 190 511 20.5818 25.7273 38.5909 26.9908 Constraint 144 511 16.3281 20.4102 30.6153 26.9908 Constraint 122 511 12.7407 15.9259 23.8889 26.9908 Constraint 113 511 13.9556 17.4445 26.1667 26.9908 Constraint 144 629 23.6099 29.5124 44.2686 26.9733 Constraint 391 489 12.2902 15.3627 23.0441 26.9251 Constraint 382 489 13.7153 17.1441 25.7161 26.9251 Constraint 88 599 17.9929 22.4911 33.7367 26.8583 Constraint 88 590 19.3207 24.1509 36.2264 26.8583 Constraint 250 651 24.1448 30.1809 45.2714 26.8228 Constraint 250 511 17.8453 22.3067 33.4600 26.8123 Constraint 442 629 19.5626 24.4533 36.6799 26.7993 Constraint 435 599 19.1088 23.8860 35.8290 26.7288 Constraint 435 590 20.6103 25.7628 38.6443 26.7288 Constraint 435 585 19.1728 23.9660 35.9489 26.7288 Constraint 429 585 16.8604 21.0755 31.6132 26.7288 Constraint 421 585 17.1307 21.4134 32.1201 26.7288 Constraint 375 599 17.8935 22.3669 33.5504 26.7186 Constraint 375 590 18.9122 23.6402 35.4603 26.7186 Constraint 368 599 18.0790 22.5987 33.8981 26.7186 Constraint 368 590 19.2904 24.1130 36.1695 26.7186 Constraint 360 599 16.5374 20.6717 31.0076 26.7186 Constraint 360 590 17.7997 22.2497 33.3745 26.7186 Constraint 355 599 18.0493 22.5617 33.8425 26.7186 Constraint 355 590 18.9910 23.7387 35.6081 26.7186 Constraint 350 599 18.4647 23.0809 34.6213 26.7186 Constraint 350 590 19.6718 24.5897 36.8846 26.7186 Constraint 330 636 20.7347 25.9184 38.8776 26.6626 Constraint 412 599 17.5686 21.9607 32.9411 26.6202 Constraint 412 590 19.3316 24.1645 36.2468 26.6202 Constraint 279 636 22.0744 27.5930 41.3895 26.5586 Constraint 272 636 21.9440 27.4300 41.1449 26.5586 Constraint 267 636 22.3545 27.9431 41.9146 26.5586 Constraint 250 636 22.3909 27.9886 41.9829 26.5586 Constraint 237 636 20.7028 25.8785 38.8178 26.5586 Constraint 190 636 22.4114 28.0142 42.0213 26.5586 Constraint 201 644 24.1339 30.1673 45.2510 26.5295 Constraint 190 644 24.5758 30.7197 46.0795 26.5295 Constraint 176 644 23.7592 29.6990 44.5485 26.5295 Constraint 169 636 21.8195 27.2744 40.9116 26.4805 Constraint 88 585 17.2346 21.5433 32.3149 26.4535 Constraint 341 636 20.5749 25.7186 38.5779 26.3626 Constraint 88 622 21.2283 26.5354 39.8030 26.2854 Constraint 399 599 16.4621 20.5776 30.8665 26.2224 Constraint 399 590 17.8902 22.3627 33.5441 26.2224 Constraint 237 651 23.0562 28.8203 43.2304 26.1247 Constraint 201 651 23.5552 29.4440 44.1660 26.1247 Constraint 190 651 23.7860 29.7325 44.5987 26.1247 Constraint 182 651 21.7427 27.1783 40.7675 26.1247 Constraint 176 651 23.2431 29.0539 43.5808 26.1247 Constraint 449 613 19.6134 24.5167 36.7751 25.9894 Constraint 375 489 12.1843 15.2304 22.8456 25.9271 Constraint 314 577 16.2703 20.3378 30.5068 25.8589 Constraint 303 577 17.0330 21.2912 31.9368 25.8589 Constraint 297 577 17.4708 21.8386 32.7578 25.8589 Constraint 292 577 17.6366 22.0458 33.0686 25.8589 Constraint 285 577 18.5465 23.1832 34.7747 25.8589 Constraint 279 577 19.4106 24.2632 36.3949 25.8589 Constraint 272 577 19.7491 24.6864 37.0295 25.8589 Constraint 267 577 20.3918 25.4897 38.2346 25.8589 Constraint 259 577 19.3245 24.1557 36.2335 25.8589 Constraint 237 577 20.8657 26.0821 39.1232 25.8589 Constraint 210 577 17.9274 22.4092 33.6139 25.8589 Constraint 201 577 20.4820 25.6026 38.4038 25.8589 Constraint 190 577 20.8845 26.1056 39.1584 25.8589 Constraint 182 577 18.0978 22.6223 33.9334 25.8589 Constraint 176 577 20.0973 25.1216 37.6825 25.8589 Constraint 330 644 21.9627 27.4534 41.1801 25.7404 Constraint 391 585 18.5161 23.1451 34.7177 25.6272 Constraint 382 585 20.2815 25.3519 38.0278 25.6272 Constraint 404 585 18.3269 22.9086 34.3629 25.6201 Constraint 169 644 23.4075 29.2594 43.8891 25.5449 Constraint 221 644 24.1269 30.1587 45.2380 25.5276 Constraint 88 629 20.1065 25.1331 37.6997 25.4758 Constraint 221 636 22.3424 27.9280 41.8920 25.4497 Constraint 341 644 21.3156 26.6445 39.9667 25.4404 Constraint 442 599 18.5056 23.1320 34.6980 25.3953 Constraint 442 590 20.2421 25.3026 37.9539 25.3953 Constraint 442 585 18.8946 23.6182 35.4273 25.3953 Constraint 330 651 21.4777 26.8471 40.2707 25.3356 Constraint 169 651 23.0311 28.7888 43.1833 25.1401 Constraint 221 651 23.4963 29.3704 44.0556 25.1228 Constraint 404 636 20.1668 25.2084 37.8127 25.0642 Constraint 341 651 20.9578 26.1973 39.2959 25.0356 Constraint 449 604 17.7408 22.1760 33.2641 25.0015 Constraint 242 577 18.6050 23.2563 34.8844 24.9133 Constraint 226 577 22.0210 27.5263 41.2894 24.8589 Constraint 221 577 19.4509 24.3136 36.4704 24.8589 Constraint 449 622 20.1443 25.1803 37.7705 24.8434 Constraint 473 613 18.9715 23.7144 35.5716 24.8234 Constraint 473 604 16.8977 21.1221 31.6831 24.8234 Constraint 153 622 24.6955 30.8694 46.3040 24.7021 Constraint 153 604 21.2481 26.5602 39.8403 24.7021 Constraint 153 599 20.8002 26.0003 39.0004 24.7021 Constraint 391 636 20.8560 26.0701 39.1051 24.6664 Constraint 382 636 22.2016 27.7520 41.6281 24.6664 Constraint 391 497 9.4664 11.8330 17.7496 24.6542 Constraint 382 497 11.2760 14.0950 21.1425 24.6542 Constraint 412 585 19.4298 24.2873 36.4309 24.6355 Constraint 226 644 25.3674 31.7093 47.5639 24.5295 Constraint 480 613 17.7037 22.1296 33.1944 24.4391 Constraint 480 604 15.7714 19.7143 29.5714 24.4391 Constraint 96 613 21.2160 26.5200 39.7799 24.4371 Constraint 96 604 18.6810 23.3513 35.0270 24.4371 Constraint 449 599 17.4108 21.7634 32.6452 24.4286 Constraint 449 590 18.9515 23.6893 35.5340 24.4286 Constraint 449 585 17.3672 21.7091 32.5636 24.4286 Constraint 375 636 20.5813 25.7267 38.5900 24.3664 Constraint 368 636 21.4327 26.7908 40.1862 24.3664 Constraint 360 636 19.9548 24.9434 37.4152 24.3664 Constraint 355 636 21.1796 26.4745 39.7118 24.3664 Constraint 350 636 21.5151 26.8939 40.3408 24.3664 Constraint 375 585 18.4327 23.0409 34.5614 24.3291 Constraint 368 585 19.0138 23.7672 35.6508 24.3291 Constraint 360 585 16.9888 21.2361 31.8541 24.3291 Constraint 355 585 18.0867 22.6084 33.9127 24.3291 Constraint 350 585 18.7548 23.4435 35.1653 24.3291 Constraint 473 599 17.1669 21.4586 32.1879 24.2504 Constraint 473 590 18.3505 22.9382 34.4072 24.2504 Constraint 473 585 16.6207 20.7759 31.1638 24.2504 Constraint 322 657 20.2518 25.3148 37.9722 24.1591 Constraint 314 657 19.9278 24.9098 37.3647 24.1591 Constraint 297 657 21.4984 26.8729 40.3094 24.1591 Constraint 292 657 20.9669 26.2086 39.3129 24.1591 Constraint 285 657 21.4475 26.8093 40.2140 24.1591 Constraint 272 657 22.8083 28.5103 42.7655 24.1591 Constraint 267 657 22.8776 28.5970 42.8956 24.1591 Constraint 259 657 21.9407 27.4259 41.1388 24.1591 Constraint 242 657 21.2437 26.5546 39.8319 24.1591 Constraint 237 657 22.6333 28.2916 42.4374 24.1591 Constraint 210 657 21.2547 26.5684 39.8526 24.1591 Constraint 201 657 23.2803 29.1003 43.6505 24.1591 Constraint 190 657 23.6462 29.5577 44.3366 24.1591 Constraint 182 657 21.5893 26.9866 40.4799 24.1591 Constraint 226 651 24.6542 30.8178 46.2267 24.1247 Constraint 429 636 18.8993 23.6241 35.4361 24.0796 Constraint 421 636 19.3413 24.1766 36.2649 24.0796 Constraint 412 636 21.3373 26.6716 40.0074 24.0796 Constraint 314 571 18.6300 23.2875 34.9312 24.0717 Constraint 303 571 19.1743 23.9678 35.9518 24.0717 Constraint 297 571 19.7421 24.6776 37.0164 24.0717 Constraint 292 571 20.0312 25.0390 37.5585 24.0717 Constraint 285 571 20.6809 25.8512 38.7767 24.0717 Constraint 279 571 21.5087 26.8859 40.3289 24.0717 Constraint 272 571 21.8884 27.3605 41.0407 24.0717 Constraint 267 571 22.3746 27.9683 41.9524 24.0717 Constraint 259 571 21.3312 26.6641 39.9961 24.0717 Constraint 237 571 22.8251 28.5314 42.7970 24.0717 Constraint 210 571 20.1624 25.2030 37.8044 24.0717 Constraint 201 571 22.5531 28.1914 42.2870 24.0717 Constraint 190 571 22.9058 28.6322 42.9483 24.0717 Constraint 182 571 20.3135 25.3918 38.0878 24.0717 Constraint 176 571 22.2369 27.7962 41.6943 24.0717 Constraint 391 511 11.1040 13.8800 20.8201 23.9909 Constraint 382 511 12.2997 15.3746 23.0619 23.9909 Constraint 153 511 15.3077 19.1346 28.7019 23.9556 Constraint 153 629 24.4068 30.5084 45.7627 23.8925 Constraint 169 577 19.4660 24.3325 36.4988 23.8896 Constraint 161 577 20.5086 25.6357 38.4535 23.8896 Constraint 136 577 18.0915 22.6143 33.9215 23.8896 Constraint 128 577 17.3447 21.6809 32.5214 23.8896 Constraint 122 577 17.7191 22.1489 33.2234 23.8896 Constraint 113 577 17.4863 21.8579 32.7869 23.8896 Constraint 104 577 16.5329 20.6661 30.9991 23.8896 Constraint 480 599 16.5036 20.6296 30.9443 23.8661 Constraint 480 590 17.3194 21.6493 32.4739 23.8661 Constraint 96 599 18.1959 22.7448 34.1173 23.8641 Constraint 96 590 19.6770 24.5963 36.8944 23.8641 Constraint 250 657 23.3369 29.1711 43.7566 23.8591 Constraint 449 629 19.7020 24.6275 36.9413 23.8556 Constraint 399 585 17.1931 21.4914 32.2372 23.8330 Constraint 322 577 15.9601 19.9502 29.9253 23.7656 Constraint 391 644 22.1311 27.6638 41.4957 23.7443 Constraint 382 644 23.7408 29.6760 44.5140 23.7443 Constraint 153 613 23.1092 28.8866 43.3298 23.7041 Constraint 153 590 21.1791 26.4739 39.7108 23.7040 Constraint 399 636 19.3841 24.2301 36.3452 23.6818 Constraint 473 622 19.8148 24.7685 37.1528 23.6775 Constraint 226 636 22.6292 28.2865 42.4298 23.5586 Constraint 161 636 25.2653 31.5816 47.3724 23.5036 Constraint 480 585 15.3895 19.2368 28.8553 23.4613 Constraint 96 585 17.9492 22.4366 33.6548 23.4593 Constraint 375 497 9.4339 11.7923 17.6885 23.3561 Constraint 368 497 10.7808 13.4760 20.2141 23.3561 Constraint 368 489 13.9653 17.4566 26.1849 23.3561 Constraint 360 497 8.1803 10.2254 15.3380 23.3561 Constraint 360 489 11.4809 14.3511 21.5266 23.3561 Constraint 391 651 21.5191 26.8989 40.3483 23.3395 Constraint 382 651 22.9797 28.7247 43.0870 23.3395 Constraint 429 651 20.9952 26.2440 39.3660 23.3324 Constraint 429 644 21.1782 26.4727 39.7091 23.3324 Constraint 421 651 20.1954 25.2442 37.8663 23.3324 Constraint 421 644 20.7480 25.9350 38.9025 23.3324 Constraint 412 651 21.8270 27.2837 40.9256 23.3324 Constraint 412 644 22.6759 28.3449 42.5173 23.3324 Constraint 404 651 21.9470 27.4338 41.1506 23.3324 Constraint 404 644 22.5415 28.1769 42.2653 23.3324 Constraint 153 585 19.4785 24.3482 36.5223 23.2992 Constraint 144 577 18.6718 23.3398 35.0097 23.2939 Constraint 480 622 18.8573 23.5717 35.3575 23.2932 Constraint 96 622 21.6258 27.0322 40.5483 23.2912 Constraint 169 657 22.6809 28.3512 42.5268 23.1745 Constraint 176 657 22.3200 27.9001 41.8501 23.1611 Constraint 322 668 22.0071 27.5089 41.2633 23.1591 Constraint 314 668 21.6836 27.1046 40.6568 23.1591 Constraint 303 668 22.5281 28.1601 42.2402 23.1591 Constraint 297 668 23.1156 28.8945 43.3418 23.1591 Constraint 292 668 22.7746 28.4682 42.7024 23.1591 Constraint 285 668 23.1085 28.8857 43.3285 23.1591 Constraint 279 668 24.1401 30.1752 45.2628 23.1591 Constraint 272 668 24.5258 30.6573 45.9859 23.1591 Constraint 259 668 23.7455 29.6818 44.5228 23.1591 Constraint 242 668 23.2646 29.0807 43.6211 23.1591 Constraint 237 668 24.7699 30.9624 46.4435 23.1591 Constraint 210 668 23.2602 29.0753 43.6129 23.1591 Constraint 190 668 25.5050 31.8813 47.8219 23.1591 Constraint 182 668 23.3595 29.1993 43.7990 23.1591 Constraint 242 571 20.5390 25.6737 38.5106 23.1261 Constraint 314 552 16.7547 20.9434 31.4150 23.0910 Constraint 303 552 17.5614 21.9517 32.9276 23.0910 Constraint 297 552 18.0835 22.6043 33.9065 23.0910 Constraint 292 552 18.5619 23.2024 34.8036 23.0910 Constraint 285 552 19.6089 24.5111 36.7666 23.0910 Constraint 279 552 20.5164 25.6455 38.4683 23.0910 Constraint 