# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 4.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 237 442 2.9684 3.7105 5.5657 23.5507 Constraint 242 442 2.9721 3.7151 5.5727 17.2107 Constraint 221 292 2.9780 3.7225 5.5838 12.6128 Constraint 429 497 3.1778 3.9723 5.9584 5.5730 Constraint 480 604 3.1116 3.8894 5.8342 3.9904 Constraint 182 272 3.1421 3.9276 5.8913 2.9893 Constraint 210 442 2.9070 3.6338 5.4507 2.9634 Constraint 128 201 3.1714 3.9643 5.9464 2.9118 Constraint 399 473 3.1908 3.9885 5.9828 2.5709 Constraint 314 391 2.4674 3.0842 4.6264 2.5709 Constraint 242 412 2.8259 3.5323 5.2985 2.3223 Constraint 242 599 2.9384 3.6730 5.5095 1.9846 Constraint 136 629 3.1966 3.9957 5.9936 1.1914 Constraint 480 636 3.1718 3.9648 5.9471 1.0000 Constraint 480 577 3.1846 3.9807 5.9711 1.0000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 742 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 742 0.8000 1.0000 1.5000 0.0000 Constraint 657 735 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 742 0.8000 1.0000 1.5000 0.0000 Constraint 651 735 0.8000 1.0000 1.5000 0.0000 Constraint 651 729 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 742 0.8000 1.0000 1.5000 0.0000 Constraint 644 735 0.8000 1.0000 1.5000 0.0000 Constraint 644 729 0.8000 1.0000 1.5000 0.0000 Constraint 644 720 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 742 0.8000 1.0000 1.5000 0.0000 Constraint 636 735 0.8000 1.0000 1.5000 0.0000 Constraint 636 729 0.8000 1.0000 1.5000 0.0000 Constraint 636 720 0.8000 1.0000 1.5000 0.0000 Constraint 636 713 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 742 0.8000 1.0000 1.5000 0.0000 Constraint 629 735 0.8000 1.0000 1.5000 0.0000 Constraint 629 729 0.8000 1.0000 1.5000 0.0000 Constraint 629 720 0.8000 1.0000 1.5000 0.0000 Constraint 629 713 0.8000 1.0000 1.5000 0.0000 Constraint 629 706 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 742 0.8000 1.0000 1.5000 0.0000 Constraint 622 735 0.8000 1.0000 1.5000 0.0000 Constraint 622 729 0.8000 1.0000 1.5000 0.0000 Constraint 622 720 0.8000 1.0000 1.5000 0.0000 Constraint 622 713 0.8000 1.0000 1.5000 0.0000 Constraint 622 706 0.8000 1.0000 1.5000 0.0000 Constraint 622 698 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 742 0.8000 1.0000 1.5000 0.0000 Constraint 613 735 0.8000 1.0000 1.5000 0.0000 Constraint 613 729 0.8000 1.0000 1.5000 0.0000 Constraint 613 720 0.8000 1.0000 1.5000 0.0000 Constraint 613 713 0.8000 1.0000 1.5000 0.0000 Constraint 613 706 0.8000 1.0000 1.5000 0.0000 Constraint 613 698 0.8000 1.0000 1.5000 0.0000 Constraint 613 687 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 742 0.8000 1.0000 1.5000 0.0000 Constraint 604 735 0.8000 1.0000 1.5000 0.0000 Constraint 604 729 0.8000 1.0000 1.5000 0.0000 Constraint 604 720 0.8000 1.0000 1.5000 0.0000 Constraint 604 713 0.8000 1.0000 1.5000 0.0000 Constraint 604 706 0.8000 1.0000 1.5000 0.0000 Constraint 604 698 0.8000 1.0000 1.5000 0.0000 Constraint 604 687 0.8000 1.0000 1.5000 0.0000 Constraint 604 676 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 742 0.8000 1.0000 1.5000 0.0000 Constraint 599 735 0.8000 1.0000 1.5000 0.0000 Constraint 599 729 0.8000 1.0000 1.5000 0.0000 Constraint 599 720 0.8000 1.0000 1.5000 0.0000 Constraint 599 713 0.8000 1.0000 1.5000 0.0000 Constraint 599 706 0.8000 1.0000 1.5000 0.0000 Constraint 599 698 0.8000 1.0000 1.5000 0.0000 Constraint 599 687 0.8000 1.0000 1.5000 0.0000 Constraint 599 676 0.8000 1.0000 1.5000 0.0000 Constraint 599 668 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 742 0.8000 1.0000 1.5000 0.0000 Constraint 590 735 0.8000 1.0000 1.5000 0.0000 Constraint 590 729 0.8000 1.0000 1.5000 0.0000 Constraint 590 720 0.8000 1.0000 1.5000 0.0000 Constraint 590 713 0.8000 1.0000 1.5000 0.0000 Constraint 590 706 0.8000 1.0000 1.5000 0.0000 Constraint 590 698 0.8000 1.0000 1.5000 0.0000 Constraint 590 687 0.8000 1.0000 1.5000 0.0000 Constraint 590 676 0.8000 1.0000 1.5000 0.0000 Constraint 590 668 0.8000 1.0000 1.5000 0.0000 Constraint 590 657 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 742 0.8000 1.0000 1.5000 0.0000 Constraint 585 735 0.8000 1.0000 1.5000 0.0000 Constraint 585 729 0.8000 1.0000 1.5000 0.0000 Constraint 585 720 0.8000 1.0000 1.5000 0.0000 Constraint 585 713 0.8000 1.0000 1.5000 0.0000 Constraint 585 706 0.8000 1.0000 1.5000 0.0000 Constraint 585 698 0.8000 1.0000 1.5000 0.0000 Constraint 585 687 0.8000 1.0000 1.5000 0.0000 Constraint 585 676 0.8000 1.0000 1.5000 0.0000 Constraint 585 668 0.8000 1.0000 1.5000 0.0000 Constraint 585 657 0.8000 1.0000 1.5000 0.0000 Constraint 585 651 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 735 0.8000 1.0000 1.5000 0.0000 Constraint 577 729 0.8000 1.0000 1.5000 0.0000 Constraint 577 720 0.8000 1.0000 1.5000 0.0000 Constraint 577 713 0.8000 1.0000 1.5000 0.0000 Constraint 577 706 0.8000 1.0000 1.5000 0.0000 Constraint 577 698 0.8000 1.0000 1.5000 0.0000 Constraint 577 687 0.8000 1.0000 1.5000 0.0000 Constraint 577 676 0.8000 1.0000 1.5000 0.0000 Constraint 577 668 0.8000 1.0000 1.5000 0.0000 Constraint 577 657 0.8000 1.0000 1.5000 0.0000 Constraint 577 651 0.8000 1.0000 1.5000 0.0000 Constraint 577 644 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 742 0.8000 1.0000 1.5000 0.0000 Constraint 571 735 0.8000 1.0000 1.5000 0.0000 Constraint 571 729 0.8000 1.0000 1.5000 0.0000 Constraint 571 720 0.8000 1.0000 1.5000 0.0000 Constraint 571 713 0.8000 1.0000 1.5000 0.0000 Constraint 571 706 0.8000 1.0000 1.5000 0.0000 Constraint 571 698 0.8000 1.0000 1.5000 0.0000 Constraint 571 687 0.8000 1.0000 1.5000 0.0000 Constraint 571 676 0.8000 1.0000 1.5000 0.0000 Constraint 571 668 0.8000 1.0000 1.5000 0.0000 Constraint 571 657 0.8000 1.0000 1.5000 0.0000 Constraint 571 651 0.8000 1.0000 1.5000 0.0000 Constraint 571 644 0.8000 1.0000 1.5000 0.0000 Constraint 571 636 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 742 0.8000 1.0000 1.5000 0.0000 Constraint 557 735 0.8000 1.0000 1.5000 0.0000 Constraint 557 729 0.8000 1.0000 1.5000 0.0000 Constraint 557 720 0.8000 1.0000 1.5000 0.0000 Constraint 557 713 0.8000 1.0000 1.5000 0.0000 Constraint 557 706 0.8000 1.0000 1.5000 0.0000 Constraint 557 698 0.8000 1.0000 1.5000 0.0000 Constraint 557 687 0.8000 1.0000 1.5000 0.0000 Constraint 557 676 0.8000 1.0000 1.5000 0.0000 Constraint 557 668 0.8000 1.0000 1.5000 0.0000 Constraint 557 657 0.8000 1.0000 1.5000 0.0000 Constraint 557 651 0.8000 1.0000 1.5000 0.0000 Constraint 557 644 0.8000 1.0000 1.5000 0.0000 Constraint 557 636 0.8000 1.0000 1.5000 0.0000 Constraint 557 629 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 735 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 720 0.8000 1.0000 1.5000 0.0000 Constraint 552 713 0.8000 1.0000 1.5000 0.0000 Constraint 552 706 0.8000 1.0000 1.5000 0.0000 Constraint 552 698 0.8000 1.0000 1.5000 0.0000 Constraint 552 687 0.8000 1.0000 1.5000 0.0000 Constraint 552 676 0.8000 1.0000 1.5000 0.0000 Constraint 552 668 0.8000 1.0000 1.5000 0.0000 Constraint 552 657 0.8000 1.0000 1.5000 0.0000 Constraint 552 651 0.8000 1.0000 1.5000 0.0000 Constraint 552 644 0.8000 1.0000 1.5000 0.0000 Constraint 552 636 0.8000 1.0000 1.5000 0.0000 Constraint 552 629 0.8000 1.0000 1.5000 0.0000 Constraint 552 