272 552 20.8945 26.1181 39.1772 23.0910 Constraint 267 552 21.6917 27.1146 40.6719 23.0910 Constraint 259 552 20.5798 25.7248 38.5872 23.0910 Constraint 237 552 22.0109 27.5136 41.2704 23.0910 Constraint 210 552 18.6454 23.3067 34.9601 23.0910 Constraint 201 552 21.3895 26.7369 40.1053 23.0910 Constraint 190 552 21.9779 27.4724 41.2085 23.0910 Constraint 182 552 18.8385 23.5481 35.3222 23.0910 Constraint 176 552 20.8898 26.1122 39.1683 23.0910 Constraint 226 571 24.0532 30.0665 45.0998 23.0717 Constraint 221 571 21.7077 27.1347 40.7020 23.0717 Constraint 250 577 20.8647 26.0809 39.1213 23.0221 Constraint 467 613 19.1969 23.9961 35.9942 23.0157 Constraint 461 613 19.3538 24.1922 36.2883 23.0157 Constraint 467 604 16.8151 21.0188 31.5282 23.0157 Constraint 461 604 16.8066 21.0082 31.5123 23.0157 Constraint 330 519 16.3270 20.4087 30.6131 22.9908 Constraint 322 519 14.9231 18.6539 27.9808 22.9908 Constraint 314 519 14.7680 18.4600 27.6900 22.9908 Constraint 303 519 17.7753 22.2192 33.3288 22.9908 Constraint 297 519 18.6110 23.2638 34.8957 22.9908 Constraint 292 519 17.4511 21.8139 32.7209 22.9908 Constraint 285 519 19.0423 23.8028 35.7043 22.9908 Constraint 279 519 21.6132 27.0165 40.5247 22.9908 Constraint 272 519 21.5174 26.8967 40.3450 22.9908 Constraint 267 519 21.7221 27.1526 40.7289 22.9908 Constraint 259 519 19.0932 23.8665 35.7998 22.9908 Constraint 237 519 19.8821 24.8526 37.2789 22.9908 Constraint 226 519 21.8986 27.3732 41.0598 22.9908 Constraint 221 519 19.5588 24.4485 36.6728 22.9908 Constraint 210 519 17.2464 21.5580 32.3371 22.9908 Constraint 201 519 20.5475 25.6844 38.5266 22.9908 Constraint 190 519 22.0874 27.6093 41.4140 22.9908 Constraint 182 519 19.0728 23.8410 35.7615 22.9908 Constraint 176 519 21.0040 26.2551 39.3826 22.9908 Constraint 169 519 18.2546 22.8183 34.2275 22.9908 Constraint 161 519 20.2997 25.3746 38.0619 22.9908 Constraint 144 519 16.2914 20.3642 30.5463 22.9908 Constraint 136 519 16.9917 21.2396 31.8594 22.9908 Constraint 128 519 15.6844 19.6055 29.4083 22.9908 Constraint 122 519 13.6931 17.1164 25.6746 22.9908 Constraint 113 519 14.2561 17.8201 26.7302 22.9908 Constraint 104 519 14.8809 18.6011 27.9016 22.9908 Constraint 88 519 11.7341 14.6676 22.0014 22.9908 Constraint 473 629 18.7169 23.3961 35.0941 22.8678 Constraint 267 668 24.3394 30.4243 45.6364 22.8591 Constraint 250 668 25.2624 31.5780 47.3669 22.8591 Constraint 80 613 21.0545 26.3181 39.4772 22.8318 Constraint 80 604 19.1170 23.8963 35.8444 22.8317 Constraint 303 657 19.8754 24.8442 37.2664 22.8257 Constraint 279 657 21.4588 26.8235 40.2353 22.8257 Constraint 375 511 9.5925 11.9906 17.9859 22.6928 Constraint 368 511 11.4803 14.3504 21.5256 22.6928 Constraint 360 511 9.7306 12.1633 18.2449 22.6928 Constraint 341 519 16.5433 20.6791 31.0186 22.6908 Constraint 136 644 25.8032 32.2540 48.3811 22.5782 Constraint 128 644 24.8325 31.0406 46.5609 22.5782 Constraint 122 644 24.5591 30.6989 46.0483 22.5782 Constraint 113 644 24.2364 30.2954 45.4432 22.5782 Constraint 104 644 23.7182 29.6478 44.4716 22.5782 Constraint 88 644 23.2944 29.1180 43.6770 22.5782 Constraint 161 644 26.8212 33.5265 50.2898 22.5680 Constraint 136 636 23.4970 29.3712 44.0569 22.5158 Constraint 128 636 22.6786 28.3483 42.5224 22.5158 Constraint 122 636 21.8244 27.2804 40.9207 22.5158 Constraint 113 636 21.5038 26.8798 40.3196 22.5158 Constraint 104 636 21.6004 27.0005 40.5007 22.5158 Constraint 88 636 20.4094 25.5118 38.2677 22.5158 Constraint 480 629 18.1334 22.6668 34.0002 22.4835 Constraint 96 629 20.7904 25.9879 38.9819 22.4815 Constraint 375 644 22.2668 27.8334 41.7502 22.4462 Constraint 368 644 22.3497 27.9371 41.9057 22.4462 Constraint 360 644 21.0224 26.2780 39.4170 22.4462 Constraint 355 644 21.4287 26.7859 40.1788 22.4462 Constraint 350 644 21.6760 27.0950 40.6425 22.4462 Constraint 467 599 17.5223 21.9028 32.8543 22.4427 Constraint 467 590 18.4439 23.0548 34.5823 22.4427 Constraint 467 585 16.2745 20.3431 30.5147 22.4427 Constraint 461 599 17.0562 21.3202 31.9803 22.4427 Constraint 461 590 18.2458 22.8072 34.2108 22.4427 Constraint 461 585 16.2357 20.2946 30.4419 22.4427 Constraint 330 657 20.9905 26.2381 39.3572 22.3720 Constraint 80 599 19.1825 23.9781 35.9672 22.2587 Constraint 80 590 19.8610 24.8263 37.2395 22.2587 Constraint 80 585 17.6364 22.0455 33.0682 22.2587 Constraint 399 519 11.4072 14.2590 21.3884 22.1812 Constraint 169 668 24.8047 31.0058 46.5088 22.1745 Constraint 136 651 25.3782 31.7227 47.5841 22.1734 Constraint 128 651 24.3484 30.4355 45.6533 22.1734 Constraint 122 651 24.2469 30.3087 45.4630 22.1734 Constraint 113 651 24.0088 30.0110 45.0166 22.1734 Constraint 104 651 23.2586 29.0732 43.6098 22.1734 Constraint 88 651 22.9535 28.6918 43.0377 22.1734 Constraint 585 651 12.2057 15.2572 22.8858 22.1681 Constraint 161 651 26.2402 32.8003 49.2005 22.1632 Constraint 201 668 24.6011 30.7514 46.1271 22.1611 Constraint 176 668 24.1730 30.2163 45.3244 22.1611 Constraint 226 668 26.2845 32.8556 49.2835 22.1591 Constraint 226 657 24.4397 30.5496 45.8244 22.1591 Constraint 221 668 24.4163 30.5203 45.7805 22.1591 Constraint 221 657 22.6572 28.3215 42.4822 22.1591 Constraint 242 552 19.8507 24.8133 37.2200 22.1454 Constraint 169 552 19.3790 24.2238 36.3356 22.1064 Constraint 161 552 20.5546 25.6932 38.5398 22.1064 Constraint 144 552 17.6968 22.1210 33.1815 22.1064 Constraint 136 552 17.5097 21.8872 32.8308 22.1064 Constraint 128 552 17.0294 21.2868 31.9301 22.1064 Constraint 122 552 16.7495 20.9369 31.4053 22.1064 Constraint 113 552 16.0093 20.0117 30.0175 22.1064 Constraint 104 552 15.6251 19.5313 29.2970 22.1064 Constraint 169 571 21.6791 27.0988 40.6483 22.1025 Constraint 161 571 22.5624 28.2029 42.3044 22.1025 Constraint 144 571 20.3038 25.3797 38.0696 22.1025 Constraint 136 571 19.8999 24.8749 37.3124 22.1025 Constraint 128 571 19.6201 24.5251 36.7876 22.1025 Constraint 122 571 20.0660 25.0825 37.6238 22.1025 Constraint 113 571 19.3877 24.2346 36.3519 22.1025 Constraint 104 571 18.4547 23.0684 34.6027 22.1025 Constraint 435 636 22.0671 27.5839 41.3759 22.0949 Constraint 226 552 23.1587 28.9483 43.4225 22.0910 Constraint 221 552 20.5067 25.6334 38.4500 22.0910 Constraint 242 519 17.7128 22.1411 33.2116 22.0453 Constraint 375 651 21.6705 27.0881 40.6322 22.0414 Constraint 368 651 21.6435 27.0544 40.5816 22.0414 Constraint 360 651 20.6306 25.7882 38.6823 22.0414 Constraint 355 651 21.0496 26.3119 39.4679 22.0414 Constraint 350 651 21.0062 26.2577 39.3866 22.0414 Constraint 96 519 12.4711 15.5889 23.3834 21.9928 Constraint 144 644 26.5519 33.1898 49.7847 21.9825 Constraint 330 577 17.0363 21.2954 31.9431 21.9785 Constraint 330 571 18.4651 23.0814 34.6221 21.9785 Constraint 322 571 18.6362 23.2953 34.9429 21.9785 Constraint 399 651 21.2505 26.5631 39.8447 21.9501 Constraint 399 644 21.5179 26.8973 40.3460 21.9501 Constraint 144 636 23.7760 29.7199 44.5799 21.9201 Constraint 467 629 19.3520 24.1900 36.2850 21.8698 Constraint 467 622 20.4009 25.5011 38.2516 21.8698 Constraint 461 629 19.2032 24.0040 36.0061 21.8698 Constraint 461 622 20.2569 25.3211 37.9817 21.8698 Constraint 88 577 16.7347 20.9184 31.3777 21.7964 Constraint 435 519 13.3743 16.7179 25.0769 21.7764 Constraint 429 519 10.5964 13.2455 19.8683 21.7764 Constraint 421 519 11.8835 14.8544 22.2816 21.7764 Constraint 412 519 14.4069 18.0086 27.0129 21.7764 Constraint 404 519 13.3219 16.6524 24.9787 21.7764 Constraint 429 657 20.1251 25.1564 37.7346 21.7716 Constraint 421 657 19.5873 24.4842 36.7262 21.7716 Constraint 412 657 21.2353 26.5441 39.8161 21.7716 Constraint 404 657 21.1363 26.4204 39.6306 21.7716 Constraint 355 519 14.3153 17.8941 26.8412 21.6928 Constraint 350 519 15.7540 19.6925 29.5387 21.6928 Constraint 80 622 22.2001 27.7502 41.6253 21.6858 Constraint 341 577 16.2967 20.3709 30.5563 21.6785 Constraint 341 571 17.9505 22.4382 33.6572 21.6785 Constraint 590 657 12.4963 15.6204 23.4305 21.5939 Constraint 144 651 26.3027 32.8784 49.3176 21.5777 Constraint 314 535 14.8020 18.5025 27.7538 21.5112 Constraint 303 535 17.4438 21.8047 32.7071 21.5112 Constraint 297 535 18.2240 22.7800 34.1700 21.5112 Constraint 292 535 17.0532 21.3165 31.9747 21.5112 Constraint 285 535 18.3930 22.9913 34.4869 21.5112 Constraint 279 535 20.9384 26.1730 39.2594 21.5112 Constraint 272 535 20.8285 26.0356 39.0534 21.5112 Constraint 267 535 20.8767 26.0959 39.1439 21.5112 Constraint 259 535 18.3302 22.9127 34.3691 21.5112 Constraint 237 535 19.6221 24.5276 36.7915 21.5112 Constraint 226 535 21.5745 26.9681 40.4521 21.5112 Constraint 221 535 19.1811 23.9764 35.9646 21.5112 Constraint 210 535 17.4896 21.8621 32.7931 21.5112 Constraint 201 535 20.7006 25.8758 38.8137 21.5112 Constraint 190 535 21.9473 27.4341 41.1511 21.5112 Constraint 182 535 19.0210 23.7763 35.6644 21.5112 Constraint 176 535 21.1701 26.4626 39.6939 21.5112 Constraint 169 535 18.6993 23.3741 35.0611 21.5112 Constraint 161 535 20.7266 25.9083 38.8624 21.5112 Constraint 144 535 17.4943 21.8679 32.8018 21.5112 Constraint 136 535 18.0594 22.5743 33.8614 21.5112 Constraint 128 535 16.5415 20.6769 31.0154 21.5112 Constraint 122 535 15.6589 19.5736 29.3605 21.5112 Constraint 113 535 16.1872 20.2340 30.3510 21.5112 Constraint 104 535 15.9703 19.9628 29.9443 21.5112 Constraint 391 657 20.7093 25.8866 38.8299 21.3739 Constraint 382 657 22.1770 27.7212 41.5818 21.3739 Constraint 330 668 22.3720 27.9650 41.9474 21.3720 Constraint 435 651 22.7895 28.4869 42.7303 21.3478 Constraint 435 644 23.4825 29.3532 44.0298 21.3478 Constraint 435 552 18.1036 22.6295 33.9442 21.2967 Constraint 429 552 16.0214 20.0268 30.0402 21.2967 Constraint 421 552 15.7499 19.6874 29.5311 21.2967 Constraint 80 629 21.4635 26.8294 40.2441 21.2810 Constraint 250 571 22.5354 28.1693 42.2540 21.2349 Constraint 314 544 18.2759 22.8449 34.2674 21.1064 Constraint 303 544 18.9446 23.6807 35.5211 21.1064 Constraint 297 544 18.9824 23.7280 35.5919 21.1064 Constraint 292 544 19.6519 24.5649 36.8473 21.1064 Constraint 285 544 20.8543 26.0678 39.1017 21.1064 Constraint 279 544 21.4580 26.8225 40.2338 21.1064 Constraint 272 544 21.5513 26.9392 40.4087 21.1064 Constraint 267 544 22.5950 28.2438 42.3657 21.1064 Constraint 259 544 21.6669 27.0837 40.6255 21.1064 Constraint 237 544 22.8667 28.5834 42.8751 21.1064 Constraint 226 544 23.7530 29.6913 44.5369 21.1064 Constraint 221 544 21.2631 26.5788 39.8682 21.1064 Constraint 210 544 19.4565 24.3206 36.4809 21.1064 Constraint 201 544 21.8379 27.2973 40.9460 21.1064 Constraint 190 544 22.3011 27.8764 41.8146 21.1064 Constraint 182 544 19.2872 24.1090 36.1634 21.1064 Constraint 176 544 21.0892 26.3615 39.5423 21.1064 Constraint 169 544 19.5863 24.4829 36.7243 21.1064 Constraint 161 544 20.3745 25.4682 38.2023 21.1064 Constraint 144 544 18.1040 22.6300 33.9450 21.1064 Constraint 136 544 17.7812 22.2265 33.3397 21.1064 Constraint 128 544 17.3785 21.7231 32.5847 21.1064 Constraint 122 544 17.5658 21.9573 32.9359 21.1064 Constraint 113 544 16.9918 21.2397 31.8596 21.1064 Constraint 104 544 16.3245 20.4056 30.6084 21.1064 Constraint 314 557 18.7342 23.4177 35.1266 21.0890 Constraint 303 557 19.0839 23.8548 35.7822 21.0890 Constraint 297 557 19.7593 24.6992 37.0487 21.0890 Constraint 292 557 20.4730 25.5912 38.3869 21.0890 Constraint 285 557 21.1767 26.4709 39.7063 21.0890 Constraint 279 557 21.8432 27.3040 40.9560 21.0890 Constraint 272 557 22.4531 28.0664 42.0996 21.0890 Constraint 267 557 23.0954 28.8693 43.3040 21.0890 Constraint 259 557 22.2773 27.8466 41.7699 21.0890 Constraint 237 557 23.9734 29.9668 44.9502 21.0890 Constraint 210 557 20.6815 25.8518 38.7777 21.0890 Constraint 201 557 23.2634 29.0793 43.6189 21.0890 Constraint 190 557 23.6096 29.5120 44.2680 21.0890 Constraint 182 557 20.6309 25.7887 38.6830 21.0890 Constraint 176 557 22.7099 28.3874 42.5811 21.0890 Constraint 435 577 18.5346 23.1682 34.7523 21.0839 Constraint 429 577 16.6207 20.7758 31.1638 21.0839 Constraint 421 577 16.3152 20.3940 30.5910 21.0839 Constraint 391 552 17.2463 21.5579 32.3368 20.9977 Constraint 382 552 19.3909 24.2386 36.3579 20.9977 Constraint 330 552 16.5873 20.7341 31.1011 20.9977 Constraint 322 552 16.5706 20.7132 31.0699 20.9977 Constraint 80 519 13.4196 16.7745 25.1618 20.9832 Constraint 429 668 22.2188 27.7735 41.6602 20.7716 Constraint 421 668 21.6448 27.0560 40.5841 20.7716 Constraint 412 668 23.4685 29.3357 44.0035 20.7716 Constraint 404 668 23.4025 29.2532 43.8798 20.7716 Constraint 442 636 22.0227 27.5284 41.2926 20.7615 Constraint 341 657 18.9669 23.7087 35.5630 20.7385 Constraint 341 552 16.7983 20.9979 31.4968 20.6977 Constraint 599 668 11.6152 14.5190 21.7785 20.5939 Constraint 590 668 13.6246 17.0308 25.5462 20.5939 Constraint 242 535 17.0530 21.3162 31.9743 20.5656 Constraint 96 636 21.7617 27.2022 40.8033 20.5196 Constraint 473 552 16.5249 20.6561 30.9841 20.4729 Constraint 442 519 13.7850 17.2313 25.8470 20.4430 Constraint 399 657 20.4048 25.5060 38.2590 20.3893 Constraint 391 668 22.5637 28.2046 42.3069 20.3739 Constraint 382 668 24.1798 30.2247 45.3371 20.3739 Constraint 435 544 18.7954 23.4943 35.2414 20.2967 Constraint 435 535 14.8872 18.6090 27.9136 20.2967 Constraint 429 544 16.7728 20.9660 31.4489 20.2967 Constraint 429 535 12.4412 15.5515 23.3272 20.2967 Constraint 421 544 16.2039 20.2549 30.3824 20.2967 Constraint 421 535 12.5815 15.7269 23.5903 20.2967 Constraint 473 577 17.3960 21.7450 32.6175 20.2600 Constraint 250 552 22.7026 28.3782 42.5674 20.2542 Constraint 136 657 24.1415 30.1768 45.2652 20.1976 Constraint 128 657 23.2047 29.0058 43.5088 20.1976 Constraint 122 657 22.9147 28.6433 42.9650 20.1976 Constraint 113 657 22.7914 28.4893 42.7339 20.1976 Constraint 104 657 22.3226 27.9032 41.8549 20.1976 Constraint 88 657 21.7420 27.1775 40.7663 20.1976 Constraint 242 544 20.8799 26.0999 39.1498 20.1608 Constraint 250 519 21.1203 26.4004 39.6006 20.1541 Constraint 242 557 21.6928 27.1160 40.6741 20.1435 Constraint 449 519 11.2471 14.0589 21.0883 20.1430 Constraint 169 557 21.5771 26.9714 40.4571 20.1044 Constraint 161 557 22.6863 28.3578 42.5367 20.1044 Constraint 144 557 20.1297 25.1621 37.7432 20.1044 Constraint 136 557 19.4427 24.3033 36.4550 20.1044 Constraint 128 557 19.2617 24.0772 36.1158 20.1044 Constraint 122 557 19.6535 24.5669 36.8503 20.1044 Constraint 113 557 18.6858 23.3573 35.0359 20.1044 Constraint 104 557 17.7393 22.1741 33.2612 20.1044 Constraint 226 557 24.9284 31.1605 46.7407 20.0890 Constraint 221 557 22.3217 27.9021 41.8532 20.0890 Constraint 375 657 20.9197 26.1496 39.2244 20.0758 Constraint 368 657 21.1030 26.3787 39.5681 20.0758 Constraint 360 657 19.9503 24.9379 37.4069 20.0758 Constraint 355 657 20.6912 25.8640 38.7960 20.0758 Constraint 442 651 21.8749 27.3436 41.0154 20.0143 Constraint 442 644 22.8848 28.6059 42.9089 20.0143 Constraint 88 552 15.2362 19.0453 28.5679 20.0131 Constraint 88 571 18.9520 23.6900 35.5349 20.0093 Constraint 391 527 12.4221 15.5277 23.2915 19.9909 Constraint 391 519 14.2771 17.8463 26.7695 19.9909 Constraint 382 527 14.6412 18.3015 27.4523 19.9909 Constraint 382 519 15.9416 19.9269 29.8904 19.9909 Constraint 330 527 14.8281 18.5351 27.8027 19.9909 Constraint 322 527 13.0225 16.2782 24.4173 19.9909 Constraint 314 527 13.1793 16.4741 24.7111 19.9909 Constraint 303 527 16.2466 20.3083 30.4625 19.9909 Constraint 297 527 16.6063 20.7579 31.1369 19.9909 Constraint 292 527 15.4416 19.3020 28.9530 19.9909 Constraint 285 527 17.4190 21.7738 32.6606 19.9909 Constraint 279 527 19.7763 24.7203 37.0805 19.9909 Constraint 272 527 19.4133 24.2666 36.3999 19.9909 Constraint 267 527 19.8449 24.8061 37.2091 19.9909 Constraint 259 527 17.3024 21.6280 32.4420 19.9909 Constraint 237 527 18.2963 22.8704 34.3056 19.9909 Constraint 226 527 19.9435 24.9294 37.3941 19.9909 Constraint 221 527 17.4952 21.8690 32.8035 19.9909 Constraint 210 527 15.3241 19.1551 28.7326 19.9909 Constraint 201 527 18.5585 23.1982 34.7972 19.9909 Constraint 190 527 19.9649 24.9561 37.4341 19.9909 Constraint 182 527 17.0240 21.2800 31.9201 19.9909 Constraint 176 527 18.9680 23.7100 35.5649 19.9909 Constraint 169 527 16.4430 20.5537 30.8305 19.9909 Constraint 161 527 18.5411 23.1764 34.7646 19.9909 Constraint 144 527 14.9774 18.7217 28.0826 19.9909 Constraint 136 527 15.4352 19.2940 28.9410 19.9909 Constraint 128 527 14.0133 17.5166 26.2749 19.9909 Constraint 122 527 12.4966 15.6208 23.4312 19.9909 Constraint 113 527 13.2055 16.5069 24.7603 19.9909 Constraint 104 527 13.5105 16.8881 25.3322 19.9909 Constraint 88 527 11.2882 14.1102 21.1653 19.9909 Constraint 391 577 17.5402 21.9253 32.8879 19.9823 Constraint 391 571 18.9981 23.7476 35.6214 19.9823 Constraint 382 577 19.7562 24.6953 37.0429 19.9823 Constraint 382 571 21.1709 26.4637 39.6955 19.9823 Constraint 404 577 17.9577 22.4471 33.6706 19.9753 Constraint 442 552 17.4761 21.8452 32.7677 19.9633 Constraint 153 519 15.3091 19.1363 28.7045 19.9556 Constraint 153 636 24.7517 30.9396 46.4094 19.8556 Constraint 435 657 21.6705 27.0881 40.6321 19.7870 Constraint 442 577 18.0255 22.5319 33.7979 19.7504 Constraint 497 613 19.8491 24.8114 37.2171 19.7475 Constraint 497 604 17.9907 22.4884 33.7325 19.7474 Constraint 341 668 20.2469 25.3086 37.9629 19.7385 Constraint 375 552 18.3173 22.8967 34.3450 19.6997 Constraint 368 552 18.4684 23.0855 34.6283 19.6997 Constraint 360 552 16.1461 20.1826 30.2739 19.6997 Constraint 355 552 17.5682 21.9602 32.9403 19.6997 Constraint 350 552 17.5483 21.9354 32.9031 19.6997 Constraint 341 527 15.2502 19.0627 28.5940 19.6909 Constraint 449 552 15.5599 19.4499 29.1748 19.6633 Constraint 153 552 17.8629 22.3286 33.4930 19.6441 Constraint 153 577 19.1197 23.8996 35.8495 19.6402 Constraint 153 571 20.1842 25.2302 37.8453 19.6402 Constraint 144 657 24.9066 31.1332 46.6998 19.6019 Constraint 322 676 23.2997 29.1246 43.6869 19.5958 Constraint 314 676 23.4771 29.3464 44.0197 19.5958 Constraint 303 676 23.8282 29.7853 44.6779 19.5958 Constraint 297 676 24.0865 30.1081 45.1622 19.5958 Constraint 292 676 24.3438 30.4298 45.6447 19.5958 Constraint 96 644 23.6426 29.5532 44.3298 19.5840 Constraint 480 577 16.2838 20.3548 30.5322 19.4709 Constraint 480 571 17.7481 22.1851 33.2776 19.4709 Constraint 449 577 16.5803 20.7254 31.0881 19.4504 Constraint 489 613 19.3057 24.1321 36.1982 19.4475 Constraint 489 604 17.2762 21.5953 32.3929 19.4474 Constraint 391 535 13.5583 16.9478 25.4218 19.4179 Constraint 382 535 15.1532 18.9415 28.4123 19.4179 Constraint 330 535 16.6470 20.8087 31.2131 19.4179 Constraint 322 535 15.6023 19.5029 29.2543 19.4179 Constraint 88 535 14.0127 17.5158 26.2737 19.4179 Constraint 399 668 22.2131 27.7664 41.6496 19.3893 Constraint 80 636 21.7515 27.1894 40.7841 19.3191 Constraint 435 571 21.1768 26.4710 39.7065 19.2967 Constraint 429 571 19.6265 24.5331 36.7996 19.2967 Constraint 421 571 18.7536 23.4419 35.1629 19.2967 Constraint 285 676 24.4403 30.5504 45.8256 19.2958 Constraint 279 676 24.8270 31.0338 46.5507 19.2958 Constraint 267 676 25.5872 31.9840 47.9760 19.2958 Constraint 259 676 25.3859 31.7324 47.5987 19.2958 Constraint 250 676 27.5162 34.3952 51.5928 19.2958 Constraint 242 676 25.2401 31.5501 47.3252 19.2958 Constraint 585 657 11.9140 14.8925 22.3388 19.2044 Constraint 412 552 18.5414 23.1767 34.7650 19.2035 Constraint 404 552 18.6392 23.2991 34.9486 19.2035 Constraint 399 552 16.8005 21.0006 31.5010 19.2035 Constraint 161 657 25.2496 31.5620 47.3431 19.1995 Constraint 136 668 26.6062 33.2577 49.8865 19.1976 Constraint 128 668 25.6670 32.0837 48.1256 19.1976 Constraint 122 668 25.4391 31.7989 47.6983 19.1976 Constraint 113 668 25.2263 31.5329 47.2993 19.1976 Constraint 104 668 24.6812 30.8516 46.2773 19.1976 Constraint 88 668 24.1738 30.2172 45.3258 19.1976 Constraint 399 527 10.2128 12.7660 19.1490 19.1813 Constraint 96 651 23.0870 28.8588 43.2882 19.1792 Constraint 497 599 18.2983 22.8729 34.3093 19.1745 Constraint 497 590 19.3434 24.1793 36.2689 19.1745 Constraint 557 629 11.8700 14.8374 22.2562 19.1335 Constraint 341 535 15.9746 19.9682 29.9523 19.1179 Constraint 375 668 22.8258 28.5322 42.7983 19.0758 Constraint 368 668 22.7463 28.4328 42.6492 19.0758 Constraint 360 668 21.6015 27.0019 40.5028 19.0758 Constraint 355 668 21.8985 27.3732 41.0597 19.0758 Constraint 153 535 16.9938 21.2422 31.8634 19.0489 Constraint 242 527 16.0821 20.1026 30.1540 19.0453 Constraint 96 552 15.5731 19.4664 29.1996 19.0151 Constraint 391 544 18.6056 23.2570 34.8854 19.0131 Constraint 382 544 20.9446 26.1808 39.2711 19.0131 Constraint 330 544 17.5302 21.9128 32.8691 19.0131 Constraint 322 544 17.8903 22.3629 33.5444 19.0131 Constraint 88 544 16.4646 20.5808 30.8711 19.0131 Constraint 330 557 18.0486 22.5608 33.8412 18.9958 Constraint 322 557 18.6438 23.3048 34.9571 18.9958 Constraint 96 527 10.8486 13.5608 20.3411 18.9928 Constraint 412 577 18.4530 23.0663 34.5994 18.9907 Constraint 442 544 18.0490 22.5613 33.8419 18.9633 Constraint 442 535 15.2486 19.0607 28.5911 18.9633 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 489 599 17.5675 21.9594 32.9391 18.8745 Constraint 489 590 18.7320 23.4149 35.1224 18.8745 Constraint 449 636 21.0666 26.3333 39.4999 18.8024 Constraint 96 577 17.2116 21.5145 32.2718 18.8022 Constraint 435 668 24.5088 30.6360 45.9540 18.7870 Constraint 435 527 11.8181 14.7727 22.1590 18.7765 Constraint 429 527 9.5040 11.8800 17.8200 18.7765 Constraint 421 527 9.9010 12.3763 18.5644 18.7765 Constraint 412 527 12.4641 15.5802 23.3702 18.7765 Constraint 404 527 12.2521 15.3152 22.9728 18.7765 Constraint 497 585 17.5213 21.9016 32.8524 18.7696 Constraint 350 657 19.0950 23.8687 35.8031 18.7423 Constraint 341 544 17.8963 22.3703 33.5555 18.7131 Constraint 341 557 17.4367 21.7959 32.6938 18.6958 Constraint 375 527 13.1753 16.4691 24.7037 18.6928 Constraint 375 519 14.1906 17.7383 26.6074 18.6928 Constraint 368 527 14.0052 17.5064 26.2597 18.6928 Constraint 368 519 15.6757 19.5947 29.3920 18.6928 Constraint 360 527 11.0543 13.8179 20.7269 18.6928 Constraint 360 519 13.2092 16.5115 24.7672 18.6928 Constraint 355 527 13.5967 16.9959 25.4938 18.6928 Constraint 350 527 14.2246 17.7807 26.6710 18.6928 Constraint 375 577 19.0658 23.8322 35.7483 18.6842 Constraint 375 571 20.6053 25.7567 38.6350 18.6842 Constraint 368 577 18.9919 23.7399 35.6099 18.6842 Constraint 368 571 20.4104 25.5130 38.2695 18.6842 Constraint 360 577 17.0579 21.3224 31.9836 18.6842 Constraint 360 571 18.5823 23.2279 34.8418 18.6842 Constraint 355 577 18.1173 22.6467 33.9700 18.6842 Constraint 355 571 19.7093 24.6367 36.9550 18.6842 Constraint 350 577 18.0508 22.5635 33.8453 18.6842 Constraint 350 571 19.6192 24.5240 36.7860 18.6842 Constraint 250 535 19.3278 24.1597 36.2396 18.6744 Constraint 467 552 16.0482 20.0603 30.0905 18.6652 Constraint 461 552 15.1061 18.8827 28.3240 18.6652 Constraint 449 544 16.1898 20.2373 30.3559 18.6633 Constraint 449 535 13.4411 16.8014 25.2021 18.6633 Constraint 153 544 17.8568 22.3210 33.4815 18.6441 Constraint 399 535 