622 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 742 0.8000 1.0000 1.5000 0.0000 Constraint 544 735 0.8000 1.0000 1.5000 0.0000 Constraint 544 729 0.8000 1.0000 1.5000 0.0000 Constraint 544 720 0.8000 1.0000 1.5000 0.0000 Constraint 544 713 0.8000 1.0000 1.5000 0.0000 Constraint 544 706 0.8000 1.0000 1.5000 0.0000 Constraint 544 698 0.8000 1.0000 1.5000 0.0000 Constraint 544 687 0.8000 1.0000 1.5000 0.0000 Constraint 544 676 0.8000 1.0000 1.5000 0.0000 Constraint 544 668 0.8000 1.0000 1.5000 0.0000 Constraint 544 657 0.8000 1.0000 1.5000 0.0000 Constraint 544 651 0.8000 1.0000 1.5000 0.0000 Constraint 544 644 0.8000 1.0000 1.5000 0.0000 Constraint 544 636 0.8000 1.0000 1.5000 0.0000 Constraint 544 629 0.8000 1.0000 1.5000 0.0000 Constraint 544 622 0.8000 1.0000 1.5000 0.0000 Constraint 544 613 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 742 0.8000 1.0000 1.5000 0.0000 Constraint 535 735 0.8000 1.0000 1.5000 0.0000 Constraint 535 729 0.8000 1.0000 1.5000 0.0000 Constraint 535 720 0.8000 1.0000 1.5000 0.0000 Constraint 535 713 0.8000 1.0000 1.5000 0.0000 Constraint 535 706 0.8000 1.0000 1.5000 0.0000 Constraint 535 698 0.8000 1.0000 1.5000 0.0000 Constraint 535 687 0.8000 1.0000 1.5000 0.0000 Constraint 535 676 0.8000 1.0000 1.5000 0.0000 Constraint 535 668 0.8000 1.0000 1.5000 0.0000 Constraint 535 657 0.8000 1.0000 1.5000 0.0000 Constraint 535 651 0.8000 1.0000 1.5000 0.0000 Constraint 535 644 0.8000 1.0000 1.5000 0.0000 Constraint 535 636 0.8000 1.0000 1.5000 0.0000 Constraint 535 629 0.8000 1.0000 1.5000 0.0000 Constraint 535 622 0.8000 1.0000 1.5000 0.0000 Constraint 535 613 0.8000 1.0000 1.5000 0.0000 Constraint 535 604 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 742 0.8000 1.0000 1.5000 0.0000 Constraint 527 735 0.8000 1.0000 1.5000 0.0000 Constraint 527 729 0.8000 1.0000 1.5000 0.0000 Constraint 527 720 0.8000 1.0000 1.5000 0.0000 Constraint 527 713 0.8000 1.0000 1.5000 0.0000 Constraint 527 706 0.8000 1.0000 1.5000 0.0000 Constraint 527 698 0.8000 1.0000 1.5000 0.0000 Constraint 527 687 0.8000 1.0000 1.5000 0.0000 Constraint 527 676 0.8000 1.0000 1.5000 0.0000 Constraint 527 668 0.8000 1.0000 1.5000 0.0000 Constraint 527 657 0.8000 1.0000 1.5000 0.0000 Constraint 527 651 0.8000 1.0000 1.5000 0.0000 Constraint 527 644 0.8000 1.0000 1.5000 0.0000 Constraint 527 636 0.8000 1.0000 1.5000 0.0000 Constraint 527 629 0.8000 1.0000 1.5000 0.0000 Constraint 527 622 0.8000 1.0000 1.5000 0.0000 Constraint 527 613 0.8000 1.0000 1.5000 0.0000 Constraint 527 604 0.8000 1.0000 1.5000 0.0000 Constraint 527 599 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 742 0.8000 1.0000 1.5000 0.0000 Constraint 519 735 0.8000 1.0000 1.5000 0.0000 Constraint 519 729 0.8000 1.0000 1.5000 0.0000 Constraint 519 720 0.8000 1.0000 1.5000 0.0000 Constraint 519 713 0.8000 1.0000 1.5000 0.0000 Constraint 519 706 0.8000 1.0000 1.5000 0.0000 Constraint 519 698 0.8000 1.0000 1.5000 0.0000 Constraint 519 687 0.8000 1.0000 1.5000 0.0000 Constraint 519 676 0.8000 1.0000 1.5000 0.0000 Constraint 519 668 0.8000 1.0000 1.5000 0.0000 Constraint 519 657 0.8000 1.0000 1.5000 0.0000 Constraint 519 651 0.8000 1.0000 1.5000 0.0000 Constraint 519 644 0.8000 1.0000 1.5000 0.0000 Constraint 519 636 0.8000 1.0000 1.5000 0.0000 Constraint 519 629 0.8000 1.0000 1.5000 0.0000 Constraint 519 622 0.8000 1.0000 1.5000 0.0000 Constraint 519 613 0.8000 1.0000 1.5000 0.0000 Constraint 519 604 0.8000 1.0000 1.5000 0.0000 Constraint 519 599 0.8000 1.0000 1.5000 0.0000 Constraint 519 590 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 742 0.8000 1.0000 1.5000 0.0000 Constraint 511 735 0.8000 1.0000 1.5000 0.0000 Constraint 511 729 0.8000 1.0000 1.5000 0.0000 Constraint 511 720 0.8000 1.0000 1.5000 0.0000 Constraint 511 713 0.8000 1.0000 1.5000 0.0000 Constraint 511 706 0.8000 1.0000 1.5000 0.0000 Constraint 511 698 0.8000 1.0000 1.5000 0.0000 Constraint 511 687 0.8000 1.0000 1.5000 0.0000 Constraint 511 676 0.8000 1.0000 1.5000 0.0000 Constraint 511 668 0.8000 1.0000 1.5000 0.0000 Constraint 511 657 0.8000 1.0000 1.5000 0.0000 Constraint 511 651 0.8000 1.0000 1.5000 0.0000 Constraint 511 644 0.8000 1.0000 1.5000 0.0000 Constraint 511 636 0.8000 1.0000 1.5000 0.0000 Constraint 511 629 0.8000 1.0000 1.5000 0.0000 Constraint 511 622 0.8000 1.0000 1.5000 0.0000 Constraint 511 613 0.8000 1.0000 1.5000 0.0000 Constraint 511 604 0.8000 1.0000 1.5000 0.0000 Constraint 511 599 0.8000 1.0000 1.5000 0.0000 Constraint 511 590 0.8000 1.0000 1.5000 0.0000 Constraint 511 585 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 742 0.8000 1.0000 1.5000 0.0000 Constraint 497 735 0.8000 1.0000 1.5000 0.0000 Constraint 497 729 0.8000 1.0000 1.5000 0.0000 Constraint 497 720 0.8000 1.0000 1.5000 0.0000 Constraint 497 713 0.8000 1.0000 1.5000 0.0000 Constraint 497 706 0.8000 1.0000 1.5000 0.0000 Constraint 497 698 0.8000 1.0000 1.5000 0.0000 Constraint 497 687 0.8000 1.0000 1.5000 0.0000 Constraint 497 676 0.8000 1.0000 1.5000 0.0000 Constraint 497 668 0.8000 1.0000 1.5000 0.0000 Constraint 497 657 0.8000 1.0000 1.5000 0.0000 Constraint 497 651 0.8000 1.0000 1.5000 0.0000 Constraint 497 644 0.8000 1.0000 1.5000 0.0000 Constraint 497 636 0.8000 1.0000 1.5000 0.0000 Constraint 497 629 0.8000 1.0000 1.5000 0.0000 Constraint 497 622 0.8000 1.0000 1.5000 0.0000 Constraint 497 613 0.8000 1.0000 1.5000 0.0000 Constraint 497 604 0.8000 1.0000 1.5000 0.0000 Constraint 497 599 0.8000 1.0000 1.5000 0.0000 Constraint 497 590 0.8000 1.0000 1.5000 0.0000 Constraint 497 585 0.8000 1.0000 1.5000 0.0000 Constraint 497 577 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 742 0.8000 1.0000 1.5000 0.0000 Constraint 489 735 0.8000 1.0000 1.5000 0.0000 Constraint 489 729 0.8000 1.0000 1.5000 0.0000 Constraint 489 720 0.8000 1.0000 1.5000 0.0000 Constraint 489 713 0.8000 1.0000 1.5000 0.0000 Constraint 489 706 0.8000 1.0000 1.5000 0.0000 Constraint 489 698 0.8000 1.0000 1.5000 0.0000 Constraint 489 687 0.8000 1.0000 1.5000 0.0000 Constraint 489 676 0.8000 1.0000 1.5000 0.0000 Constraint 489 668 0.8000 1.0000 1.5000 0.0000 Constraint 489 657 0.8000 1.0000 1.5000 0.0000 Constraint 489 651 0.8000 1.0000 1.5000 0.0000 Constraint 489 644 0.8000 1.0000 1.5000 0.0000 Constraint 489 636 0.8000 1.0000 1.5000 0.0000 Constraint 489 629 0.8000 1.0000 1.5000 0.0000 Constraint 489 622 0.8000 1.0000 1.5000 0.0000 Constraint 489 613 0.8000 1.0000 1.5000 0.0000 Constraint 489 604 0.8000 1.0000 1.5000 0.0000 Constraint 489 599 0.8000 1.0000 1.5000 0.0000 Constraint 489 590 0.8000 1.0000 1.5000 0.0000 Constraint 489 585 0.8000 1.0000 1.5000 0.0000 Constraint 489 577 0.8000 1.0000 1.5000 0.0000 Constraint 489 571 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 742 0.8000 1.0000 1.5000 0.0000 Constraint 480 735 0.8000 1.0000 1.5000 0.0000 Constraint 480 729 0.8000 1.0000 1.5000 0.0000 Constraint 480 720 0.8000 1.0000 1.5000 0.0000 Constraint 480 713 0.8000 1.0000 1.5000 0.0000 Constraint 480 706 0.8000 1.0000 1.5000 0.0000 Constraint 480 698 0.8000 1.0000 1.5000 0.0000 Constraint 480 687 0.8000 1.0000 1.5000 0.0000 Constraint 480 676 0.8000 1.0000 1.5000 0.0000 Constraint 480 668 0.8000 1.0000 1.5000 0.0000 Constraint 480 657 0.8000 1.0000 1.5000 0.0000 Constraint 480 651 0.8000 