11.4091 14.2613 21.3920 18.6083 Constraint 144 668 27.4567 34.3209 51.4814 18.6019 Constraint 497 622 21.1196 26.3995 39.5992 18.6015 Constraint 272 676 24.8502 31.0627 46.5941 18.5977 Constraint 210 676 24.2738 30.3422 45.5133 18.5977 Constraint 201 676 25.9279 32.4099 48.6149 18.5977 Constraint 190 676 25.7902 32.2377 48.3566 18.5977 Constraint 182 676 23.6698 29.5872 44.3808 18.5977 Constraint 176 676 25.0461 31.3076 46.9615 18.5977 Constraint 604 676 11.7978 14.7473 22.1209 18.5958 Constraint 535 613 17.8716 22.3394 33.5092 18.5112 Constraint 535 604 16.1088 20.1360 30.2040 18.5112 Constraint 473 571 20.0315 25.0394 37.5592 18.4729 Constraint 489 585 16.9496 21.1870 31.7806 18.4696 Constraint 442 657 20.7657 25.9571 38.9357 18.4536 Constraint 467 577 16.8787 21.0984 31.6476 18.4523 Constraint 461 577 16.1521 20.1901 30.2852 18.4523 Constraint 96 535 13.8808 17.3511 26.0266 18.4199 Constraint 80 552 14.8670 18.5838 27.8757 18.4103 Constraint 489 622 20.3137 25.3922 38.0883 18.3015 Constraint 237 676 25.9938 32.4922 48.7383 18.2977 Constraint 435 557 20.7139 25.8923 38.8385 18.2967 Constraint 429 557 19.1448 23.9310 35.8966 18.2967 Constraint 421 557 18.2501 22.8127 34.2190 18.2967 Constraint 221 676 25.8583 32.3229 48.4844 18.2958 Constraint 250 544 23.7383 29.6729 44.5093 18.2696 Constraint 250 557 24.1210 30.1512 45.2268 18.2523 Constraint 585 668 13.5009 16.8762 25.3143 18.2044 Constraint 412 544 19.2185 24.0232 36.0348 18.2035 Constraint 412 535 14.6153 18.2692 27.4038 18.2035 Constraint 404 544 19.5883 24.4854 36.7281 18.2035 Constraint 404 535 13.6855 17.1069 25.6604 18.2035 Constraint 399 544 17.7036 22.1295 33.1942 18.2035 Constraint 96 657 22.0350 27.5437 41.3155 18.2014 Constraint 161 668 27.9003 34.8753 52.3130 18.1995 Constraint 404 571 20.9261 26.1577 39.2365 18.1881 Constraint 399 577 17.3969 21.7462 32.6193 18.1881 Constraint 399 571 19.4144 24.2680 36.4020 18.1881 Constraint 552 629 12.7584 15.9480 23.9220 18.1354 Constraint 375 535 12.6002 15.7503 23.6254 18.1199 Constraint 368 535 13.6040 17.0049 25.5074 18.1199 Constraint 360 535 11.7590 14.6987 22.0480 18.1199 Constraint 355 535 12.7977 15.9972 23.9958 18.1199 Constraint 350 535 14.6055 18.2569 27.3853 18.1199 Constraint 544 613 13.0857 16.3572 24.5357 18.1064 Constraint 449 651 21.9140 27.3925 41.0888 18.0553 Constraint 449 644 22.6013 28.2516 42.3774 18.0553 Constraint 96 544 16.4796 20.5995 30.8992 18.0151 Constraint 88 557 18.4580 23.0725 34.6088 18.0112 Constraint 391 557 19.2737 24.0921 36.1381 17.9977 Constraint 382 557 21.4397 26.7997 40.1995 17.9977 Constraint 511 604 18.9718 23.7147 35.5720 17.9909 Constraint 80 527 12.7425 15.9282 23.8922 17.9832 Constraint 80 644 24.1266 30.1583 45.2375 17.9787 Constraint 442 571 20.3889 25.4861 38.2291 17.9632 Constraint 473 644 21.9702 27.4627 41.1941 17.8771 Constraint 473 636 19.6588 24.5736 36.8603 17.8146 Constraint 467 636 19.8703 24.8378 37.2568 17.8146 Constraint 461 636 20.3919 25.4898 38.2348 17.8146 Constraint 330 676 23.3859 29.2324 43.8486 17.8086 Constraint 497 629 20.4549 25.5687 38.3530 17.7919 Constraint 153 644 25.9674 32.4593 48.6889 17.7741 Constraint 497 577 16.7317 20.9146 31.3720 17.7729 Constraint 350 668 20.5072 25.6340 38.4510 17.7424 Constraint 375 544 20.0410 25.0513 37.5769 17.7151 Constraint 368 544 20.1306 25.1632 37.7448 17.7151 Constraint 360 544 17.7456 22.1820 33.2729 17.7151 Constraint 355 544 18.9546 23.6932 35.5398 17.7151 Constraint 350 544 18.4892 23.1115 34.6672 17.7151 Constraint 467 544 16.8084 21.0105 31.5157 17.6652 Constraint 461 544 16.3341 20.4176 30.6264 17.6652 Constraint 461 535 12.3548 15.4435 23.1652 17.6652 Constraint 449 571 18.9936 23.7420 35.6130 17.6632 Constraint 153 557 20.1542 25.1928 37.7892 17.6422 Constraint 169 676 25.4165 31.7707 47.6560 17.6131 Constraint 80 577 17.9051 22.3813 33.5720 17.6017 Constraint 80 651 23.8619 29.8273 44.7410 17.5739 Constraint 341 676 23.0399 28.7998 43.1997 17.5086 Constraint 480 644 21.4916 26.8644 40.2967 17.4928 Constraint 489 629 19.7300 24.6625 36.9937 17.4919 Constraint 480 557 18.0832 22.6040 33.9059 17.4729 Constraint 473 557 19.6334 24.5418 36.8127 17.4729 Constraint 489 577 15.8890 19.8612 29.7918 17.4729 Constraint 489 571 17.5576 21.9470 32.9204 17.4729 Constraint 473 651 22.0054 27.5067 41.2601 17.4723 Constraint 442 668 23.7897 29.7371 44.6056 17.4536 Constraint 442 527 11.4705 14.3381 21.5071 17.4430 Constraint 480 636 18.3869 22.9836 34.4754 17.4303 Constraint 511 599 19.3434 24.1793 36.2689 17.4179 Constraint 511 590 20.3347 25.4184 38.1276 17.4179 Constraint 80 544 16.1877 20.2347 30.3520 17.4103 Constraint 80 535 15.2197 19.0246 28.5370 17.4103 Constraint 153 651 25.5973 31.9966 47.9950 17.3693 Constraint 535 622 18.4380 23.0475 34.5712 17.3652 Constraint 226 676 27.0817 33.8522 50.7782 17.2977 Constraint 429 676 25.3255 31.6569 47.4854 17.2083 Constraint 421 676 24.1871 30.2339 45.3509 17.2083 Constraint 412 676 26.4789 33.0986 49.6479 17.2083 Constraint 404 676 27.2156 34.0195 51.0293 17.2083 Constraint 412 571 21.2019 26.5023 39.7535 17.2035 Constraint 96 668 24.5880 30.7350 46.1026 17.2014 Constraint 250 527 19.6543 24.5678 36.8518 17.1542 Constraint 449 527 9.4057 11.7571 17.6356 17.1430 Constraint 480 651 21.9498 27.4372 41.1558 17.0880 Constraint 599 676 12.4718 15.5898 23.3847 17.0305 Constraint 590 676 14.5914 18.2393 27.3590 17.0305 Constraint 96 571 19.5917 24.4897 36.7345 17.0150 Constraint 511 585 18.7117 23.3896 35.0844 17.0131 Constraint 80 657 22.7210 28.4012 42.6018 17.0009 Constraint 527 613 18.8431 23.5539 35.3309 16.9909 Constraint 527 604 16.7638 20.9548 31.4322 16.9909 Constraint 519 613 19.5496 24.4370 36.6556 16.9909 Constraint 519 604 17.5603 21.9504 32.9256 16.9909 Constraint 511 613 21.3461 26.6826 40.0239 16.9909 Constraint 153 657 25.3232 31.6540 47.4809 16.9645 Constraint 442 557 19.9380 24.9225 37.3838 16.9633 Constraint 544 622 12.7554 15.9442 23.9163 16.9604 Constraint 153 527 13.4839 16.8549 25.2824 16.9557 Constraint 577 644 12.4144 15.5180 23.2770 16.9280 Constraint 391 676 25.9449 32.4312 48.6467 16.8106 Constraint 382 676 28.2895 35.3619 53.0428 16.8106 Constraint 375 557 20.6323 25.7904 38.6856 16.6997 Constraint 368 557 20.4518 25.5647 38.3471 16.6997 Constraint 360 557 18.3899 22.9874 34.4811 16.6997 Constraint 355 557 18.9981 23.7476 35.6214 16.6997 Constraint 350 557 19.1340 23.9174 35.8762 16.6997 Constraint 467 571 19.9749 24.9686 37.4529 16.6652 Constraint 461 571 19.1675 23.9594 35.9391 16.6652 Constraint 449 557 18.5305 23.1631 34.7446 16.6633 Constraint 535 629 18.8911 23.6138 35.4207 16.5556 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 473 657 19.8155 24.7694 37.1541 16.4945 Constraint 449 657 20.7235 25.9044 38.8566 16.4945 Constraint 527 599 16.4973 20.6216 30.9325 16.4179 Constraint 519 599 17.4030 21.7538 32.6307 16.4179 Constraint 519 590 18.3531 22.9414 34.4122 16.4179 Constraint 80 571 19.3976 24.2469 36.3704 16.4102 Constraint 613 687 13.6280 17.0350 25.5525 16.3198 Constraint 322 687 23.1761 28.9701 43.4552 16.3198 Constraint 314 687 22.9606 28.7008 43.0512 16.3198 Constraint 303 687 22.7702 28.4627 42.6940 16.3198 Constraint 297 687 23.1796 28.9745 43.4617 16.3198 Constraint 292 687 23.5889 29.4861 44.2291 16.3198 Constraint 210 687 24.7487 30.9359 46.4038 16.3198 Constraint 182 687 23.8363 29.7954 44.6930 16.3198 Constraint 412 557 20.8642 26.0803 39.1204 16.2035 Constraint 404 557 21.4847 26.8558 40.2837 16.2035 Constraint 399 557 19.7124 24.6404 36.9607 16.2035 Constraint 544 629 13.5073 16.8842 25.3263 16.1508 Constraint 285 687 23.1546 28.9433 43.4149 16.1198 Constraint 279 687 23.1463 28.9329 43.3993 16.1198 Constraint 272 687 24.0532 30.0665 45.0998 16.1198 Constraint 267 687 23.9059 29.8824 44.8236 16.1198 Constraint 259 687 24.3578 30.4472 45.6709 16.1198 Constraint 250 687 26.4734 33.0917 49.6375 16.1198 Constraint 242 687 24.5500 30.6875 46.0313 16.1198 Constraint 237 687 26.2316 32.7895 49.1842 16.1198 Constraint 467 651 23.0888 28.8610 43.2915 16.0694 Constraint 467 644 22.8278 28.5348 42.8021 16.0694 Constraint 461 651 22.4528 28.0660 42.0990 16.0694 Constraint 461 644 22.7350 28.4187 42.6281 16.0694 Constraint 571 636 12.5948 15.7434 23.6152 16.0630 Constraint 96 557 18.6449 23.3061 34.9591 16.0151 Constraint 80 668 25.1196 31.3995 47.0993 16.0009 Constraint 153 668 28.1824 35.2280 52.8419 15.9645 Constraint 527 622 19.4698 24.3373 36.5059 15.8450 Constraint 519 622 20.1145 25.1431 37.7147 15.8450 Constraint 511 622 22.6622 28.3277 42.4916 15.8450 Constraint 399 676 26.1007 32.6259 48.9389 15.8260 Constraint 330 687 22.7146 28.3932 42.5898 15.7241 Constraint 467 557 19.6548 24.5685 36.8527 15.6652 Constraint 461 557 18.7066 23.3832 35.0748 15.6652 Constraint 136 676 27.8346 34.7932 52.1899 15.6343 Constraint 128 676 27.2788 34.0985 51.1478 15.6343 Constraint 122 676 27.7709 34.7136 52.0705 15.6343 Constraint 113 676 27.3417 34.1771 51.2657 15.6343 Constraint 104 676 26.2341 32.7927 49.1890 15.6343 Constraint 88 676 26.9779 33.7224 50.5836 15.6343 Constraint 622 698 13.6616 17.0769 25.6154 15.5241 Constraint 613 698 14.6993 18.3742 27.5613 15.5241 Constraint 341 698 20.9388 26.1735 39.2603 15.5241 Constraint 341 687 22.1547 27.6933 41.5400 15.5241 Constraint 330 698 21.6072 27.0090 40.5136 15.5241 Constraint 322 698 22.2543 27.8178 41.7267 15.5241 Constraint 314 698 21.7202 27.1502 40.7254 15.5241 Constraint 303 698 21.3035 26.6294 39.9441 15.5241 Constraint 297 698 21.8868 27.3585 41.0377 15.5241 Constraint 292 698 22.2294 27.7867 41.6800 15.5241 Constraint 285 698 21.6855 27.1069 40.6603 15.5241 Constraint 279 698 21.7029 27.1287 40.6930 15.5241 Constraint 272 698 22.7596 28.4494 42.6742 15.5241 Constraint 267 698 22.4018 28.0022 42.0033 15.5241 Constraint 259 698 22.9500 28.6876 43.0313 15.5241 Constraint 250 698 25.1762 31.4703 47.2054 15.5241 Constraint 242 698 23.5029 29.3787 44.0680 15.5241 Constraint 237 698 25.3233 31.6541 47.4812 15.5241 Constraint 210 698 23.7742 29.7178 44.5766 15.5241 Constraint 201 698 25.2871 31.6089 47.4133 15.5241 Constraint 190 698 24.3147 30.3934 45.5900 15.5241 Constraint 182 698 22.7288 28.4110 42.6164 15.5241 Constraint 176 698 24.5491 30.6864 46.0296 15.5241 Constraint 169 698 25.0060 31.2575 46.8862 15.5241 Constraint 375 676 27.2729 34.0911 51.1366 15.5125 Constraint 368 676 26.5456 33.1820 49.7730 15.5125 Constraint 360 676 24.8664 31.0830 46.6245 15.5125 Constraint 355 676 24.9390 31.1738 46.7606 15.5125 Constraint 350 676 23.9381 29.9226 44.8840 15.5125 Constraint 467 657 20.9934 26.2417 39.3626 15.4964 Constraint 461 657 20.7106 25.8883 38.8324 15.4964 Constraint 473 668 22.5147 28.1434 42.2151 15.4945 Constraint 449 668 23.8210 29.7763 44.6644 15.4945 Constraint 80 557 17.9767 22.4708 33.7062 15.4103 Constraint 201 687 25.2191 31.5239 47.2859 15.3217 Constraint 190 687 24.4944 30.6180 45.9269 15.3217 Constraint 176 687 24.3372 30.4215 45.6322 15.3217 Constraint 169 687 24.6203 30.7754 46.1631 15.3217 Constraint 604 687 12.1060 15.1325 22.6988 15.3198 Constraint 435 676 28.1621 35.2026 52.8039 15.2237 Constraint 571 644 14.6229 18.2787 27.4180 15.1408 Constraint 221 687 24.9743 31.2178 46.8267 15.1198 Constraint 480 657 19.5467 24.4334 36.6501 15.1121 Constraint 144 676 29.4658 36.8322 55.2483 15.0385 Constraint 527 629 19.3341 24.1677 36.2515 15.0354 Constraint 519 629 20.0376 25.0470 37.5706 15.0354 Constraint 511 629 21.9065 27.3832 