1.0000 1.5000 0.0000 Constraint 480 644 0.8000 1.0000 1.5000 0.0000 Constraint 480 629 0.8000 1.0000 1.5000 0.0000 Constraint 480 622 0.8000 1.0000 1.5000 0.0000 Constraint 480 613 0.8000 1.0000 1.5000 0.0000 Constraint 480 599 0.8000 1.0000 1.5000 0.0000 Constraint 480 590 0.8000 1.0000 1.5000 0.0000 Constraint 480 585 0.8000 1.0000 1.5000 0.0000 Constraint 480 571 0.8000 1.0000 1.5000 0.0000 Constraint 480 557 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 742 0.8000 1.0000 1.5000 0.0000 Constraint 473 735 0.8000 1.0000 1.5000 0.0000 Constraint 473 729 0.8000 1.0000 1.5000 0.0000 Constraint 473 720 0.8000 1.0000 1.5000 0.0000 Constraint 473 713 0.8000 1.0000 1.5000 0.0000 Constraint 473 706 0.8000 1.0000 1.5000 0.0000 Constraint 473 698 0.8000 1.0000 1.5000 0.0000 Constraint 473 687 0.8000 1.0000 1.5000 0.0000 Constraint 473 676 0.8000 1.0000 1.5000 0.0000 Constraint 473 668 0.8000 1.0000 1.5000 0.0000 Constraint 473 657 0.8000 1.0000 1.5000 0.0000 Constraint 473 651 0.8000 1.0000 1.5000 0.0000 Constraint 473 644 0.8000 1.0000 1.5000 0.0000 Constraint 473 636 0.8000 1.0000 1.5000 0.0000 Constraint 473 629 0.8000 1.0000 1.5000 0.0000 Constraint 473 622 0.8000 1.0000 1.5000 0.0000 Constraint 473 613 0.8000 1.0000 1.5000 0.0000 Constraint 473 604 0.8000 1.0000 1.5000 0.0000 Constraint 473 599 0.8000 1.0000 1.5000 0.0000 Constraint 473 590 0.8000 1.0000 1.5000 0.0000 Constraint 473 585 0.8000 1.0000 1.5000 0.0000 Constraint 473 577 0.8000 1.0000 1.5000 0.0000 Constraint 473 571 0.8000 1.0000 1.5000 0.0000 Constraint 473 557 0.8000 1.0000 1.5000 0.0000 Constraint 473 552 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 706 0.8000 1.0000 1.5000 0.0000 Constraint 467 698 0.8000 1.0000 1.5000 0.0000 Constraint 467 687 0.8000 1.0000 1.5000 0.0000 Constraint 467 676 0.8000 1.0000 1.5000 0.0000 Constraint 467 668 0.8000 1.0000 1.5000 0.0000 Constraint 467 657 0.8000 1.0000 1.5000 0.0000 Constraint 467 651 0.8000 1.0000 1.5000 0.0000 Constraint 467 644 0.8000 1.0000 1.5000 0.0000 Constraint 467 636 0.8000 1.0000 1.5000 0.0000 Constraint 467 629 0.8000 1.0000 1.5000 0.0000 Constraint 467 622 0.8000 1.0000 1.5000 0.0000 Constraint 467 613 0.8000 1.0000 1.5000 0.0000 Constraint 467 604 0.8000 1.0000 1.5000 0.0000 Constraint 467 599 0.8000 1.0000 1.5000 0.0000 Constraint 467 590 0.8000 1.0000 1.5000 0.0000 Constraint 467 585 0.8000 1.0000 1.5000 0.0000 Constraint 467 577 0.8000 1.0000 1.5000 0.0000 Constraint 467 571 0.8000 1.0000 1.5000 0.0000 Constraint 467 557 0.8000 1.0000 1.5000 0.0000 Constraint 467 552 0.8000 1.0000 1.5000 0.0000 Constraint 467 544 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 698 0.8000 1.0000 1.5000 0.0000 Constraint 461 687 0.8000 1.0000 1.5000 0.0000 Constraint 461 676 0.8000 1.0000 1.5000 0.0000 Constraint 461 668 0.8000 1.0000 1.5000 0.0000 Constraint 461 657 0.8000 1.0000 1.5000 0.0000 Constraint 461 651 0.8000 1.0000 1.5000 0.0000 Constraint 461 644 0.8000 1.0000 1.5000 0.0000 Constraint 461 636 0.8000 1.0000 1.5000 0.0000 Constraint 461 629 0.8000 1.0000 1.5000 0.0000 Constraint 461 622 0.8000 1.0000 1.5000 0.0000 Constraint 461 613 0.8000 1.0000 1.5000 0.0000 Constraint 461 604 0.8000 1.0000 1.5000 0.0000 Constraint 461 599 0.8000 1.0000 1.5000 0.0000 Constraint 461 590 0.8000 1.0000 1.5000 0.0000 Constraint 461 585 0.8000 1.0000 1.5000 0.0000 Constraint 461 577 0.8000 1.0000 1.5000 0.0000 Constraint 461 571 0.8000 1.0000 1.5000 0.0000 Constraint 461 557 0.8000 1.0000 1.5000 0.0000 Constraint 461 552 0.8000 1.0000 1.5000 0.0000 Constraint 461 544 0.8000 1.0000 1.5000 0.0000 Constraint 461 535 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 687 0.8000 1.0000 1.5000 0.0000 Constraint 449 676 0.8000 1.0000 1.5000 0.0000 Constraint 449 668 0.8000 1.0000 1.5000 0.0000 Constraint 449 657 0.8000 1.0000 1.5000 0.0000 Constraint 449 651 0.8000 1.0000 1.5000 0.0000 Constraint 449 644 0.8000 1.0000 1.5000 0.0000 Constraint 449 636 0.8000 1.0000 1.5000 0.0000 Constraint 449 629 0.8000 1.0000 1.5000 0.0000 Constraint 449 622 0.8000 1.0000 1.5000 0.0000 Constraint 449 613 0.8000 1.0000 1.5000 0.0000 Constraint 449 604 0.8000 1.0000 1.5000 0.0000 Constraint 449 599 0.8000 1.0000 1.5000 0.0000 Constraint 449 590 0.8000 1.0000 1.5000 0.0000 Constraint 449 585 0.8000 1.0000 1.5000 0.0000 Constraint 449 577 0.8000 1.0000 1.5000 0.0000 Constraint 449 571 0.8000 1.0000 1.5000 0.0000 Constraint 449 557 0.8000 1.0000 1.5000 0.0000 Constraint 449 552 0.8000 1.0000 1.5000 0.0000 Constraint 449 544 0.8000 1.0000 1.5000 0.0000 Constraint 449 535 0.8000 1.0000 1.5000 0.0000 Constraint 449 527 0.8000 1.0000 1.5000 0.0000 Constraint 449 519 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 687 0.8000 1.0000 1.5000 0.0000 Constraint 442 676 0.8000 1.0000 1.5000 0.0000 Constraint 442 668 0.8000 1.0000 1.5000 0.0000 Constraint 442 657 0.8000 1.0000 1.5000 0.0000 Constraint 442 651 0.8000 1.0000 1.5000 0.0000 Constraint 442 644 0.8000 1.0000 1.5000 0.0000 Constraint 442 636 0.8000 1.0000 1.5000 0.0000 Constraint 442 629 0.8000 1.0000 1.5000 0.0000 Constraint 442 622 0.8000 1.0000 1.5000 0.0000 Constraint 442 613 0.8000 1.0000 1.5000 0.0000 Constraint 442 604 0.8000 1.0000 1.5000 0.0000 Constraint 442 599 0.8000 1.0000 1.5000 0.0000 Constraint 442 590 0.8000 1.0000 1.5000 0.0000 Constraint 442 585 0.8000 1.0000 1.5000 0.0000 Constraint 442 577 0.8000 1.0000 1.5000 0.0000 Constraint 442 571 0.8000 1.0000 1.5000 0.0000 Constraint 442 557 0.8000 1.0000 1.5000 0.0000 Constraint 442 552 0.8000 1.0000 1.5000 0.0000 Constraint 442 544 0.8000 1.0000 1.5000 0.0000 Constraint 442 535 0.8000 1.0000 1.5000 0.0000 Constraint 442 527 0.8000 1.0000 1.5000 0.0000 Constraint 442 519 0.8000 1.0000 1.5000 0.0000 Constraint 442 511 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 698 0.8000 1.0000 1.5000 0.0000 Constraint 435 687 0.8000 1.0000 1.5000 0.0000 Constraint 435 676 0.8000 1.0000 1.5000 0.0000 Constraint 435 668 0.8000 1.0000 1.5000 0.0000 Constraint 435 657 0.8000 1.0000 1.5000 0.0000 Constraint 435 651 0.8000 1.0000 1.5000 0.0000 Constraint 435 644 0.8000 1.0000 1.5000 0.0000 Constraint 435 636 0.8000 1.0000 1.5000 0.0000 Constraint 435 629 0.8000 1.0000 1.5000 0.0000 Constraint 435 622 0.8000 1.0000 1.5000 0.0000 Constraint 435 613 0.8000 1.0000 1.5000 0.0000 Constraint 435 604 0.8000 1.0000 1.5000 0.0000 Constraint 435 599 0.8000 1.0000 1.5000 0.0000 Constraint 435 590 0.8000 1.0000 1.5000 0.0000 Constraint 435 585 0.8000 1.0000 1.5000 0.0000 Constraint 435 577 0.8000 1.0000 1.5000 0.0000 Constraint 435 571 0.8000 1.0000 1.5000 0.0000 Constraint 435 557 0.8000 1.0000 1.5000 0.0000 Constraint 435 552 0.8000 1.0000 1.5000 0.0000 Constraint 435 544 0.8000 1.0000 1.5000 0.0000 Constraint 435 535 0.8000 1.0000 1.5000 0.0000 Constraint 435 527 0.8000 1.0000 1.5000 0.0000 Constraint 435 519 0.8000 1.0000 1.5000 0.0000 Constraint 435 511 0.8000 1.0000 1.5000 0.0000 Constraint 435 497 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 706 0.8000 1.0000 1.5000 0.0000 Constraint 429 698 0.8000 1.0000 1.5000 0.0000 Constraint 429 687 0.8000 1.0000 1.5000 0.0000 Constraint 429 676 0.8000 1.0000 1.5000 0.0000 Constraint 429 668 0.8000 1.0000 1.5000 0.0000 Constraint 429 657 0.8000 1.0000 1.5000 