41.0748 15.0354 Constraint 429 687 25.4264 31.7831 47.6746 14.9169 Constraint 421 687 23.6949 29.6186 44.4279 14.9169 Constraint 412 687 25.6752 32.0940 48.1410 14.9169 Constraint 404 687 26.8493 33.5616 50.3424 14.9169 Constraint 571 651 14.0388 17.5485 26.3228 14.7360 Constraint 399 687 25.2561 31.5701 47.3552 14.7260 Constraint 391 687 24.8921 31.1151 46.6726 14.7260 Constraint 382 687 27.2479 34.0598 51.0897 14.7260 Constraint 585 676 15.2079 19.0099 28.5148 14.6411 Constraint 161 676 29.1638 36.4547 54.6820 14.6362 Constraint 577 668 14.1741 17.7177 26.5765 14.5473 Constraint 577 657 11.5537 14.4421 21.6631 14.5473 Constraint 399 698 24.0362 30.0453 45.0680 14.5260 Constraint 391 698 23.5863 29.4829 44.2243 14.5260 Constraint 382 698 25.9745 32.4682 48.7023 14.5260 Constraint 604 698 12.4866 15.6083 23.4124 14.5241 Constraint 226 698 25.8942 32.3677 48.5516 14.5241 Constraint 221 698 23.6223 29.5279 44.2918 14.5241 Constraint 467 668 23.8957 29.8696 44.8044 14.4964 Constraint 461 668 23.7455 29.6818 44.5228 14.4964 Constraint 557 644 14.7255 18.4068 27.6102 14.1427 Constraint 226 687 26.0767 32.5958 48.8938 14.1217 Constraint 429 698 24.8867 31.1084 46.6625 14.1212 Constraint 421 698 23.0870 28.8588 43.2882 14.1212 Constraint 412 698 24.9804 31.2255 46.8382 14.1212 Constraint 404 698 26.0594 32.5743 48.8614 14.1212 Constraint 629 706 12.3339 15.4174 23.1261 14.1193 Constraint 622 706 14.4440 18.0551 27.0826 14.1193 Constraint 613 706 15.3496 19.1870 28.7806 14.1193 Constraint 341 706 21.3294 26.6617 39.9926 14.1193 Constraint 330 706 22.0707 27.5884 41.3826 14.1193 Constraint 322 706 23.3424 29.1780 43.7671 14.1193 Constraint 314 706 22.6997 28.3747 42.5620 14.1193 Constraint 303 706 21.7250 27.1562 40.7343 14.1193 Constraint 297 706 22.6124 28.2655 42.3982 14.1193 Constraint 292 706 23.4393 29.2991 43.9487 14.1193 Constraint 285 706 22.5107 28.1383 42.2075 14.1193 Constraint 279 706 22.2326 27.7907 41.6861 14.1193 Constraint 272 706 23.8373 29.7967 44.6950 14.1193 Constraint 267 706 23.3084 29.1355 43.7033 14.1193 Constraint 259 706 24.3039 30.3799 45.5699 14.1193 Constraint 250 706 26.7608 33.4510 50.1765 14.1193 Constraint 242 706 25.1370 31.4213 47.1319 14.1193 Constraint 237 706 27.3886 34.2357 51.3536 14.1193 Constraint 210 706 25.5729 31.9661 47.9491 14.1193 Constraint 182 706 24.0793 30.0991 45.1487 14.1193 Constraint 480 668 21.9020 27.3775 41.0662 14.1121 Constraint 557 636 12.9698 16.2122 24.3183 14.0803 Constraint 577 676 15.5490 19.4362 29.1543 13.9744 Constraint 442 676 26.6850 33.3563 50.0344 13.8902 Constraint 497 644 23.9064 29.8830 44.8244 13.8012 Constraint 599 687 11.9453 14.9316 22.3974 13.7545 Constraint 590 687 14.9011 18.6264 27.9396 13.7545 Constraint 557 651 14.8468 18.5585 27.8377 13.7379 Constraint 96 676 26.8401 33.5501 50.3252 13.6381 Constraint 375 698 25.7348 32.1684 48.2527 13.5279 Constraint 375 687 26.8023 33.5029 50.2543 13.5279 Constraint 368 698 24.3605 30.4507 45.6760 13.5279 Constraint 368 687 25.5486 31.9357 47.9036 13.5279 Constraint 360 698 22.9390 28.6738 43.0107 13.5279 Constraint 360 687 24.1522 30.1902 45.2853 13.5279 Constraint 355 698 22.6894 28.3617 42.5425 13.5279 Constraint 355 687 24.0936 30.1170 45.1755 13.5279 Constraint 350 698 21.7897 27.2371 40.8557 13.5279 Constraint 350 687 23.0019 28.7523 43.1285 13.5279 Constraint 489 644 23.4246 29.2808 43.9212 13.5012 Constraint 497 651 23.8725 29.8406 44.7609 13.3964 Constraint 144 687 28.8288 36.0360 54.0540 13.3429 Constraint 136 687 27.4870 34.3587 51.5381 13.3429 Constraint 128 687 26.8213 33.5266 50.2900 13.3429 Constraint 122 687 27.6222 34.5278 51.7917 13.3429 Constraint 113 687 27.2390 34.0488 51.0732 13.3429 Constraint 104 687 25.8028 32.2535 48.3803 13.3429 Constraint 88 687 26.8481 33.5601 50.3402 13.3429 Constraint 552 644 15.9033 19.8792 29.8187 13.1447 Constraint 527 644 21.9826 27.4783 41.2174 13.1378 Constraint 519 644 23.3932 29.2415 43.8623 13.1378 Constraint 511 644 25.3641 31.7052 47.5577 13.1378 Constraint 429 706 26.4422 33.0528 49.5792 13.1212 Constraint 421 706 24.2881 30.3601 45.5402 13.1212 Constraint 412 706 26.1849 32.7311 49.0966 13.1212 Constraint 404 706 27.4691 34.3364 51.5046 13.1212 Constraint 399 706 25.3708 31.7136 47.5703 13.1212 Constraint 391 706 24.6114 30.7642 46.1464 13.1212 Constraint 382 706 27.1800 33.9751 50.9626 13.1212 Constraint 201 706 26.1840 32.7300 49.0950 13.1212 Constraint 190 706 24.7407 30.9259 46.3888 13.1212 Constraint 176 706 25.1364 31.4205 47.1307 13.1212 Constraint 169 706 26.0301 32.5377 48.8065 13.1212 Constraint 604 706 13.3902 16.7378 25.1067 13.1193 Constraint 221 706 24.9297 31.1622 46.7432 13.1193 Constraint 489 651 23.5494 29.4368 44.1552 13.0964 Constraint 552 636 13.8233 17.2791 25.9186 13.0822 Constraint 599 698 12.8856 16.1070 24.1605 12.9588 Constraint 590 698 16.0979 20.1224 30.1836 12.9588 Constraint 435 687 27.4353 34.2942 51.4413 12.9323 Constraint 571 668 16.3215 20.4019 30.6029 12.7602 Constraint 571 657 13.7257 17.1572 25.7358 12.7602 Constraint 557 668 16.8730 21.0913 31.6369 12.7602 Constraint 557 657 14.4557 18.0696 27.1044 12.7602 Constraint 552 651 16.0311 20.0389 30.0583 12.7399 Constraint 497 636 22.9360 28.6700 43.0050 12.7387 Constraint 527 651 21.7386 27.1733 40.7599 12.7330 Constraint 519 651 23.4806 29.3508 44.0262 12.7330 Constraint 511 651 25.7622 32.2028 48.3042 12.7330 Constraint 535 644 23.0199 28.7749 43.1623 12.5649 Constraint 144 698 28.6951 35.8689 53.8033 12.5471 Constraint 136 698 27.4929 34.3661 51.5491 12.5471 Constraint 128 698 26.4434 33.0542 49.5814 12.5471 Constraint 122 698 27.1368 33.9210 50.8816 12.5471 Constraint 113 698 27.0623 33.8279 50.7419 12.5471 Constraint 104 698 25.5087 31.8859 47.8289 12.5471 Constraint 88 698 26.1165 32.6456 48.9684 12.5471 Constraint 489 636 21.7218 27.1522 40.7284 12.4387 Constraint 80 676 27.6457 34.5571 51.8357 12.4376 Constraint 497 668 23.4560 29.3200 43.9800 12.4186 Constraint 497 657 21.3491 26.6864 40.0296 12.4186 Constraint 161 687 28.5324 35.6655 53.4982 12.3448 Constraint 571 676 17.1651 21.4564 32.1847 12.1872 Constraint 557 676 18.1778 22.7223 34.0834 12.1872 Constraint 544 644 17.9111 22.3888 33.5833 12.1601 Constraint 535 651 22.8827 28.6034 42.9052 12.1601 Constraint 435 698 26.8119 33.5149 50.2723 12.1366 Constraint 375 706 26.8377 33.5471 50.3207 12.1231 Constraint 368 706 24.9933 31.2416 46.8624 12.1231 Constraint 360 706 23.6906 29.6132 44.4198 12.1231 Constraint 355 706 22.9978 28.7473 43.1209 12.1231 Constraint 350 706 22.2468 27.8085 41.7127 12.1231 Constraint 226 706 26.4654 33.0817 49.6225 12.1212 Constraint 489 668 22.9607 28.7008 43.0512 12.1186 Constraint 489 657 20.8889 26.1112 39.1667 12.1186 Constraint 527 636 21.5905 26.9881 40.4822 12.0754 Constraint 519 636 22.0882 27.6103 41.4154 12.0754 Constraint 511 636 23.9144 29.8931 44.8396 12.0754 Constraint 153 676 29.8562 37.3202 55.9804 11.9760 Constraint 153 698 28.2973 35.3717 53.0575 11.9742 Constraint 153 687 29.1463 36.4328 54.6493 11.9742 Constraint 449 676 26.8750 33.5937 50.3905 11.9312 Constraint 552 668 17.5807 21.9758 32.9637 11.7621 Constraint 552 657 15.0736 18.8420 28.2630 11.7621 Constraint 544 651 17.2537 21.5671 32.3507 11.7553 Constraint 527 668 22.3601 27.9501 41.9252 11.7553 Constraint 527 657 20.2840 25.3550 38.0325 11.7553 Constraint 519 668 23.6673 29.5841 44.3762 11.7553 Constraint 519 657 21.9093 27.3866 41.0800 11.7553 Constraint 511 668 24.8693 31.0866 46.6300 11.7553 Constraint 511 657 23.3447 29.1808 43.7713 11.7553 Constraint 442 687 26.1211 32.6514 48.9771 11.5988 Constraint 599 706 13.7904 17.2380 25.8569 11.5540 Constraint 590 706 16.7265 20.9082 31.3622 11.5540 Constraint 161 698 28.5100 35.6375 53.4562 11.5491 Constraint 535 636 21.9608 27.4509 41.1764 11.5024 Constraint 585 687 14.9472 18.6840 28.0260 11.3651 Constraint 96 687 26.6530 33.3163 49.9744 11.3467 Constraint 651 729 12.7486 15.9357 23.9036 11.2921 Constraint 644 729 13.8925 17.3657 26.0485 11.2921 Constraint 644 720 12.4763 15.5954 23.3931 11.2921 Constraint 629 729 15.6185 19.5232 29.2847 11.2921 Constraint 629 720 13.6747 17.0934 25.6402 11.2921 Constraint 622 729 18.0614 22.5767 33.8651 11.2921 Constraint 622 720 16.1927 20.2409 30.3614 11.2921 Constraint 613 729 19.1424 23.9280 35.8920 11.2921 Constraint 613 720 17.6596 22.0744 33.1117 11.2921 Constraint 604 729 16.5927 20.7409 31.1114 11.2921 Constraint 604 720 15.3294 19.1618 28.7427 11.2921 Constraint 599 729 17.0082 21.2602 31.8903 11.2921 Constraint 599 720 15.3828 19.2285 28.8428 11.2921 Constraint 590 729 20.1572 25.1964 37.7947 11.2921 Constraint 590 720 18.6390 23.2988 34.9482 11.2921 Constraint 341 720 22.1469 27.6836 41.5254 11.2921 Constraint 330 729 23.0316 28.7895 43.1843 11.2921 Constraint 330 720 22.8787 28.5984 42.8976 11.2921 Constraint 322 729 24.5382 30.6728 46.0092 11.2921 Constraint 322 720 24.4039 30.5049 45.7574 11.2921 Constraint 314 729 23.4676 29.3344 44.0017 11.2921 Constraint 314 720 23.4916 29.3645 44.0468 11.2921 Constraint 303 720 21.7154 27.1442 40.7163 11.2921 Constraint 297 729 23.0117 28.7646 43.1469 11.2921 Constraint 297 720 22.6937 28.3671 42.5506 11.2921 Constraint 292 729 23.8312 29.7889 44.6834 11.2921 Constraint 292 720 23.7122 29.6403 44.4604 11.2921 Constraint 285 729 22.1620 27.7024 41.5537 11.2921 Constraint 285 720 22.1173 27.6467 41.4700 11.2921 Constraint 279 720 21.2118 26.5147 39.7721 11.2921 Constraint 272 729 23.5506 29.4382 44.1573 11.2921 Constraint 272 720 23.2143 29.0179 43.5269 11.2921 Constraint 267 729 22.4144 28.0180 42.0270 11.2921 Constraint 267 720 22.2258 27.7823 41.6734 11.2921 Constraint 259 729 24.0253 30.0316 45.0474 11.2921 Constraint 259 720 24.0496 30.0620 45.0930 11.2921 Constraint 250 729 26.4620 33.0776 49.6163 11.2921 Constraint 250 720 26.4736 33.0920 49.6380 11.2921 Constraint 242 729 25.6859 32.1074 48.1611 11.2921 Constraint 242 720 25.5926 31.9908 47.9862 11.2921 Constraint 237 729 27.9173 34.8966 52.3450 11.2921 Constraint 226 729 27.6257 34.5321 51.7981 11.2921 Constraint 221 729 25.1020 31.3775 47.0662 11.2921 Constraint 221 720 24.8886 31.1108 46.6661 11.2921 Constraint 210 729 26.5976 33.2469 49.8704 11.2921 Constraint 210 720 26.3254 32.9067 49.3601 11.2921 Constraint 190 729 26.0036 32.5045 48.7567 11.2921 Constraint 182 729 24.8496 31.0620 46.5930 11.2921 Constraint 182 720 24.4598 30.5747 45.8621 11.2921 Constraint 552 676 18.9115 23.6394 35.4591 11.1891 Constraint 535 668 23.1403 28.9253 43.3880 11.1823 Constraint 535 657 21.4371 26.7964 40.1945 11.1823 Constraint 527 676 24.4096 30.5120 45.7680 11.1823 Constraint 519 676 25.7157 32.1447 48.2170 11.1823 Constraint 511 676 27.8508 34.8135 52.2203 11.1823 Constraint 144 706 32.1012 40.1266 60.1898 11.1424 Constraint 136 706 30.4309 38.0387 57.0580 11.1424 Constraint 128 706 29.3737 36.7171 55.0756 11.1424 Constraint 122 706 30.4890 38.1113 57.1669 11.1424 Constraint 113 706 30.1108 37.6385 56.4577 11.1424 Constraint 104 706 28.0729 35.0912 52.6368 11.1424 Constraint 88 706 29.1224 36.4029 54.6044 11.1424 Constraint 435 706 29.1998 36.4997 54.7496 11.1366 Constraint 544 636 15.7181 19.6476 29.4715 11.0976 Constraint 467 676 28.8094 36.0117 54.0176 10.9331 Constraint 461 676 27.4180 34.2725 51.4088 10.9331 Constraint 629 713 12.3235 15.4043 23.1065 10.8873 Constraint 622 713 14.4399 18.0499 27.0748 10.8873 Constraint 613 713 15.9657 19.9571 29.9356 10.8873 Constraint 604 713 14.1320 17.6650 26.4974 10.8873 Constraint 599 713 14.3969 17.9961 26.9941 10.8873 Constraint 590 713 17.3023 21.6279 32.4418 10.8873 Constraint 341 713 22.4309 28.0386 42.0579 10.8873 Constraint 330 713 23.0711 28.8389 43.2583 10.8873 Constraint 322 713 24.8293 31.0366 46.5550 10.8873 Constraint 314 713 24.0730 30.0912 45.1369 10.8873 Constraint 303 713 22.4104 28.0130 42.0194 10.8873 Constraint 297 713 23.4745 29.3432 44.0148 10.8873 Constraint 292 713 24.6576 30.8221 46.2331 10.8873 Constraint 285 713 23.2073 29.0091 43.5137 10.8873 Constraint 279 713 22.3940 27.9925 41.9888 10.8873 Constraint 272 713 24.4323 30.5404 45.8106 10.8873 Constraint 267 713 23.6298 29.5373 44.3060 10.8873 Constraint 259 713 25.3109 31.6386 47.4578 10.8873 Constraint 250 713 27.9389 34.9237 52.3855 10.8873 Constraint 242 713 26.7249 33.4061 50.1092 10.8873 Constraint 237 713 29.1178 36.3972 54.5959 10.8873 Constraint 226 713 28.8011 36.0013 54.0020 10.8873 Constraint 221 713 26.0706 32.5882 48.8823 10.8873 Constraint 210 713 27.2747 34.0934 51.1401 10.8873 Constraint 201 713 28.8457 36.0572 54.0858 10.8873 Constraint 190 713 26.8252 33.5315 50.2972 10.8873 Constraint 182 713 25.2778 31.5973 47.3960 10.8873 Constraint 176 713 27.7100 34.6374 51.9562 10.8873 Constraint 169 713 29.0512 36.3140 54.4710 10.8873 Constraint 657 735 12.2872 15.3589 23.0384 10.8670 Constraint 651 735 13.4652 16.8315 25.2473 10.8670 Constraint 644 735 14.2326 17.7907 26.6861 10.8670 Constraint 629 735 17.2221 21.5276 32.2914 10.8670 Constraint 622 735 19.9529 24.9412 37.4117 10.8670 Constraint 613 735 20.5818 25.7273 38.5909 10.8670 Constraint 604 735 17.9675 22.4594 33.6891 10.8670 Constraint 399 735 28.3883 35.4854 53.2281 10.8670 Constraint 391 735 27.1102 33.8878 50.8317 10.8670 Constraint 382 735 29.6879 37.1099 55.6648 10.8670 Constraint 330 735 25.1174 31.3967 47.0950 10.8670 Constraint 322 735 26.7458 33.4323 50.1484 10.8670 Constraint 314 735 25.7409 32.1762 48.2642 10.8670 Constraint 303 735 24.1251 30.1563 45.2345 10.8670 Constraint 297 735 25.3715 31.7144 47.5716 10.8670 Constraint 292 735 26.3146 32.8932 49.3399 10.8670 Constraint 285 735 24.6657 30.8321 46.2482 10.8670 Constraint 279 735 24.0772 30.0965 45.1447 10.8670 Constraint 272 735 26.1579 32.6974 49.0461 10.8670 Constraint 267 735 25.0902 31.3627 47.0441 10.8670 Constraint 259 735 26.6087 33.2609 49.8913 10.8670 Constraint 250 735 29.0586 36.3233 54.4849 10.8670 Constraint 242 735 28.3256 35.4070 53.1105 10.8670 Constraint 237 735 30.5943 38.2428 57.3642 10.8670 Constraint 226 735 30.3451 37.9313 56.8970 10.8670 Constraint 221 735 27.7518 34.6897 52.0346 10.8670 Constraint 210 735 29.0560 36.3200 54.4800 10.8670 Constraint 201 735 30.4977 38.1221 57.1831 10.8670 Constraint 190 735 28.6047 35.7559 53.6338 10.8670 Constraint 182 735 27.2245 34.0307 51.0460 10.8670 Constraint 169 735 30.8580 38.5725 57.8587 10.8670 Constraint 69 497 6.1934 7.7418 11.6126 10.8517 Constraint 69 489 9.7699 12.2124 18.3186 10.8517 Constraint 69 480 10.8660 13.5825 20.3738 10.8517 Constraint 69 473 9.5712 11.9640 17.9461 10.8517 Constraint 69 467 11.7894 14.7367 22.1050 10.8517 Constraint 69 461 10.5397 13.1746 19.7619 10.8517 Constraint 69 449 9.7738 12.2173 18.3259 10.8517 Constraint 69 442 12.0721 15.0901 22.6352 10.8517 Constraint 69 435 12.5818 15.7272 23.5908 10.8517 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 279 13.6813 17.1016 25.6524 10.8517 Constraint 69 272 14.2551 17.8189 26.7283 10.8517 Constraint 69 267 14.0334 17.5418 26.3127 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 237 14.6819 18.3523 27.5285 10.8517 Constraint 69 226 16.0908 20.1136 30.1703 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 201 15.2752 19.0940 28.6410 10.8517 Constraint 69 190 15.7492 19.6865 29.5297 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 69 176 15.4693 19.3367 29.0050 10.8517 Constraint 69 169 13.2793 16.5991 24.8987 10.8517 Constraint 69 161 16.4907 20.6134 30.9201 10.8517 Constraint 69 144 12.7629 15.9536 23.9305 10.8517 Constraint 69 136 12.2217 15.2771 22.9157 10.8517 Constraint 497 676 27.1190 33.8987 50.8481 10.8488 Constraint 442 698 25.6533 32.0666 48.1000 10.8031 Constraint 544 668 19.1170 23.8962 35.8443 10.7775 Constraint 544 657 16.5736 20.7170 31.0755 10.7775 Constraint 80 687 27.0922 33.8653 50.7979 10.7419 Constraint 577 687 13.8556 17.3195 25.9792 10.6983 Constraint 341 729 20.8934 26.1167 39.1751 10.6254 Constraint 303 729 20.6965 25.8706 38.8059 10.6254 Constraint 279 729 20.2900 25.3624 38.0437 10.6254 Constraint 535 676 25.4267 31.7834 47.6751 10.6093 Constraint 153 706 31.4837 39.3547 59.0320 10.5694 Constraint 585 698 15.2753 19.0942 28.6413 10.5694 Constraint 96 698 26.2800 32.8500 49.2750 10.5510 Constraint 489 676 26.4893 33.1117 49.6675 10.5488 Constraint 480 676 27.5736 34.4670 51.7006 10.5488 Constraint 429 735 30.2401 37.8001 56.7001 10.4622 Constraint 421 735 27.5738 34.4673 51.7009 10.4622 Constraint 412 735 29.3481 36.6851 55.0277 10.4622 Constraint 404 735 30.8662 38.5828 57.8742 10.4622 Constraint 636 729 16.2615 20.3269 30.4903 10.2940 Constraint 636 720 14.8628 18.5786 27.8678 10.2940 Constraint 599 735 19.3520 24.1900 36.2850 10.2940 Constraint 590 735 22.3971 27.9963 41.9945 10.2940 Constraint 399 729 27.3124 34.1405 51.2108 10.2940 Constraint 399 720 27.6158 34.5198 51.7797 10.2940 Constraint 391 729 25.8864 32.3580 48.5371 10.2940 Constraint 391 720 26.1256 32.6570 48.9856 10.2940 Constraint 382 729 28.5695 35.7118 53.5677 10.2940 Constraint 382 720 28.8925 36.1157 54.1735 10.2940 Constraint 237 720 26.5023 33.1279 49.6919 10.2940 Constraint 226 720 25.9774 32.4718 48.7077 10.2940 Constraint 201 729 26.7780 33.4725 50.2088 10.2940 Constraint 201 720 26.1096 32.6370 48.9555 10.2940 Constraint 190 720 24.0028 30.0035 45.0052 10.2940 Constraint 176 729 25.7711 32.2138 48.3207 10.2940 Constraint 176 720 25.0135 31.2668 46.9002 10.2940 Constraint 169 729 27.4145 34.2682 51.4023 10.2940 Constraint 169 720 26.7590 33.4488 50.1731 10.2940 Constraint 544 676 20.0896 25.1120 37.6680 10.2045 Constraint 341 735 22.5103 28.1379 42.2068 10.2003 Constraint 80 698 27.1905 33.9881 50.9821 10.1462 Constraint 161 706 31.5839 39.4799 59.2198 10.1443 Constraint 571 687 15.1098 18.8872 28.3308 10.1026 Constraint 557 687 17.0121 21.2652 31.8977 10.1026 Constraint 527 687 23.3584 29.1980 43.7970 10.0823 Constraint 519 687 24.6471 30.8089 46.2134 10.0823 Constraint 511 687 26.8819 33.6024 50.4035 10.0823 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 577 698 13.9825 17.4781 26.2171 9.9026 Constraint 571 698 16.0300 20.0375 30.0563 9.9026 Constraint 557 698 17.7626 22.2032 33.3048 9.9026 Constraint 636 713 13.4884 16.8605 25.2908 9.8892 Constraint 429 729 29.1785 36.4732 54.7098 9.8892 Constraint 429 720 29.2511 36.5638 54.8457 9.8892 Constraint 429 713 29.9959 37.4949 56.2423 9.8892 Constraint 421 729 26.3601 32.9501 49.4251 9.8892 Constraint 421 720 26.3164 32.8954 49.3432 9.8892 Constraint 421 713 27.2850 34.1063 51.1594 9.8892 Constraint 412 729 28.1326 35.1657 52.7486 9.8892 Constraint 412 720 28.1185 35.1481 52.7222 9.8892 Constraint 412 713 29.2388 36.5485 54.8227 9.8892 Constraint 404 729 29.8803 37.3503 56.0255 9.8892 Constraint 404 720 30.0649 37.5811 56.3716 9.8892 Constraint 404 713 31.0671 38.8339 58.2508 9.8892 Constraint 399 713 28.6715 35.8394 53.7591 9.8892 Constraint 391 713 27.3567 34.1959 51.2938 9.8892 Constraint 382 713 30.2943 37.8679 56.8018 9.8892 Constraint 527 698 22.3936 27.9920 41.9879 9.8823 Constraint 519 698 23.2939 29.1174 43.6761 9.8823 Constraint 511 698 24.8944 31.1180 46.6770 9.8823 Constraint 636 735 17.6306 22.0383 33.0574 9.8689 Constraint 375 735 29.9280 37.4100 56.1150 9.8689 Constraint 368 735 27.3483 34.1853 51.2780 9.8689 Constraint 360 735 26.5998 33.2498 49.8746 9.8689 Constraint 355 735 24.9722 31.2152 46.8228 9.8689 Constraint 176 735 28.3615 35.4518 53.1777 9.8689 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 442 706 28.7575 35.9468 53.9202 9.8031 Constraint 497 687 26.3558 32.9448 49.4172 9.7489 Constraint 473 687 28.5553 35.6942 53.5413 9.7398 Constraint 449 687 27.1953 33.9941 50.9911 9.7398 Constraint 585 706 16.5481 20.6852 31.0278 9.5694 Constraint 497 698 24.5516 30.6895 46.0343 9.5489 Constraint 489 698 24.1853 30.2316 45.3474 9.5489 Constraint 489 687 26.0746 32.5932 48.8898 9.5489 Constraint 480 698 25.5300 31.9125 47.8687 9.5489 Constraint 480 687 27.7665 34.7082 52.0623 9.5489 Constraint 535 687 24.4867 30.6084 45.9125 9.5094 Constraint 535 698 23.1089 28.8861 43.3292 9.3094 Constraint 153 729 31.9142 39.8927 59.8391 9.3075 Constraint 144 729 32.7005 40.8757 61.3135 9.3075 Constraint 136 729 30.4460 38.0576 57.0863 9.3075 Constraint 136 720 30.5308 38.1635 57.2452 9.3075 Constraint 128 729 28.9559 36.1948 54.2922 9.3075 Constraint 128 720 29.2500 36.5625 54.8437 9.3075 Constraint 122 729 30.8867 38.6084 57.9125 9.3075 Constraint 122 720 31.2651 39.0813 58.6220 9.3075 Constraint 113 729 30.8975 38.6218 57.9327 9.3075 Constraint 113 720 31.1961 38.9951 58.4926 9.3075 Constraint 104 729 28.0642 35.0803 52.6204 9.3075 Constraint 104 720 28.4030 35.5037 53.2556 9.3075 Constraint 88 729 30.1845 37.7306 56.5959 9.3075 Constraint 88 720 30.7385 38.4231 57.6347 9.3075 Constraint 375 729 28.8058 36.0073 54.0109 9.2959 Constraint 375 720 29.0804 36.3505 54.5257 9.2959 Constraint 368 729 26.1481 32.6851 49.0277 9.2959 Constraint 368 720 26.4263 33.0329 49.5494 9.2959 Constraint 360 729 25.3123 31.6404 47.4605 9.2959 Constraint 360 720 25.3710 31.7138 47.5707 9.2959 Constraint 355 729 24.0800 30.1000 45.1501 9.2959 Constraint 355 720 24.4296 30.5370 45.8054 9.2959 Constraint 350 720 22.4774 28.0967 42.1450 9.2959 Constraint 350 735 22.3802 27.9752 41.9628 9.2022 Constraint 96 706 29.3134 36.6417 54.9625 9.1462 Constraint 80 706 29.5548 36.9435 55.4152 9.1462 Constraint 473 698 27.0883 33.8604 50.7906 9.1441 Constraint 449 698 26.9266 33.6582 50.4874 9.1441 Constraint 552 687 17.6778 22.0973 33.1459 9.1045 Constraint 544 687 18.3332 22.9165 34.3747 9.1045 Constraint 552 698 17.8711 22.3389 33.5083 8.9045 Constraint 544 698 18.7612 23.4515 35.1772 8.9045 Constraint 585 729 18.7545 23.4432 35.1648 8.9027 Constraint 585 720 18.1970 22.7462 34.1193 8.9027 Constraint 585 713 17.6160 22.0200 33.0300 8.9027 Constraint 577 706 15.5573 19.4467 29.1700 8.9027 Constraint 571 706 17.0821 21.3526 32.0289 8.9027 Constraint 557 706 18.6144 23.2680 34.9020 8.9027 Constraint 153 713 33.9459 42.4324 63.6486 8.9027 Constraint 136 713 31.8452 39.8065 59.7097 8.9027 Constraint 128 713 30.7611 38.4514 57.6770 8.9027 Constraint 122 713 32.7439 40.9299 61.3948 8.9027 Constraint 113 713 32.2863 40.3579 60.5368 8.9027 Constraint 104 713 29.4039 36.7549 55.1323 8.9027 Constraint 88 713 31.7813 39.7266 59.5899 8.9027 Constraint 375 713 30.9266 38.6582 57.9873 8.8911 Constraint 368 713 28.3172 35.3965 53.0947 8.8911 Constraint 360 713 27.2010 34.0013 51.0019 8.8911 Constraint 355 713 26.1905 32.7381 49.1072 8.8911 Constraint 350 713 24.2418 30.3023 45.4535 8.8911 Constraint 136 735 33.2368 41.5460 62.3190 8.8824 Constraint 128 735 31.7450 39.6812 59.5218 8.8824 Constraint 122 735 33.7363 42.1703 63.2555 8.8824 Constraint 113 735 33.6670 42.0838 63.1256 8.8824 Constraint 104 735 30.8862 38.6077 57.9115 8.8824 Constraint 88 735 32.9382 41.1728 61.7591 8.8824 Constraint 69 511 7.4924 9.3655 14.0483 8.8530 