0.0000 Constraint 429 651 0.8000 1.0000 1.5000 0.0000 Constraint 429 644 0.8000 1.0000 1.5000 0.0000 Constraint 429 636 0.8000 1.0000 1.5000 0.0000 Constraint 429 629 0.8000 1.0000 1.5000 0.0000 Constraint 429 622 0.8000 1.0000 1.5000 0.0000 Constraint 429 613 0.8000 1.0000 1.5000 0.0000 Constraint 429 604 0.8000 1.0000 1.5000 0.0000 Constraint 429 599 0.8000 1.0000 1.5000 0.0000 Constraint 429 590 0.8000 1.0000 1.5000 0.0000 Constraint 429 585 0.8000 1.0000 1.5000 0.0000 Constraint 429 577 0.8000 1.0000 1.5000 0.0000 Constraint 429 571 0.8000 1.0000 1.5000 0.0000 Constraint 429 557 0.8000 1.0000 1.5000 0.0000 Constraint 429 552 0.8000 1.0000 1.5000 0.0000 Constraint 429 544 0.8000 1.0000 1.5000 0.0000 Constraint 429 535 0.8000 1.0000 1.5000 0.0000 Constraint 429 527 0.8000 1.0000 1.5000 0.0000 Constraint 429 519 0.8000 1.0000 1.5000 0.0000 Constraint 429 511 0.8000 1.0000 1.5000 0.0000 Constraint 429 489 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 742 0.8000 1.0000 1.5000 0.0000 Constraint 421 735 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 706 0.8000 1.0000 1.5000 0.0000 Constraint 421 698 0.8000 1.0000 1.5000 0.0000 Constraint 421 687 0.8000 1.0000 1.5000 0.0000 Constraint 421 676 0.8000 1.0000 1.5000 0.0000 Constraint 421 668 0.8000 1.0000 1.5000 0.0000 Constraint 421 657 0.8000 1.0000 1.5000 0.0000 Constraint 421 651 0.8000 1.0000 1.5000 0.0000 Constraint 421 644 0.8000 1.0000 1.5000 0.0000 Constraint 421 636 0.8000 1.0000 1.5000 0.0000 Constraint 421 629 0.8000 1.0000 1.5000 0.0000 Constraint 421 622 0.8000 1.0000 1.5000 0.0000 Constraint 421 613 0.8000 1.0000 1.5000 0.0000 Constraint 421 604 0.8000 1.0000 1.5000 0.0000 Constraint 421 599 0.8000 1.0000 1.5000 0.0000 Constraint 421 590 0.8000 1.0000 1.5000 0.0000 Constraint 421 585 0.8000 1.0000 1.5000 0.0000 Constraint 421 577 0.8000 1.0000 1.5000 0.0000 Constraint 421 571 0.8000 1.0000 1.5000 0.0000 Constraint 421 557 0.8000 1.0000 1.5000 0.0000 Constraint 421 552 0.8000 1.0000 1.5000 0.0000 Constraint 421 544 0.8000 1.0000 1.5000 0.0000 Constraint 421 535 0.8000 1.0000 1.5000 0.0000 Constraint 421 527 0.8000 1.0000 1.5000 0.0000 Constraint 421 519 0.8000 1.0000 1.5000 0.0000 Constraint 421 511 0.8000 1.0000 1.5000 0.0000 Constraint 421 497 0.8000 1.0000 1.5000 0.0000 Constraint 421 489 0.8000 1.0000 1.5000 0.0000 Constraint 421 480 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 698 0.8000 1.0000 1.5000 0.0000 Constraint 412 687 0.8000 1.0000 1.5000 0.0000 Constraint 412 676 0.8000 1.0000 1.5000 0.0000 Constraint 412 668 0.8000 1.0000 1.5000 0.0000 Constraint 412 657 0.8000 1.0000 1.5000 0.0000 Constraint 412 651 0.8000 1.0000 1.5000 0.0000 Constraint 412 644 0.8000 1.0000 1.5000 0.0000 Constraint 412 636 0.8000 1.0000 1.5000 0.0000 Constraint 412 629 0.8000 1.0000 1.5000 0.0000 Constraint 412 622 0.8000 1.0000 1.5000 0.0000 Constraint 412 613 0.8000 1.0000 1.5000 0.0000 Constraint 412 604 0.8000 1.0000 1.5000 0.0000 Constraint 412 599 0.8000 1.0000 1.5000 0.0000 Constraint 412 590 0.8000 1.0000 1.5000 0.0000 Constraint 412 585 0.8000 1.0000 1.5000 0.0000 Constraint 412 577 0.8000 1.0000 1.5000 0.0000 Constraint 412 571 0.8000 1.0000 1.5000 0.0000 Constraint 412 557 0.8000 1.0000 1.5000 0.0000 Constraint 412 552 0.8000 1.0000 1.5000 0.0000 Constraint 412 544 0.8000 1.0000 1.5000 0.0000 Constraint 412 535 0.8000 1.0000 1.5000 0.0000 Constraint 412 527 0.8000 1.0000 1.5000 0.0000 Constraint 412 519 0.8000 1.0000 1.5000 0.0000 Constraint 412 511 0.8000 1.0000 1.5000 0.0000 Constraint 412 497 0.8000 1.0000 1.5000 0.0000 Constraint 412 489 0.8000 1.0000 1.5000 0.0000 Constraint 412 480 0.8000 1.0000 1.5000 0.0000 Constraint 412 473 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 706 0.8000 1.0000 1.5000 0.0000 Constraint 404 698 0.8000 1.0000 1.5000 0.0000 Constraint 404 687 0.8000 1.0000 1.5000 0.0000 Constraint 404 676 0.8000 1.0000 1.5000 0.0000 Constraint 404 668 0.8000 1.0000 1.5000 0.0000 Constraint 404 657 0.8000 1.0000 1.5000 0.0000 Constraint 404 651 0.8000 1.0000 1.5000 0.0000 Constraint 404 644 0.8000 1.0000 1.5000 0.0000 Constraint 404 636 0.8000 1.0000 1.5000 0.0000 Constraint 404 629 0.8000 1.0000 1.5000 0.0000 Constraint 404 622 0.8000 1.0000 1.5000 0.0000 Constraint 404 613 0.8000 1.0000 1.5000 0.0000 Constraint 404 604 0.8000 1.0000 1.5000 0.0000 Constraint 404 599 0.8000 1.0000 1.5000 0.0000 Constraint 404 590 0.8000 1.0000 1.5000 0.0000 Constraint 404 585 0.8000 1.0000 1.5000 0.0000 Constraint 404 577 0.8000 1.0000 1.5000 0.0000 Constraint 404 571 0.8000 1.0000 1.5000 0.0000 Constraint 404 557 0.8000 1.0000 1.5000 0.0000 Constraint 404 552 0.8000 1.0000 1.5000 0.0000 Constraint 404 544 0.8000 1.0000 1.5000 0.0000 Constraint 404 535 0.8000 1.0000 1.5000 0.0000 Constraint 404 527 0.8000 1.0000 1.5000 0.0000 Constraint 404 519 0.8000 1.0000 1.5000 0.0000 Constraint 404 511 0.8000 1.0000 1.5000 0.0000 Constraint 404 497 0.8000 1.0000 1.5000 0.0000 Constraint 404 489 0.8000 1.0000 1.5000 0.0000 Constraint 404 480 0.8000 1.0000 1.5000 0.0000 Constraint 404 473 0.8000 1.0000 1.5000 0.0000 Constraint 404 467 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 742 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 706 0.8000 1.0000 1.5000 0.0000 Constraint 399 698 0.8000 1.0000 1.5000 0.0000 Constraint 399 687 0.8000 1.0000 1.5000 0.0000 Constraint 399 676 0.8000 1.0000 1.5000 0.0000 Constraint 399 668 0.8000 1.0000 1.5000 0.0000 Constraint 399 657 0.8000 1.0000 1.5000 0.0000 Constraint 399 651 0.8000 1.0000 1.5000 0.0000 Constraint 399 644 0.8000 1.0000 1.5000 0.0000 Constraint 399 636 0.8000 1.0000 1.5000 0.0000 Constraint 399 629 0.8000 1.0000 1.5000 0.0000 Constraint 399 622 0.8000 1.0000 1.5000 0.0000 Constraint 399 613 0.8000 1.0000 1.5000 0.0000 Constraint 399 604 0.8000 1.0000 1.5000 0.0000 Constraint 399 599 0.8000 1.0000 1.5000 0.0000 Constraint 399 590 0.8000 1.0000 1.5000 0.0000 Constraint 399 585 0.8000 1.0000 1.5000 0.0000 Constraint 399 577 0.8000 1.0000 1.5000 0.0000 Constraint 399 571 0.8000 1.0000 1.5000 0.0000 Constraint 399 557 0.8000 1.0000 1.5000 0.0000 Constraint 399 552 0.8000 1.0000 1.5000 0.0000 Constraint 399 544 0.8000 1.0000 1.5000 0.0000 Constraint 399 535 0.8000 1.0000 1.5000 0.0000 Constraint 399 527 0.8000 1.0000 1.5000 0.0000 Constraint 399 519 0.8000 1.0000 1.5000 0.0000 Constraint 399 511 0.8000 1.0000 1.5000 0.0000 Constraint 399 497 0.8000 1.0000 1.5000 0.0000 Constraint 399 489 0.8000 1.0000 1.5000 0.0000 Constraint 399 480 0.8000 1.0000 1.5000 0.0000 Constraint 399 467 0.8000 1.0000 1.5000 0.0000 Constraint 399 461 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 742 0.8000 1.0000 1.5000 0.0000 Constraint 391 735 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 698 0.8000 1.0000 1.5000 0.0000 Constraint 391 687 0.8000 1.0000 1.5000 0.0000 Constraint 391 676 0.8000 1.0000 1.5000 0.0000 Constraint 391 668 0.8000 1.0000 1.5000 0.0000 Constraint 391 657 0.8000 1.0000 1.5000 0.0000 Constraint 391 651 0.8000 1.0000 1.5000 0.0000 Constraint 391 644 0.8000 1.0000 1.5000 0.0000 Constraint 391 636 0.8000 1.0000 1.5000 0.0000 Constraint 391 629 0.8000 1.0000 1.5000 0.0000 Constraint 391 622 0.8000 1.0000 1.5000 0.0000 Constraint 391 613 0.8000 1.0000 1.5000 0.0000 Constraint 391 604 0.8000 1.0000 1.5000 0.0000 Constraint 391 599 0.8000 1.0000 1.5000 0.0000 Constraint 391 590 0.8000 1.0000 1.5000 0.0000 Constraint 391 585 0.8000 1.0000 1.5000 0.0000 Constraint 391 577 0.8000 1.0000 1.5000 0.0000 Constraint 391 571 0.8000 1.0000 1.5000 0.0000 Constraint 391 557 0.8000 1.0000 1.5000 0.0000 Constraint 391 552 0.8000 1.0000 1.5000 0.0000 Constraint 391 544 0.8000 1.0000 1.5000 0.0000 Constraint 391 535 0.8000 1.0000 1.5000 0.0000 Constraint 391 527 0.8000 1.0000 1.5000 0.0000 Constraint 391 519 0.8000 1.0000 1.5000 0.0000 Constraint 391 511 0.8000 1.0000 1.5000 0.0000 Constraint 391 497 0.8000 1.0000 1.5000 0.0000 Constraint 391 489 0.8000 1.0000 1.5000 0.0000 Constraint 391 480 0.8000 1.0000 1.5000 0.0000 Constraint 391 473 0.8000 1.0000 1.5000 0.0000 Constraint 391 467 0.8000 1.0000 1.5000 0.0000 Constraint 391 461 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 742 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 706 0.8000 1.0000 1.5000 0.0000 Constraint 382 698 0.8000 1.0000 1.5000 0.0000 Constraint 382 687 0.8000 1.0000 1.5000 0.0000 Constraint 382 676 0.8000 1.0000 1.5000 0.0000 Constraint 382 668 0.8000 1.0000 1.5000 0.0000 Constraint 382 657 0.8000 1.0000 1.5000 0.0000 Constraint 382 651 0.8000 1.0000 1.5000 0.0000 Constraint 382 644 0.8000 1.0000 1.5000 0.0000 Constraint 382 636 0.8000 1.0000 1.5000 0.0000 Constraint 382 629 0.8000 1.0000 1.5000 0.0000 Constraint 382 622 0.8000 1.0000 1.5000 0.0000 Constraint 382 613 0.8000 1.0000 1.5000 0.0000 Constraint 382 604 0.8000 1.0000 1.5000 0.0000 Constraint 382 599 0.8000 1.0000 1.5000 0.0000 Constraint 382 590 0.8000 1.0000 1.5000 0.0000 Constraint 382 585 0.8000 1.0000 1.5000 0.0000 Constraint 382 577 0.8000 1.0000 1.5000 0.0000 Constraint 382 571 0.8000 1.0000 1.5000 0.0000 Constraint 382 557 0.8000 1.0000 1.5000 0.0000 Constraint 382 552 0.8000 1.0000 1.5000 0.0000 Constraint 382 544 0.8000 1.0000 1.5000 0.0000 Constraint 382 535 0.8000 1.0000 1.5000 0.0000 Constraint 382 527 0.8000 1.0000 1.5000 0.0000 Constraint 382 519 0.8000 1.0000 1.5000 0.0000 Constraint 382 511 0.8000 1.0000 1.5000 0.0000 Constraint 382 497 0.8000 1.0000 1.5000 0.0000 Constraint 382 489 0.8000 1.0000 1.5000 0.0000 Constraint 382 480 0.8000 1.0000 1.5000 0.0000 Constraint 382 473 0.8000 1.0000 1.5000 0.0000 Constraint 382 467 0.8000 1.0000 1.5000 0.0000 Constraint 382 461 0.8000 1.0000 1.5000 0.0000 Constraint 382 449 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 742 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 706 0.8000 1.0000 1.5000 0.0000 Constraint 375 698 0.8000 1.0000 1.5000 0.0000 Constraint 375 687 0.8000 1.0000 1.5000 0.0000 Constraint 375 676 0.8000 1.0000 1.5000 0.0000 Constraint 375 668 0.8000 1.0000 1.5000 0.0000 Constraint 375 657 0.8000 1.0000 1.5000 0.0000 Constraint 375 651 0.8000 1.0000 1.5000 0.0000 Constraint 375 644 0.8000 1.0000 1.5000 0.0000 Constraint 375 636 0.8000 1.0000 1.5000 0.0000 Constraint 375 629 0.8000 1.0000 1.5000 0.0000 Constraint 375 622 0.8000 1.0000 1.5000 0.0000 Constraint 375 613 0.8000 1.0000 1.5000 0.0000 Constraint 375 604 0.8000 1.0000 1.5000 0.0000 Constraint 375 599 0.8000 1.0000 1.5000 0.0000 Constraint 375 590 0.8000 1.0000 1.5000 0.0000 Constraint 375 585 0.8000 1.0000 1.5000 0.0000 Constraint 375 577 0.8000 1.0000 1.5000 0.0000 Constraint 375 571 0.8000 1.0000 1.5000 0.0000 Constraint 375 557 0.8000 1.0000 1.5000 0.0000 Constraint 375 552 0.8000 1.0000 1.5000 0.0000 Constraint 375 544 0.8000 1.0000 1.5000 0.0000 Constraint 375 535 0.8000 1.0000 1.5000 0.0000 Constraint 375 527 0.8000 1.0000 1.5000 0.0000 Constraint 375 519 0.8000 1.0000 1.5000 0.0000 Constraint 375 511 0.8000 1.0000 1.5000 0.0000 Constraint 375 497 0.8000 1.0000 1.5000 0.0000 Constraint 375 489 0.8000 1.0000 1.5000 0.0000 Constraint 375 480 0.8000 1.0000 1.5000 0.0000 Constraint 375 473 0.8000 1.0000 1.5000 0.0000 Constraint 375 467 0.8000 1.0000 1.5000 0.0000 Constraint 375 461 0.8000 1.0000 1.5000 0.0000 Constraint 375 449 0.8000 1.0000 1.5000 0.0000 Constraint 375 442 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 742 0.8000 1.0000 1.5000 0.0000 Constraint 368 735 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 706 0.8000 1.0000 1.5000 0.0000 Constraint 368 698 0.8000 1.0000 1.5000 0.0000 Constraint 368 687 0.8000 1.0000 1.5000 0.0000 Constraint 368 676 0.8000 1.0000 1.5000 0.0000 Constraint 368 668 0.8000 1.0000 1.5000 0.0000 Constraint 368 657 0.8000 1.0000 1.5000 0.0000 Constraint 368 651 0.8000 1.0000 1.5000 0.0000 Constraint 368 644 0.8000 1.0000 1.5000 0.0000 Constraint 368 636 0.8000 1.0000 1.5000 0.0000 Constraint 368 629 0.8000 1.0000 1.5000 0.0000 Constraint 368 622 0.8000 1.0000 1.5000 0.0000 Constraint 368 613 0.8000 1.0000 1.5000 0.0000 Constraint 368 604 0.8000 1.0000 1.5000 0.0000 Constraint 368 599 0.8000 1.0000 1.5000 0.0000 Constraint 368 590 0.8000 1.0000 1.5000 0.0000 Constraint 368 585 0.8000 1.0000 1.5000 0.0000 Constraint 368 577 0.8000 1.0000 1.5000 0.0000 Constraint 368 571 0.8000 1.0000 1.5000 0.0000 Constraint 368 557 0.8000 1.0000 1.5000 0.0000 Constraint 368 552 0.8000 1.0000 1.5000 0.0000 Constraint 368 544 0.8000 1.0000 1.5000 0.0000 Constraint 368 535 0.8000 1.0000 1.5000 0.0000 Constraint 368 527 0.8000 1.0000 1.5000 0.0000 Constraint 368 519 0.8000 1.0000 1.5000 0.0000 Constraint 368 511 0.8000 1.0000 1.5000 0.0000 Constraint 368 497 0.8000 1.0000 1.5000 0.0000 Constraint 368 489 0.8000 1.0000 1.5000 0.0000 Constraint 368 480 0.8000 1.0000 1.5000 0.0000 Constraint 368 473 0.8000 1.0000 1.5000 0.0000 Constraint 368 467 0.8000 1.0000 1.5000 0.0000 Constraint 368 461 0.8000 1.0000 1.5000 0.0000 Constraint 368 449 0.8000 1.0000 1.5000 0.0000 Constraint 368 442 0.8000 1.0000 1.5000 0.0000 Constraint 368 435 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 742 0.8000 1.0000 1.5000 0.0000 Constraint 360 735 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 706 0.8000 1.0000 1.5000 0.0000 Constraint 360 698 0.8000 1.0000 1.5000 0.0000 Constraint 360 687 0.8000 1.0000 1.5000 0.0000 Constraint 360 676 0.8000 1.0000 1.5000 0.0000 Constraint 360 668 0.8000 1.0000 1.5000 0.0000 Constraint 360 657 0.8000 1.0000 1.5000 0.0000 Constraint 360 651 0.8000 1.0000 1.5000 0.0000 Constraint 360 644 0.8000 1.0000 1.5000 0.0000 Constraint 360 636 0.8000 1.0000 1.5000 0.0000 Constraint 360 629 0.8000 1.0000 1.5000 0.0000 Constraint 360 622 0.8000 1.0000 1.5000 0.0000 Constraint 360 613 0.8000 1.0000 1.5000 0.0000 Constraint 360 604 0.8000 1.0000 1.5000 0.0000 Constraint 360 599 0.8000 1.0000 1.5000 0.0000 Constraint 360 590 0.8000 1.0000 1.5000 0.0000 Constraint 360 585 0.8000 1.0000 1.5000 0.0000 Constraint 360 577 0.8000 1.0000 1.5000 0.0000 Constraint 360 571 0.8000 1.0000 1.5000 0.0000 Constraint 360 557 0.8000 1.0000 1.5000 0.0000 Constraint 360 552 0.8000 1.0000 1.5000 0.0000 Constraint 360 544 0.8000 1.0000 1.5000 0.0000 Constraint 360 535 0.8000 1.0000 1.5000 0.0000 Constraint 360 527 0.8000 1.0000 1.5000 0.0000 Constraint 360 519 0.8000 1.0000 1.5000 0.0000 Constraint 360 511 0.8000 1.0000 1.5000 0.0000 Constraint 360 497 0.8000 1.0000 1.5000 0.0000 Constraint 360 489 0.8000 1.0000 1.5000 0.0000 Constraint 360 480 0.8000 1.0000 1.5000 0.0000 Constraint 360 