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 467 687 30.5278 38.1597 57.2395 8.7417 Constraint 461 687 28.6267 35.7833 53.6750 8.7417 Constraint 350 729 20.9862 26.2327 39.3490 8.6292 Constraint 527 706 25.1827 31.4784 47.2176 8.4775 Constraint 519 706 26.5450 33.1813 49.7719 8.4775 Constraint 511 706 28.0988 35.1235 52.6853 8.4775 Constraint 435 735 32.7024 40.8780 61.3170 8.4775 Constraint 161 729 31.1650 38.9562 58.4344 8.3094 Constraint 161 720 30.7507 38.4384 57.6575 8.3094 Constraint 153 735 34.7424 43.4280 65.1420 8.3094 Constraint 153 720 30.9160 38.6449 57.9674 8.3094 Constraint 144 720 31.9076 39.8845 59.8267 8.3094 Constraint 577 729 17.2863 21.6078 32.4118 8.2359 Constraint 577 720 16.6915 20.8643 31.2965 8.2359 Constraint 577 713 16.5105 20.6381 30.9572 8.2359 Constraint 571 729 18.7469 23.4336 35.1504 8.2359 Constraint 571 720 17.9840 22.4800 33.7199 8.2359 Constraint 571 713 17.4991 21.8739 32.8108 8.2359 Constraint 557 729 20.6496 25.8120 38.7180 8.2359 Constraint 557 720 20.2056 25.2570 37.8855 8.2359 Constraint 557 713 19.4526 24.3157 36.4736 8.2359 Constraint 527 735 26.3593 32.9492 49.4238 8.2156 Constraint 519 735 27.8012 34.7515 52.1273 8.2156 Constraint 511 735 28.8428 36.0535 54.0802 8.2156 Constraint 467 698 29.5486 36.9357 55.4036 8.1460 Constraint 461 698 28.1594 35.1992 52.7988 8.1460 Constraint 497 706 28.7600 35.9500 53.9250 8.1441 Constraint 489 706 28.7368 35.9209 53.8814 8.1441 Constraint 480 706 30.2123 37.7653 56.6480 8.1441 Constraint 473 706 31.2141 39.0176 58.5264 8.1441 Constraint 449 706 30.8641 38.5801 57.8702 8.1441 Constraint 69 250 14.5595 18.1993 27.2990 8.0149 Constraint 585 735 20.4886 25.6108 38.4162 7.9046 Constraint 552 706 19.7653 24.7066 37.0599 7.9046 Constraint 544 706 21.1050 26.3812 39.5718 7.9046 Constraint 535 706 25.6718 32.0897 48.1346 7.9046 Constraint 435 729 31.5626 39.4532 59.1798 7.9046 Constraint 435 720 32.5171 40.6463 60.9695 7.9046 Constraint 435 713 34.0747 42.5933 63.8900 7.9046 Constraint 161 713 33.4306 41.7883 62.6824 7.9046 Constraint 96 735 31.0570 38.8213 58.2319 7.8843 Constraint 442 735 31.5792 39.4739 59.2109 7.8108 Constraint 535 735 26.4131 33.0164 49.5246 7.6427 Constraint 535 729 24.7150 30.8937 46.3406 7.6427 Constraint 535 720 26.5419 33.1774 49.7661 7.6427 Constraint 527 729 25.0469 31.3086 46.9629 7.6427 Constraint 527 720 26.3931 32.9913 49.4870 7.6427 Constraint 519 729 26.6206 33.2758 49.9137 7.6427 Constraint 519 720 28.2129 35.2661 52.8991 7.6427 Constraint 511 729 27.7170 34.6462 51.9693 7.6427 Constraint 511 720 29.6862 37.1077 55.6616 7.6427 Constraint 497 735 29.9281 37.4101 56.1152 7.5489 Constraint 489 735 30.6719 38.3399 57.5099 7.5489 Constraint 480 735 32.5392 40.6740 61.0109 7.5489 Constraint 80 735 32.3365 40.4206 60.6309 7.4795 Constraint 96 729 29.0858 36.3573 54.5359 7.3113 Constraint 96 720 29.6780 37.0975 55.6463 7.3113 Constraint 577 735 19.7232 24.6541 36.9811 7.2378 Constraint 571 735 21.7203 27.1504 40.7256 7.2378 Constraint 557 735 23.0325 28.7906 43.1859 7.2378 Constraint 552 735 22.9919 28.7399 43.1098 7.2378 Constraint 552 729 21.3483 26.6854 40.0281 7.2378 Constraint 552 720 21.1152 26.3940 39.5910 7.2378 Constraint 552 713 21.4812 26.8516 40.2773 7.2378 Constraint 544 735 24.1673 30.2091 45.3137 7.2378 Constraint 544 729 22.2652 27.8315 41.7473 7.2378 Constraint 544 720 21.8023 27.2529 40.8793 7.2378 Constraint 544 713 22.3305 27.9131 41.8697 7.2378 Constraint 535 713 28.3105 35.3881 53.0822 7.2378 Constraint 527 713 28.2622 35.3277 52.9916 7.2378 Constraint 519 713 29.9439 37.4299 56.1448 7.2378 Constraint 511 713 31.4591 39.3239 58.9859 7.2378 Constraint 442 729 30.5094 38.1368 57.2052 7.2378 Constraint 442 720 31.1771 38.9714 58.4571 7.2378 Constraint 442 713 32.8662 41.0827 61.6240 7.2378 Constraint 467 706 34.5148 43.1436 64.7153 7.1460 Constraint 461 706 32.7377 40.9222 61.3833 7.1460 Constraint 473 735 33.3177 41.6471 62.4707 7.1441 Constraint 449 735 32.4404 40.5506 60.8258 7.1441 Constraint 497 729 28.8425 36.0531 54.0796 6.9759 Constraint 497 720 30.4904 38.1130 57.1695 6.9759 Constraint 489 729 29.3015 36.6269 54.9404 6.9759 Constraint 489 720 30.8074 38.5092 57.7638 6.9759 Constraint 480 729 31.2877 39.1097 58.6645 6.9759 Constraint 480 720 33.2697 41.5871 62.3807 6.9759 Constraint 96 713 32.4855 40.6068 60.9102 6.9065 Constraint 80 729 31.0932 38.8665 58.2998 6.9065 Constraint 80 720 31.5221 39.4026 59.1039 6.9065 Constraint 80 713 33.2847 41.6058 62.4088 6.9065 Constraint 58 511 10.8517 13.5647 20.3470 6.8531 Constraint 58 497 9.7792 12.2240 18.3360 6.8531 Constraint 58 489 12.8509 16.0636 24.0954 6.8531 Constraint 58 480 14.4512 18.0640 27.0960 6.8531 Constraint 58 473 13.7561 17.1952 25.7928 6.8531 Constraint 58 467 15.5136 19.3920 29.0880 6.8531 Constraint 58 461 13.9555 17.4444 26.1665 6.8531 Constraint 58 449 12.8759 16.0948 24.1422 6.8531 Constraint 58 442 15.5132 19.3915 29.0872 6.8531 Constraint 58 435 16.3333 20.4166 30.6249 6.8531 Constraint 58 429 12.6492 15.8114 23.7172 6.8531 Constraint 58 421 11.7793 14.7242 22.0863 6.8531 Constraint 58 412 15.1547 18.9434 28.4151 6.8531 Constraint 58 404 14.2257 17.7821 26.6732 6.8531 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 382 15.3881 19.2352 28.8527 6.8531 Constraint 58 375 12.8779 16.0974 24.1461 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 297 12.4181 15.5226 23.2839 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 58 285 13.3458 16.6823 25.0234 6.8531 Constraint 58 279 15.5587 19.4483 29.1725 6.8531 Constraint 58 272 16.4236 20.5295 30.7942 6.8531 Constraint 58 267 16.7879 20.9848 31.4772 6.8531 Constraint 58 259 14.3583 17.9478 26.9217 6.8531 Constraint 58 237 17.7259 22.1573 33.2360 6.8531 Constraint 58 226 18.6432 23.3040 34.9560 6.8531 Constraint 58 221 15.0813 18.8516 28.2775 6.8531 Constraint 58 210 13.4081 16.7601 25.1401 6.8531 Constraint 58 201 17.3128 21.6410 32.4615 6.8531 Constraint 58 190 17.8007 22.2508 33.3763 6.8531 Constraint 58 182 14.0495 17.5618 26.3427 6.8531 Constraint 58 176 17.0924 21.3655 32.0482 6.8531 Constraint 58 169 14.9643 18.7054 28.0581 6.8531 Constraint 58 161 17.3467 21.6833 32.5250 6.8531 Constraint 58 144 13.1979 16.4974 24.7461 6.8531 Constraint 58 136 12.4233 15.5292 23.2938 6.8531 Constraint 58 128 11.5778 14.4722 21.7083 6.8531 Constraint 497 713 32.5923 40.7404 61.1105 6.5711 Constraint 489 713 32.7903 40.9879 61.4819 6.5711 Constraint 480 713 35.1596 43.9495 65.9243 6.5711 Constraint 473 729 32.2435 40.3044 60.4566 6.5711 Constraint 473 720 34.2884 42.8605 64.2908 6.5711 Constraint 449 729 31.0882 38.8602 58.2904 6.5711 Constraint 449 720 32.3574 40.4467 60.6701 6.5711 Constraint 449 713 34.1004 42.6255 63.9383 6.5711 Constraint 473 676 16.4230 20.5288 30.7932 6.3581 Constraint 668 742 11.3566 14.1958 21.2937 6.1669 Constraint 657 742 13.5538 16.9423 25.4134 6.1669 Constraint 651 742 14.7527 18.4408 27.6612 6.1669 Constraint 644 742 14.3354 17.9193 26.8789 6.1669 Constraint 629 742 15.8385 19.7982 29.6973 6.1669 Constraint 622 742 18.3853 22.9816 34.4725 6.1669 Constraint 613 742 18.8530 23.5663 35.3494 6.1669 Constraint 604 742 16.5730 20.7162 31.0743 6.1669 Constraint 399 742 28.4585 35.5731 53.3597 6.1669 Constraint 391 742 26.8914 33.6143 50.4214 6.1669 Constraint 382 742 29.4575 36.8219 55.2328 6.1669 Constraint 341 742 25.7279 32.1599 48.2399 6.1669 Constraint 330 742 27.4460 34.3074 51.4612 6.1669 Constraint 322 742 28.2548 35.3185 52.9777 6.1669 Constraint 314 742 26.7315 33.4144 50.1216 6.1669 Constraint 303 742 25.8459 32.3074 48.4612 6.1669 Constraint 297 742 27.5767 34.4709 51.7064 6.1669 Constraint 292 742 27.6648 34.5810 51.8715 6.1669 Constraint 285 742 26.0134 32.5168 48.7752 6.1669 Constraint 279 742 26.4273 33.0341 49.5512 6.1669 Constraint 272 742 28.0522 35.0652 52.5978 6.1669 Constraint 267 742 26.7073 33.3841 50.0761 6.1669 Constraint 259 742 27.2869 34.1086 51.1629 6.1669 Constraint 250 742 29.4023 36.7529 55.1293 6.1669 Constraint 242 742 28.3919 35.4899 53.2348 6.1669 Constraint 237 742 30.4357 38.0446 57.0669 6.1669 Constraint 226 742 30.6944 38.3680 57.5520 6.1669 Constraint 221 742 28.7726 35.9657 53.9486 6.1669 Constraint 210 742 29.6764 37.0955 55.6432 6.1669 Constraint 182 742 28.8958 36.1198 54.1797 6.1669 Constraint 136 742 31.3130 39.1412 58.7119 6.1669 Constraint 128 742 30.2617 37.8271 56.7407 6.1669 Constraint 122 742 31.8053 39.7566 59.6349 6.1669 Constraint 113 742 31.5822 39.4778 59.2167 6.1669 Constraint 104 742 29.4572 36.8216 55.2323 6.1669 Constraint 88 742 31.0692 38.8365 58.2548 6.1669 Constraint 461 735 35.6757 44.5946 66.8919 6.1460 Constraint 58 242 14.3988 17.9985 26.9977 5.9075 Constraint 161 735 32.0377 40.0471 60.0706 5.8844 Constraint 69 604 20.0158 25.0198 37.5297 5.8530 Constraint 69 599 19.9766 24.9707 37.4561 5.8530 Constraint 69 590 20.5883 25.7354 38.6031 5.8530 Constraint 69 585 18.3456 22.9319 34.3979 5.8530 Constraint 69 577 17.0810 21.3513 32.0269 5.8530 Constraint 69 571 18.7167 23.3959 35.0939 5.8530 Constraint 58 153 14.3962 17.9953 26.9929 5.8367 Constraint 435 742 30.5344 38.1680 57.2520 5.7621 Constraint 429 742 29.6344 37.0430 55.5646 5.7621 Constraint 421 742 26.9832 33.7290 50.5936 5.7621 Constraint 412 742 28.3652 35.4565 53.1847 5.7621 Constraint 404 742 30.3148 37.8935 56.8402 5.7621 Constraint 599 742 17.8711 22.3389 33.5083 5.5940 Constraint 590 742 20.5700 25.7126 38.5688 5.5940 Constraint 467 729 37.0169 46.2711 69.4066 5.5730 Constraint 467 720 38.6570 48.3213 72.4819 5.5730 Constraint 461 729 33.9280 42.4101 63.6151 5.5730 Constraint 461 720 35.3186 44.1483 66.2225 5.5730 Constraint 461 713 38.0925 47.6156 71.4234 5.5730 Constraint 527 742 24.7230 30.9037 46.3555 5.5002 Constraint 519 742 25.8835 32.3543 48.5315 5.5002 Constraint 511 742 26.2743 32.8428 49.2643 5.5002 Constraint 585 742 19.4000 24.2500 36.3750 5.1892 Constraint 636 742 16.3509 20.4387 30.6580 5.1689 Constraint 375 742 30.1027 37.6284 56.4426 5.1689 Constraint 368 742 27.4668 34.3335 51.5002 5.1689 Constraint 360 742 26.9608 33.7010 50.5515 5.1689 Constraint 355 742 25.9097 32.3871 48.5807 5.1689 Constraint 350 742 25.1325 31.4157 47.1235 5.1689 Constraint 201 742 28.9334 36.1668 54.2502 5.1689 Constraint 190 742 27.8880 34.8600 52.2900 5.1689 Constraint 176 742 28.3855 35.4819 53.2228 5.1689 Constraint 169 742 29.3559 36.6949 55.0424 5.1689 Constraint 161 742 30.8745 38.5931 57.8897 5.1689 Constraint 96 742 29.1486 36.4357 54.6535 5.1689 Constraint 442 742 29.7093 37.1366 55.7049 5.0954 Constraint 535 742 24.3422 30.4277 45.6416 4.9272 Constraint 69 629 23.0847 28.8558 43.2837 4.8530 Constraint 69 622 23.6225 29.5281 44.2921 4.8530 Constraint 69 613 21.9721 27.4651 41.1976 4.8530 Constraint 69 557 17.1328 21.4160 32.1240 4.8530 Constraint 69 552 15.4551 19.3189 28.9783 4.8530 Constraint 69 544 17.6682 22.0852 33.1278 4.8530 Constraint 69 535 16.1602 20.2003 30.3004 4.8530 Constraint 69 527 12.0490 15.0613 22.5919 4.8530 Constraint 69 519 14.1032 17.6290 26.4435 4.8530 Constraint 497 742 27.5663 34.4578 51.6868 4.8335 Constraint 489 742 28.4781 35.5976 53.3965 4.8335 Constraint 480 742 30.0536 37.5670 56.3506 4.8335 Constraint 80 742 30.2769 37.8462 56.7692 4.7641 Constraint 153 742 31.0636 38.8295 58.2442 4.5959 Constraint 577 742 19.6405 24.5506 36.8259 4.5224 Constraint 571 742 20.7436 25.9295 38.8943 4.5224 Constraint 557 742 21.7503 27.1878 40.7817 4.5224 Constraint 552 742 22.1456 27.6820 41.5230 4.5224 