473 0.8000 1.0000 1.5000 0.0000 Constraint 360 467 0.8000 1.0000 1.5000 0.0000 Constraint 360 461 0.8000 1.0000 1.5000 0.0000 Constraint 360 449 0.8000 1.0000 1.5000 0.0000 Constraint 360 442 0.8000 1.0000 1.5000 0.0000 Constraint 360 435 0.8000 1.0000 1.5000 0.0000 Constraint 360 429 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 742 0.8000 1.0000 1.5000 0.0000 Constraint 355 735 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 720 0.8000 1.0000 1.5000 0.0000 Constraint 355 713 0.8000 1.0000 1.5000 0.0000 Constraint 355 706 0.8000 1.0000 1.5000 0.0000 Constraint 355 698 0.8000 1.0000 1.5000 0.0000 Constraint 355 687 0.8000 1.0000 1.5000 0.0000 Constraint 355 676 0.8000 1.0000 1.5000 0.0000 Constraint 355 668 0.8000 1.0000 1.5000 0.0000 Constraint 355 657 0.8000 1.0000 1.5000 0.0000 Constraint 355 651 0.8000 1.0000 1.5000 0.0000 Constraint 355 644 0.8000 1.0000 1.5000 0.0000 Constraint 355 636 0.8000 1.0000 1.5000 0.0000 Constraint 355 629 0.8000 1.0000 1.5000 0.0000 Constraint 355 622 0.8000 1.0000 1.5000 0.0000 Constraint 355 613 0.8000 1.0000 1.5000 0.0000 Constraint 355 604 0.8000 1.0000 1.5000 0.0000 Constraint 355 599 0.8000 1.0000 1.5000 0.0000 Constraint 355 590 0.8000 1.0000 1.5000 0.0000 Constraint 355 585 0.8000 1.0000 1.5000 0.0000 Constraint 355 577 0.8000 1.0000 1.5000 0.0000 Constraint 355 571 0.8000 1.0000 1.5000 0.0000 Constraint 355 557 0.8000 1.0000 1.5000 0.0000 Constraint 355 552 0.8000 1.0000 1.5000 0.0000 Constraint 355 544 0.8000 1.0000 1.5000 0.0000 Constraint 355 535 0.8000 1.0000 1.5000 0.0000 Constraint 355 527 0.8000 1.0000 1.5000 0.0000 Constraint 355 519 0.8000 1.0000 1.5000 0.0000 Constraint 355 511 0.8000 1.0000 1.5000 0.0000 Constraint 355 497 0.8000 1.0000 1.5000 0.0000 Constraint 355 489 0.8000 1.0000 1.5000 0.0000 Constraint 355 480 0.8000 1.0000 1.5000 0.0000 Constraint 355 473 0.8000 1.0000 1.5000 0.0000 Constraint 355 467 0.8000 1.0000 1.5000 0.0000 Constraint 355 461 0.8000 1.0000 1.5000 0.0000 Constraint 355 449 0.8000 1.0000 1.5000 0.0000 Constraint 355 442 0.8000 1.0000 1.5000 0.0000 Constraint 355 435 0.8000 1.0000 1.5000 0.0000 Constraint 355 429 0.8000 1.0000 1.5000 0.0000 Constraint 355 421 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 742 0.8000 1.0000 1.5000 0.0000 Constraint 350 735 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 720 0.8000 1.0000 1.5000 0.0000 Constraint 350 713 0.8000 1.0000 1.5000 0.0000 Constraint 350 706 0.8000 1.0000 1.5000 0.0000 Constraint 350 698 0.8000 1.0000 1.5000 0.0000 Constraint 350 687 0.8000 1.0000 1.5000 0.0000 Constraint 350 676 0.8000 1.0000 1.5000 0.0000 Constraint 350 668 0.8000 1.0000 1.5000 0.0000 Constraint 350 657 0.8000 1.0000 1.5000 0.0000 Constraint 350 651 0.8000 1.0000 1.5000 0.0000 Constraint 350 644 0.8000 1.0000 1.5000 0.0000 Constraint 350 636 0.8000 1.0000 1.5000 0.0000 Constraint 350 629 0.8000 1.0000 1.5000 0.0000 Constraint 350 622 0.8000 1.0000 1.5000 0.0000 Constraint 350 613 0.8000 1.0000 1.5000 0.0000 Constraint 350 604 0.8000 1.0000 1.5000 0.0000 Constraint 350 599 0.8000 1.0000 1.5000 0.0000 Constraint 350 590 0.8000 1.0000 1.5000 0.0000 Constraint 350 585 0.8000 1.0000 1.5000 0.0000 Constraint 350 577 0.8000 1.0000 1.5000 0.0000 Constraint 350 571 0.8000 1.0000 1.5000 0.0000 Constraint 350 557 0.8000 1.0000 1.5000 0.0000 Constraint 350 552 0.8000 1.0000 1.5000 0.0000 Constraint 350 544 0.8000 1.0000 1.5000 0.0000 Constraint 350 535 0.8000 1.0000 1.5000 0.0000 Constraint 350 527 0.8000 1.0000 1.5000 0.0000 Constraint 350 519 0.8000 1.0000 1.5000 0.0000 Constraint 350 511 0.8000 1.0000 1.5000 0.0000 Constraint 350 497 0.8000 1.0000 1.5000 0.0000 Constraint 350 489 0.8000 1.0000 1.5000 0.0000 Constraint 350 480 0.8000 1.0000 1.5000 0.0000 Constraint 350 473 0.8000 1.0000 1.5000 0.0000 Constraint 350 467 0.8000 1.0000 1.5000 0.0000 Constraint 350 461 0.8000 1.0000 1.5000 0.0000 Constraint 350 449 0.8000 1.0000 1.5000 0.0000 Constraint 350 442 0.8000 1.0000 1.5000 0.0000 Constraint 350 435 0.8000 1.0000 1.5000 0.0000 Constraint 350 429 0.8000 1.0000 1.5000 0.0000 Constraint 350 421 0.8000 1.0000 1.5000 0.0000 Constraint 350 412 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 742 0.8000 1.0000 1.5000 0.0000 Constraint 341 735 0.8000 1.0000 1.5000 0.0000 Constraint 341 729 0.8000 1.0000 1.5000 0.0000 Constraint 341 720 0.8000 1.0000 1.5000 0.0000 Constraint 341 713 0.8000 1.0000 1.5000 0.0000 Constraint 341 706 0.8000 1.0000 1.5000 0.0000 Constraint 341 698 0.8000 1.0000 1.5000 0.0000 Constraint 341 687 0.8000 1.0000 1.5000 0.0000 Constraint 341 676 0.8000 1.0000 1.5000 0.0000 Constraint 341 668 0.8000 1.0000 1.5000 0.0000 Constraint 341 657 0.8000 1.0000 1.5000 0.0000 Constraint 341 651 0.8000 1.0000 1.5000 0.0000 Constraint 341 644 0.8000 1.0000 1.5000 0.0000 Constraint 341 636 0.8000 1.0000 1.5000 0.0000 Constraint 341 629 0.8000 1.0000 1.5000 0.0000 Constraint 341 622 0.8000 1.0000 1.5000 0.0000 Constraint 341 613 0.8000 1.0000 1.5000 0.0000 Constraint 341 604 0.8000 1.0000 1.5000 0.0000 Constraint 341 599 0.8000 1.0000 1.5000 0.0000 Constraint 341 590 0.8000 1.0000 1.5000 0.0000 Constraint 341 585 0.8000 1.0000 1.5000 0.0000 Constraint 341 577 0.8000 1.0000 1.5000 0.0000 Constraint 341 571 0.8000 1.0000 1.5000 0.0000 Constraint 341 557 0.8000 1.0000 1.5000 0.0000 Constraint 341 552 0.8000 1.0000 1.5000 0.0000 Constraint 341 544 0.8000 1.0000 1.5000 0.0000 Constraint 341 535 0.8000 1.0000 1.5000 0.0000 Constraint 341 527 0.8000 1.0000 1.5000 0.0000 Constraint 341 519 0.8000 1.0000 1.5000 0.0000 Constraint 341 511 0.8000 1.0000 1.5000 0.0000 Constraint 341 497 0.8000 1.0000 1.5000 0.0000 Constraint 341 489 0.8000 1.0000 1.5000 0.0000 Constraint 341 480 0.8000 1.0000 1.5000 0.0000 Constraint 341 473 0.8000 1.0000 1.5000 0.0000 Constraint 341 467 0.8000 1.0000 1.5000 0.0000 Constraint 341 461 0.8000 1.0000 1.5000 0.0000 Constraint 341 449 0.8000 1.0000 1.5000 0.0000 Constraint 341 442 0.8000 1.0000 1.5000 0.0000 Constraint 341 435 0.8000 1.0000 1.5000 0.0000 Constraint 341 429 0.8000 1.0000 1.5000 0.0000 Constraint 341 421 0.8000 1.0000 1.5000 0.0000 Constraint 341 412 0.8000 1.0000 1.5000 0.0000 Constraint 341 404 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 735 0.8000 1.0000 1.5000 0.0000 Constraint 330 729 0.8000 1.0000 1.5000 0.0000 Constraint 330 720 0.8000 1.0000 1.5000 0.0000 Constraint 330 713 0.8000 1.0000 1.5000 0.0000 Constraint 330 706 0.8000 1.0000 1.5000 0.0000 Constraint 330 698 0.8000 1.0000 1.5000 0.0000 Constraint 330 687 0.8000 1.0000 1.5000 0.0000 Constraint 330 676 0.8000 1.0000 1.5000 0.0000 Constraint 330 668 0.8000 1.0000 1.5000 0.0000 Constraint 330 657 0.8000 1.0000 1.5000 0.0000 Constraint 330 651 0.8000 1.0000 1.5000 0.0000 Constraint 330 644 0.8000 1.0000 1.5000 0.0000 Constraint 330 636 0.8000 1.0000 1.5000 0.0000 Constraint 330 629 0.8000 1.0000 1.5000 0.0000 Constraint 330 622 0.8000 1.0000 1.5000 0.0000 Constraint 330 613 0.8000 1.0000 1.5000 0.0000 Constraint 330 604 0.8000 1.0000 1.5000 0.0000 Constraint 330 599 0.8000 1.0000 1.5000 0.0000 Constraint 330 590 0.8000 1.0000 1.5000 0.0000 Constraint 330 585 0.8000 1.0000 1.5000 0.0000 Constraint 330 577 0.8000 1.0000 1.5000 0.0000 Constraint 330 571 0.8000 1.0000 1.5000 0.0000 Constraint 330 557 0.8000 1.0000 1.5000 0.0000 Constraint 330 552 0.8000 1.0000 1.5000 0.0000 Constraint 330 544 0.8000 1.0000 1.5000 0.0000 Constraint 330 535 0.8000 1.0000 1.5000 0.0000 Constraint 330 527 0.8000 1.0000 1.5000 0.0000 Constraint 330 519 0.8000 1.0000 1.5000 0.0000 Constraint 330 511 0.8000 1.0000 1.5000 0.0000 Constraint 330 497 0.8000 1.0000 1.5000 0.0000 Constraint 330 489 0.8000 1.0000 1.5000 0.0000 Constraint 330 480 0.8000 1.0000 1.5000 0.0000 Constraint 330 473 0.8000 1.0000 1.5000 0.0000 Constraint 330 467 0.8000 1.0000 1.5000 0.0000 Constraint 330 461 0.8000 1.0000 1.5000 0.0000 Constraint 330 449 0.8000 1.0000 1.5000 0.0000 Constraint 330 442 0.8000 1.0000 1.5000 0.0000 Constraint 330 435 0.8000 1.0000 1.5000 0.0000 Constraint 330 429 0.8000 1.0000 1.5000 0.0000 Constraint 330 421 0.8000 1.0000 1.5000 0.0000 Constraint 330 412 0.8000 1.0000 1.5000 0.0000 Constraint 330 404 0.8000 1.0000 1.5000 0.0000 Constraint 330 399 0.8000 1.0000 1.5000 0.0000 Constraint 330 391 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 720 0.8000 1.0000 1.5000 0.0000 Constraint 322 713 0.8000 1.0000 1.5000 0.0000 Constraint 322 706 0.8000 1.0000 1.5000 0.0000 Constraint 322 698 0.8000 1.0000 1.5000 0.0000 Constraint 322 687 0.8000 1.0000 1.5000 0.0000 Constraint 322 676 0.8000 1.0000 1.5000 0.0000 Constraint 322 668 0.8000 1.0000 1.5000 0.0000 Constraint 322 657 0.8000 1.0000 1.5000 0.0000 Constraint 322 651 0.8000 1.0000 1.5000 0.0000 Constraint 322 644 0.8000 1.0000 1.5000 0.0000 Constraint 322 636 0.8000 1.0000 1.5000 0.0000 Constraint 322 629 0.8000 1.0000 1.5000 0.0000 Constraint 322 622 0.8000 1.0000 1.5000 0.0000 Constraint 322 613 0.8000 1.0000 1.5000 0.0000 Constraint 322 604 0.8000 1.0000 1.5000 0.0000 Constraint 322 599 0.8000 1.0000 1.5000 0.0000 Constraint 322 590 0.8000 1.0000 1.5000 0.0000 Constraint 322 585 0.8000 1.0000 1.5000 0.0000 Constraint 322 577 0.8000 1.0000 1.5000 0.0000 Constraint 322 571 0.8000 1.0000 1.5000 0.0000 Constraint 322 557 0.8000 1.0000 1.5000 0.0000 Constraint 322 552 0.8000 1.0000 1.5000 0.0000 Constraint 322 544 0.8000 1.0000 1.5000 0.0000 Constraint 322 535 0.8000 1.0000 1.5000 0.0000 Constraint 322 527 0.8000 1.0000 1.5000 0.0000 Constraint 322 519 0.8000 1.0000 1.5000 0.0000 Constraint 322 511 0.8000 1.0000 1.5000 0.0000 Constraint 322 497 0.8000 1.0000 1.5000 0.0000 Constraint 322 489 0.8000 1.0000 1.5000 0.0000 Constraint 322 480 0.8000 1.0000 1.5000 0.0000 Constraint 322 473 0.8000 1.0000 1.5000 0.0000 Constraint 322 467 0.8000 1.0000 1.5000 0.0000 Constraint 322 461 0.8000 1.0000 1.5000 0.0000 Constraint 322 449 0.8000 1.0000 1.5000 0.0000 Constraint 322 442 0.8000 1.0000 1.5000 0.0000 Constraint 322 435 0.8000 1.0000 1.5000 0.0000 Constraint 322 429 0.8000 1.0000 1.5000 0.0000 Constraint 322 421 0.8000 1.0000 1.5000 0.0000 Constraint 322 412 0.8000 1.0000 1.5000 0.0000 Constraint 322 404 0.8000 1.0000 1.5000 0.0000 Constraint 322 399 0.8000 1.0000 1.5000 0.0000 Constraint 322 391 0.8000 1.0000 1.5000 0.0000 Constraint 322 382 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 729 0.8000 1.0000 1.5000 0.0000 Constraint 314 720 0.8000 1.0000 1.5000 0.0000 Constraint 314 713 0.8000 1.0000 1.5000 0.0000 Constraint 314 706 0.8000 1.0000 1.5000 0.0000 Constraint 314 698 0.8000 1.0000 1.5000 0.0000 Constraint 314 687 0.8000 1.0000 1.5000 0.0000 Constraint 314 676 0.8000 1.0000 1.5000 0.0000 Constraint 314 668 0.8000 1.0000 1.5000 0.0000 Constraint 314 657 0.8000 1.0000 1.5000 0.0000 Constraint 314 651 0.8000 1.0000 1.5000 0.0000 Constraint 314 644 0.8000 1.0000 1.5000 0.0000 Constraint 314 636 0.8000 1.0000 1.5000 0.0000 Constraint 314 629 0.8000 1.0000 1.5000 0.0000 Constraint 314 622 0.8000 1.0000 1.5000 0.0000 Constraint 314 613 0.8000 1.0000 1.5000 0.0000 Constraint 314 604 0.8000 1.0000 1.5000 0.0000 Constraint 314 599 0.8000 1.0000 1.5000 0.0000 Constraint 314 590 0.8000 1.0000 1.5000 0.0000 Constraint 314 585 0.8000 1.0000 1.5000 0.0000 Constraint 314 577 0.8000 1.0000 1.5000 0.0000 Constraint 314 571 0.8000 1.0000 1.5000 0.0000 Constraint 314 557 0.8000 1.0000 1.5000 0.0000 Constraint 314 552 0.8000 1.0000 1.5000 0.0000 Constraint 314 544 0.8000 1.0000 1.5000 0.0000 Constraint 314 535 0.8000 1.0000 1.5000 0.0000 Constraint 314 527 0.8000 1.0000 1.5000 0.0000 Constraint 314 519 0.8000 1.0000 1.5000 0.0000 Constraint 314 511 0.8000 1.0000 1.5000 0.0000 Constraint 314 497 0.8000 1.0000 1.5000 0.0000 Constraint 314 489 0.8000 1.0000 1.5000 0.0000 Constraint 314 480 0.8000 1.0000 1.5000 0.0000 Constraint 314 473 0.8000 1.0000 1.5000 0.0000 Constraint 314 467 0.8000 1.0000 1.5000 0.0000 Constraint 314 461 0.8000 1.0000 1.5000 0.0000 Constraint 314 449 0.8000 1.0000 1.5000 0.0000 Constraint 314 442 0.8000 1.0000 1.5000 0.0000 Constraint 314 435 0.8000 1.0000 1.5000 0.0000 Constraint 314 429 0.8000 1.0000 1.5000 0.0000 Constraint 314 421 0.8000 1.0000 1.5000 0.0000 Constraint 314 412 0.8000 1.0000 1.5000 0.0000 Constraint 314 404 0.8000 1.0000 1.5000 0.0000 Constraint 314 399 0.8000 1.0000 1.5000 0.0000 Constraint 314 382 0.8000 1.0000 1.5000 0.0000 Constraint 314 375 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 720 0.8000 1.0000 1.5000 0.0000 Constraint 303 713 0.8000 1.0000 1.5000 0.0000 Constraint 303 706 0.8000 1.0000 1.5000 0.0000 Constraint 303 698 0.8000 1.0000 1.5000 0.0000 Constraint 303 687 0.8000 1.0000 1.5000 0.0000 Constraint 303 676 0.8000 1.0000 1.5000 0.0000 Constraint 303 668 0.8000 1.0000 1.5000 0.0000 Constraint 303 657 0.8000 1.0000 1.5000 0.0000 Constraint 303 651 0.8000 1.0000 1.5000 0.0000 Constraint 303 644 0.8000 1.0000 1.5000 0.0000 Constraint 303 636 0.8000 1.0000 1.5000 0.0000 Constraint 303 629 0.8000 1.0000 1.5000 0.0000 Constraint 303 622 0.8000 1.0000 1.5000 0.0000 Constraint 303 613 0.8000 1.0000 1.5000 0.0000 Constraint 303 604 0.8000 1.0000 1.5000 0.0000 Constraint 303 599 0.8000 1.0000 1.5000 0.0000 Constraint 303 590 0.8000 1.0000 1.5000 0.0000 Constraint 303 585 0.8000 1.0000 1.5000 0.0000 Constraint 303 577 0.8000 1.0000 1.5000 0.0000 Constraint 303 571 0.8000 1.0000 1.5000 0.0000 Constraint 303 557 0.8000 1.0000 1.5000 0.0000 Constraint 303 552 0.8000 1.0000 1.5000 0.0000 Constraint 303 544 0.8000 1.0000 1.5000 0.0000 Constraint 303 535 0.8000 1.0000 1.5000 0.0000 Constraint 303 527 0.8000 1.0000 1.5000 0.0000 Constraint 303 519 0.8000 1.0000 1.5000 0.0000 Constraint 303 511 0.8000 1.0000 1.5000 0.0000 Constraint 303 497 0.8000 1.0000 1.5000 0.0000 Constraint 303 489 0.8000 1.0000 1.5000 0.0000 Constraint 303 480 0.8000 1.0000 1.5000 0.0000 Constraint 303 473 0.8000 1.0000 1.5000 0.0000 Constraint 303 467 0.8000 1.0000 1.5000 0.0000 Constraint 303 461 0.8000 1.0000 1.5000 0.0000 Constraint 303 449 0.8000 1.0000 1.5000 0.0000 Constraint 303 442 0.8000 1.0000 1.5000 0.0000 Constraint 303 435 0.8000 1.0000 1.5000 0.0000 Constraint 303 429 0.8000 1.0000 1.5000 0.0000 Constraint 303 421 0.8000 1.0000 1.5000 0.0000 Constraint 303 412 0.8000 1.0000 1.5000 0.0000 Constraint 303 404 0.8000 1.0000 1.5000 0.0000 Constraint 303 399 0.8000 1.0000 1.5000 0.0000 Constraint 303 391 0.8000 1.0000 1.5000 0.0000 Constraint 303 382 0.8000 1.0000 1.5000 0.0000 Constraint 303 375 0.8000 1.0000 1.5000 0.0000 Constraint 303 368 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 729 0.8000 1.0000 1.5000 0.0000 Constraint 297 720 0.8000 1.0000 1.5000 0.0000 Constraint 297 713 0.8000 1.0000 1.5000 0.0000 Constraint 297 706 0.8000 1.0000 1.5000 0.0000 Constraint 297 698 0.8000 1.0000 1.5000 0.0000 Constraint 297 687 0.8000 1.0000 1.5000 0.0000 Constraint 297 676 0.8000 1.0000 1.5000 0.0000 Constraint 297 668 0.8000 1.0000 1.5000 0.0000 Constraint 297 657 0.8000 1.0000 1.5000 0.0000 Constraint 297 651 0.8000 1.0000 1.5000 0.0000 Constraint 297 644 0.8000 1.0000 1.5000 0.0000 Constraint 297 636 0.8000 1.0000 1.5000 0.0000 Constraint 297 629 0.8000 1.0000 1.5000 0.0000 Constraint 297 622 0.8000 1.0000 1.5000 0.0000 Constraint 297 613 0.8000 1.0000 1.5000 0.0000 Constraint 297 604 0.8000 1.0000 1.5000 0.0000 Constraint 297 599 0.8000 1.0000 1.5000 0.0000 Constraint 297 590 0.8000 1.0000 1.5000 0.0000 Constraint 297 585 0.8000 1.0000 1.5000 0.0000 Constraint 297 577 0.8000 1.0000 1.5000 0.0000 Constraint 297 571 0.8000 1.0000 1.5000 0.0000 Constraint 297 557 0.8000 1.0000 1.5000 0.0000 Constraint 297 552 0.8000 1.0000 1.5000 0.0000 Constraint 297 544 0.8000 1.0000 1.5000 0.0000 Constraint 297 535 0.8000 1.0000 1.5000 0.0000 Constraint 297 527 0.8000 1.0000 1.5000 0.0000 Constraint 297 519 0.8000 1.0000 1.5000 0.0000 Constraint 297 511 0.8000 1.0000 1.5000 0.0000 Constraint 297 497 0.8000 1.0000 1.5000 0.0000 Constraint 297 489 0.8000 1.0000 1.5000 0.0000 Constraint 297 480 0.8000 1.0000 1.5000 0.0000 Constraint 297 473 0.8000 1.0000 1.5000 0.0000 Constraint 297 467 0.8000 1.0000 1.5000 0.0000 Constraint 297 461 0.8000 1.0000 1.5000 0.0000 Constraint 297 449 0.8000 1.0000 1.5000 0.0000 Constraint 297 442 0.8000 1.0000 1.5000 0.0000 Constraint 297 435 0.8000 1.0000 1.5000 0.0000 Constraint 297 429 0.8000 1.0000 1.5000 0.0000 Constraint 297 421 0.8000 1.0000 1.5000 0.0000 Constraint 297 412 0.8000 1.0000 1.5000 0.0000 Constraint 297 404 0.8000 1.0000 1.5000 0.0000 Constraint 297 399 0.8000 1.0000 1.5000 0.0000 Constraint 297 391 0.8000 1.0000 1.5000 0.0000 Constraint 297 382 0.8000 1.0000 1.5000 0.0000 Constraint 297 375 0.8000 1.0000 1.5000 0.0000 Constraint 297 368 0.8000 1.0000 1.5000 0.0000 Constraint 297 360 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 720 0.8000 1.0000 1.5000 0.0000 Constraint 292 713 0.8000 1.0000 1.5000 0.0000 Constraint 292 706 0.8000 1.0000 1.5000 0.0000 Constraint 292 698 0.8000 1.0000 1.5000 0.0000 Constraint 292 687 0.8000 1.0000 1.5000 0.0000 Constraint 292 676 0.8000 1.0000 1.5000 0.0000 Constraint 292 668 0.8000 1.0000 1.5000 0.0000 Constraint 292 657 0.8000 1.0000 1.5000 0.0000 Constraint 292 651 0.8000 1.0000 1.5000 0.0000 Constraint 292 644 0.8000 1.0000 1.5000 0.0000 Constraint 292 636 0.8000 1.0000 1.5000 0.0000 Constraint 292 629 0.8000 1.0000 1.5000 0.0000 Constraint 292 622 0.8000 1.0000 1.5000 0.0000 Constraint 292 613 0.8000 1.0000 1.5000 0.0000 Constraint 292 604 0.8000 1.0000 1.5000 0.0000 Constraint 292 599 0.8000 1.0000 1.5000 0.0000 Constraint 292 590 0.8000 1.0000 1.5000 0.0000 Constraint 292 585 0.8000 1.0000 1.5000 0.0000 Constraint 292 577 0.8000 1.0000 1.5000 0.0000 Constraint 292 571 0.8000 1.0000 1.5000 0.0000 Constraint 292 557 0.8000 1.0000 1.5000 0.0000 Constraint 292 552 0.8000 1.0000 1.5000 0.0000 Constraint 292 544 0.8000 1.0000 1.5000 0.0000 Constraint 292 535 0.8000 1.0000 1.5000 0.0000 Constraint 292 527 0.8000 1.0000 1.5000 0.0000 Constraint 292 519 0.8000 1.0000 1.5000 0.0000 Constraint 292 511 0.8000 1.0000 1.5000 0.0000 Constraint 292 497 0.8000 1.0000 1.5000 0.0000 Constraint 292 489 0.8000 1.0000 1.5000 0.0000 Constraint 292 480 0.8000 1.0000 1.5000 0.0000 Constraint 292 473 0.8000 1.0000 1.5000 0.0000 Constraint 292 467 0.8000 1.0000 1.5000 0.0000 Constraint 292 461 0.8000 1.0000 1.5000 0.0000 Constraint 292 449 0.8000 1.0000 1.5000 0.0000 Constraint 292 442 0.8000 1.0000 1.5000 0.0000 Constraint 292 435 0.8000 1.0000 1.5000 0.0000 Constraint 292 429 0.8000 1.0000 1.5000 0.0000 Constraint 292 421 0.8000 1.0000 1.5000 0.0000 Constraint 292 412 0.8000 1.0000 1.5000 0.0000 Constraint 292 404 0.8000 1.0000 1.5000 0.0000 Constraint 292 399 0.8000 1.0000 1.5000 0.0000 Constraint 292 391 0.8000 1.0000 1.5000 0.0000 Constraint 292 382 0.8000 1.0000 1.5000 0.0000 Constraint 292 375 0.8000 1.0000 1.5000 0.0000 Constraint 292 368 0.8000 1.0000 1.5000 0.0000 Constraint 292 360 0.8000 1.0000 1.5000 0.0000 Constraint 292 355 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 720 0.8000 1.0000 1.5000 0.0000 Constraint 285 713 0.8000 1.0000 1.5000 0.0000 Constraint 285 706 0.8000 1.0000 1.5000 0.0000 Constraint 285 698 0.8000 1.0000 1.5000 0.0000 Constraint 285 687 0.8000 1.0000 1.5000 0.0000 Constraint 285 676 0.8000 1.0000 1.5000 0.0000 Constraint 285 668 0.8000 1.0000 1.5000 0.0000 Constraint 285 657 0.8000 1.0000 1.5000 0.0000 Constraint 285 651 0.8000 1.0000 1.5000 0.0000 Constraint 285 644 0.8000 1.0000 1.5000 0.0000 Constraint 285 636 0.8000 1.0000 1.5000 0.0000 Constraint 285 629 0.8000 1.0000 1.5000 0.0000 Constraint 285 622 0.8000 1.0000 1.5000 0.0000 Constraint 285 613 0.8000 1.0000 1.5000 0.0000 Constraint 285 604 0.8000 1.0000 1.5000 0.0000 Constraint 285 599 0.8000 1.0000 1.5000 0.0000 Constraint 285 590 0.8000 1.0000 1.5000 0.0000 Constraint 285 585 0.8000 1.0000 1.5000 0.0000 Constraint 285 577 0.8000 1.0000 1.5000 0.0000 Constraint 285 571 0.8000 1.0000 1.5000 0.0000 Constraint 285 557 0.8000 1.0000 1.5000 0.0000 Constraint 285 552 0.8000 1.0000 1.5000 0.0000 Constraint 285 544 0.8000 1.0000 1.5000 0.0000 Constraint 285 535 0.8000 1.0000 1.5000 0.0000 Constraint 285 527 0.8000 1.0000 1.5000 0.0000 Constraint 285 519 0.8000 1.0000 1.5000 0.0000 Constraint 285 511 0.8000 1.0000 1.5000 0.0000 Constraint 285 497 0.8000 1.0000 1.5000 0.0000 Constraint 285 489 0.8000 1.0000 1.5000 0.0000 Constraint 285 480 0.8000 1.0000 1.5000 0.0000 Constraint 285 473 0.8000 1.0000 1.5000 0.0000 Constraint 285 467 0.8000 1.0000 1.5000 0.0000 Constraint 285 461 0.8000 1.0000 1.5000 0.0000 Constraint 285 449 0.8000 1.0000 1.5000 0.0000 Constraint 285 442 0.8000 1.0000 1.5000 0.0000 Constraint 285 435 0.8000 1.0000 1.5000 0.0000 Constraint 285 429 0.8000 1.0000 1.5000 0.0000 Constraint 285 421 0.8000 1.0000 1.5000 0.0000 Constraint 285 412 0.8000 1.0000 1.5000 0.0000 Constraint 285 404 0.8000 1.0000 1.5000 0.0000 Constraint 285 399 0.8000 1.0000 1.5000 0.0000 Constraint 285 391 0.8000 1.0000 1.5000 0.0000 Constraint 285 382 0.8000 1.0000 1.5000 0.0000 Constraint 285 375 0.8000 1.0000 1.5000 0.0000 Constraint 285 368 0.8000 1.0000 1.5000 0.0000 Constraint 285 360 0.8000 1.0000 1.5000 0.0000 Constraint 285 355 0.8000 1.0000 1.5000 0.0000 Constraint 285 350 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 729 0.8000 1.0000 1.5000 0.0000 Constraint 279 720 0.8000 1.0000 1.5000 0.0000 Constraint 279 713 0.8000 1.0000 1.5000 0.0000 Constraint 279 706 0.8000 1.0000 1.5000 0.0000 Constraint 279 698 0.8000 1.0000 1.5000 0.0000 Constraint 279 687 0.8000 1.0000 1.5000 0.0000 Constraint 279 676 0.8000 1.0000 1.5000 0.0000 Constraint 279 668 0.8000 1.0000 1.5000 0.0000 Constraint 279 657 0.8000 1.0000 1.5000 0.0000 Constraint 279 651 0.8000 1.0000 1.5000 0.0000 Constraint 279 644 0