Constraint 544 742 22.8290 28.5363 42.8044 4.5224 Constraint 473 742 30.0814 37.6017 56.4026 4.4287 Constraint 449 742 30.6788 38.3485 57.5228 4.4287 Constraint 58 250 16.7463 20.9329 31.3993 4.0163 Constraint 51 511 12.0207 15.0259 22.5388 4.0163 Constraint 51 497 10.9133 13.6416 20.4624 4.0163 Constraint 51 489 13.0013 16.2517 24.3775 4.0163 Constraint 51 480 14.7027 18.3784 27.5676 4.0163 Constraint 51 473 14.5345 18.1682 27.2522 4.0163 Constraint 51 467 15.6072 19.5090 29.2635 4.0163 Constraint 51 461 14.3473 17.9341 26.9011 4.0163 Constraint 51 449 13.7924 17.2405 25.8608 4.0163 Constraint 51 442 16.7066 20.8833 31.3249 4.0163 Constraint 51 435 16.6274 20.7843 31.1764 4.0163 Constraint 51 429 13.0177 16.2722 24.4082 4.0163 Constraint 51 421 13.3718 16.7148 25.0722 4.0163 Constraint 51 412 16.4181 20.5227 30.7840 4.0163 Constraint 51 404 14.7570 18.4462 27.6694 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 391 15.0745 18.8432 28.2648 4.0163 Constraint 51 382 16.4733 20.5916 30.8874 4.0163 Constraint 51 375 13.9085 17.3857 26.0785 4.0163 Constraint 51 368 14.4564 18.0705 27.1057 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 355 11.8633 14.8291 22.2437 4.0163 Constraint 51 350 14.6555 18.3194 27.4791 4.0163 Constraint 51 341 13.7194 17.1492 25.7238 4.0163 Constraint 51 330 12.6862 15.8578 23.7866 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 303 13.5882 16.9853 25.4779 4.0163 Constraint 51 297 14.8148 18.5186 27.7778 4.0163 Constraint 51 292 13.4736 16.8420 25.2630 4.0163 Constraint 51 285 14.5831 18.2289 27.3433 4.0163 Constraint 51 279 17.2907 21.6133 32.4200 4.0163 Constraint 51 272 17.6102 22.0128 33.0192 4.0163 Constraint 51 267 18.0117 22.5146 33.7720 4.0163 Constraint 51 259 14.9575 18.6969 28.0454 4.0163 Constraint 51 250 16.9915 21.2393 31.8590 4.0163 Constraint 51 242 13.8008 17.2510 25.8766 4.0163 Constraint 51 237 15.9982 19.9978 29.9967 4.0163 Constraint 51 226 18.8052 23.5065 35.2598 4.0163 Constraint 51 221 16.2843 20.3554 30.5331 4.0163 Constraint 51 210 13.9320 17.4150 26.1226 4.0163 Constraint 51 201 17.9132 22.3915 33.5873 4.0163 Constraint 51 190 18.6861 23.3577 35.0365 4.0163 Constraint 51 182 15.2071 19.0089 28.5133 4.0163 Constraint 51 176 17.8354 22.2942 33.4413 4.0163 Constraint 51 169 14.9992 18.7489 28.1234 4.0163 Constraint 51 161 16.8575 21.0719 31.6079 4.0163 Constraint 51 144 12.2532 15.3165 22.9747 4.0163 Constraint 51 136 12.6908 15.8635 23.7952 4.0163 Constraint 51 128 12.1092 15.1365 22.7047 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 41 511 13.1040 16.3800 24.5700 4.0163 Constraint 41 497 13.7565 17.1956 25.7934 4.0163 Constraint 41 489 15.9941 19.9926 29.9889 4.0163 Constraint 41 480 16.4643 20.5803 30.8705 4.0163 Constraint 41 473 16.5695 20.7118 31.0677 4.0163 Constraint 41 467 18.0282 22.5353 33.8029 4.0163 Constraint 41 461 17.7331 22.1663 33.2495 4.0163 Constraint 41 449 17.5666 21.9583 32.9374 4.0163 Constraint 41 442 20.2759 25.3448 38.0173 4.0163 Constraint 41 435 19.7567 24.6958 37.0437 4.0163 Constraint 41 429 15.9727 19.9659 29.9489 4.0163 Constraint 41 421 16.4560 20.5700 30.8551 4.0163 Constraint 41 412 19.1872 23.9840 35.9760 4.0163 Constraint 41 404 17.0151 21.2689 31.9034 4.0163 Constraint 41 399 14.2035 17.7544 26.6316 4.0163 Constraint 41 391 17.2725 21.5906 32.3859 4.0163 Constraint 41 382 18.2352 22.7941 34.1911 4.0163 Constraint 41 375 15.1260 18.9075 28.3612 4.0163 Constraint 41 368 15.6107 19.5134 29.2701 4.0163 Constraint 41 360 14.0288 17.5361 26.3041 4.0163 Constraint 41 355 13.2258 16.5323 24.7984 4.0163 Constraint 41 350 16.4647 20.5809 30.8713 4.0163 Constraint 41 341 15.2699 19.0874 28.6310 4.0163 Constraint 41 330 15.4145 19.2682 28.9022 4.0163 Constraint 41 322 14.4620 18.0775 27.1162 4.0163 Constraint 41 314 13.6431 17.0538 25.5807 4.0163 Constraint 41 303 16.2894 20.3618 30.5426 4.0163 Constraint 41 297 18.2441 22.8052 34.2078 4.0163 Constraint 41 292 17.0486 21.3107 31.9661 4.0163 Constraint 41 285 17.3849 21.7311 32.5967 4.0163 Constraint 41 279 20.2989 25.3737 38.0605 4.0163 Constraint 41 272 21.0993 26.3741 39.5611 4.0163 Constraint 41 267 20.8873 26.1091 39.1636 4.0163 Constraint 41 259 17.8219 22.2774 33.4161 4.0163 Constraint 41 250 19.4013 24.2516 36.3774 4.0163 Constraint 41 242 16.7648 20.9560 31.4340 4.0163 Constraint 41 237 19.2850 24.1063 36.1594 4.0163 Constraint 41 226 22.1287 27.6609 41.4913 4.0163 Constraint 41 221 19.6872 24.6090 36.9135 4.0163 Constraint 41 210 17.7420 22.1775 33.2662 4.0163 Constraint 41 201 21.7538 27.1922 40.7884 4.0163 Constraint 41 190 22.4585 28.0731 42.1096 4.0163 Constraint 41 182 19.1914 23.9892 35.9838 4.0163 Constraint 41 176 21.9835 27.4793 41.2190 4.0163 Constraint 41 169 19.0733 23.8416 35.7624 4.0163 Constraint 41 161 21.1226 26.4032 39.6048 4.0163 Constraint 41 144 16.3834 20.4793 30.7189 4.0163 Constraint 41 136 17.0559 21.3199 31.9799 4.0163 Constraint 41 128 16.3916 20.4895 30.7342 4.0163 Constraint 41 122 13.6300 17.0375 25.5562 4.0163 Constraint 41 113 12.3966 15.4958 23.2437 4.0163 Constraint 58 629 23.9216 29.9021 44.8531 3.8531 Constraint 58 622 23.5119 29.3899 44.0848 3.8531 Constraint 58 613 21.2536 26.5670 39.8505 3.8531 Constraint 58 604 20.0149 25.0186 37.5280 3.8531 Constraint 58 599 20.6875 25.8594 38.7891 3.8531 Constraint 58 590 19.6680 24.5850 36.8775 3.8531 Constraint 58 585 16.5961 20.7451 31.1176 3.8531 Constraint 58 577 16.9802 21.2253 31.8379 3.8531 Constraint 58 571 18.2230 22.7788 34.1682 3.8531 Constraint 58 557 15.7177 19.6472 29.4708 3.8531 Constraint 58 552 13.5060 16.8825 25.3238 3.8531 Constraint 58 544 17.0510 21.3137 31.9705 3.8531 Constraint 58 535 15.6693 19.5866 29.3799 3.8531 Constraint 58 527 10.4556 13.0696 19.6043 3.8531 Constraint 58 519 12.9272 16.1590 24.2385 3.8531 Constraint 467 742 36.9250 46.1563 69.2345 3.4306 Constraint 461 742 34.4770 43.0962 64.6444 3.4306 Constraint 33 511 12.8166 16.0208 24.0312 3.3388 Constraint 33 497 12.4201 15.5251 23.2876 3.3388 Constraint 33 489 14.6618 18.3273 27.4909 3.3388 Constraint 33 480 16.0971 20.1213 30.1820 3.3388 Constraint 33 473 16.2732 20.3415 30.5122 3.3388 Constraint 33 467 17.8488 22.3110 33.4665 3.3388 Constraint 33 461 16.7234 20.9042 31.3564 3.3388 Constraint 33 449 16.5195 20.6494 30.9741 3.3388 Constraint 33 442 19.4422 24.3027 36.4541 3.3388 Constraint 33 435 20.0964 25.1206 37.6808 3.3388 Constraint 33 429 16.3114 20.3893 30.5839 3.3388 Constraint 33 421 15.8180 19.7725 29.6588 3.3388 Constraint 33 412 19.3694 24.2118 36.3177 3.3388 Constraint 33 404 18.2329 22.7911 34.1867 3.3388 Constraint 33 399 14.7826 18.4783 27.7174 3.3388 Constraint 33 391 17.3302 21.6628 32.4942 3.3388 Constraint 33 382 19.4938 24.3673 36.5509 3.3388 Constraint 33 375 16.9973 21.2467 31.8700 3.3388 Constraint 33 368 16.1762 20.2202 30.3303 3.3388 Constraint 33 360 14.1610 17.7012 26.5518 3.3388 Constraint 33 355 11.9953 14.9941 22.4912 3.3388 Constraint 33 350 14.7060 18.3824 27.5737 3.3388 Constraint 33 341 13.1862 16.4828 24.7242 3.3388 Constraint 33 330 12.7842 15.9803 23.9704 3.3388 Constraint 33 322 12.3424 15.4280 23.1419 3.3388 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 33 303 14.7631 18.4538 27.6807 3.3388 Constraint 33 297 16.2600 20.3250 30.4875 3.3388 Constraint 33 292 16.2492 20.3114 30.4672 3.3388 Constraint 33 285 17.1466 21.4333 32.1499 3.3388 Constraint 33 279 19.0331 23.7914 35.6871 3.3388 Constraint 33 272 20.1232 25.1540 37.7310 3.3388 Constraint 33 267 20.6618 25.8273 38.7409 3.3388 Constraint 33 259 18.3782 22.9727 34.4590 3.3388 Constraint 33 250 21.1221 26.4026 39.6039 3.3388 Constraint 33 242 18.1339 22.6674 34.0010 3.3388 Constraint 33 237 20.5182 25.6478 38.4717 3.3388 Constraint 33 226 22.7791 28.4739 42.7108 3.3388 Constraint 33 221 19.6563 24.5704 36.8556 3.3388 Constraint 33 210 17.8073 22.2591 33.3887 3.3388 Constraint 33 201 21.7703 27.2128 40.8193 3.3388 Constraint 33 190 21.7011 27.1264 40.6895 3.3388 Constraint 33 182 17.8905 22.3632 33.5448 3.3388 Constraint 33 176 21.0509 26.3136 39.4704 3.3388 Constraint 33 169 18.9625 23.7032 35.5547 3.3388 Constraint 33 161 20.4474 25.5593 38.3389 3.3388 Constraint 33 144 15.9423 19.9279 29.8918 3.3388 Constraint 33 136 15.7635 19.7044 29.5565 3.3388 Constraint 33 128 15.4417 19.3022 28.9533 3.3388 Constraint 33 122 13.6116 17.0144 25.5217 3.3388 Constraint 33 113 11.4267 14.2834 21.4251 3.3388 Constraint 33 104 11.6713 14.5891 21.8837 3.3388 Constraint 144 713 23.8138 29.7672 44.6508 3.3296 Constraint 144 742 26.7946 33.4932 50.2399 3.3093 Constraint 144 735 26.4989 33.1236 49.6855 3.3093 Constraint 467 735 36.9432 46.1790 69.2685 3.2884 Constraint 51 153 13.6447 17.0559 25.5838 3.0000 Constraint 41 153 18.0692 22.5865 33.8798 3.0000 Constraint 33 153 18.0451 22.5563 33.8345 3.0000 Constraint 69 636 24.1517 30.1896 45.2844 2.8911 Constraint 58 636 24.0346 30.0432 45.0648 1.8912 Constraint 51 629 26.5728 33.2160 49.8240 1.0163 Constraint 51 622 28.2486 35.3107 52.9661 1.0163 Constraint 51 613 26.9879 33.7348 50.6023 1.0163 Constraint 51 604 23.4465 29.3082 43.9622 1.0163 Constraint 51 599 23.8723 29.8403 44.7605 1.0163 Constraint 51 590 25.6892 32.1115 48.1672 1.0163 Constraint 51 585 22.6780 28.3475 42.5212 1.0163 Constraint 51 577 20.0852 25.1065 37.6597 1.0163 Constraint 51 571 22.5281 28.1601 42.2401 1.0163 Constraint 51 557 22.4016 28.0021 42.0031 1.0163 Constraint 51 552 18.5010 23.1262 34.6894 1.0163 Constraint 51 544 25.5558 31.9447 47.9171 1.0163 Constraint 51 535 21.6961 27.1202 40.6802 1.0163 Constraint 51 527 24.2898 30.3623 45.5435 1.0163 Constraint 51 519 27.1697 33.9622 50.9433 1.0163 Constraint 41 629 30.0909 37.6136 56.4204 1.0163 Constraint 41 622 31.4272 39.2840 58.9261 1.0163 Constraint 41 613 30.0466 37.5583 56.3375 1.0163 Constraint 41 604 26.7802 33.4753 50.2129 1.0163 Constraint 41 599 27.0190 33.7737 50.6606 1.0163 Constraint 41 590 28.4440 35.5550 53.3324 1.0163 Constraint 41 585 25.4753 31.8441 47.7662 1.0163 Constraint 41 577 23.0935 28.8669 43.3004 1.0163 Constraint 41 571 25.0665 31.3331 46.9996 1.0163 Constraint 41 557 24.6267 30.7834 46.1751 1.0163 Constraint 41 552 20.9694 26.2118 39.3176 1.0163 Constraint 41 544 28.6064 35.7580 53.6370 1.0163 Constraint 41 535 24.8500 31.0625 46.5937 1.0163 Constraint 41 527 27.4611 34.3264 51.4896 1.0163 Constraint 41 519 30.4771 38.0964 57.1446 1.0163 Constraint 69 676 24.9293 31.1616 46.7424 1.0000 Constraint 69 668 22.5583 28.1979 42.2969 1.0000 Constraint 69 657 19.1182 23.8978 35.8467 1.0000 Constraint 69 651 21.3240 26.6550 39.9825 1.0000 Constraint 69 644 22.6097 28.2621 42.3932 1.0000 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 33 629 27.5165 34.3956 51.5934 0.3388 Constraint 33 622 28.6050 35.7563 53.6344 0.3388 Constraint 33 613 26.7294 33.4118 50.1177 0.3388 Constraint 33 604 23.8044 29.7555 44.6332 0.3388 Constraint 33 599 24.4030 30.5037 45.7556 0.3388 Constraint 33 590 25.3412 31.6764 47.5147 0.3388 Constraint 33 585 22.0426 27.5532 41.3298 0.3388 Constraint 33 577 20.2907 25.3633 38.0450 0.3388 Constraint 33 571 22.3174 27.8967 41.8451 0.3388 Constraint 33 557 21.2512 26.5640 39.8460 0.3388 Constraint 33 552 17.5171 21.8964 32.8446 0.3388 Constraint 33 544 27.5805 34.4756 51.7134 0.3388 Constraint 33 535 23.5611 29.4514 44.1771 0.3388 Constraint 33 527 25.5562 31.9453 47.9180 0.3388 Constraint 33 519 29.0129 36.2662 54.3993 0.3388 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: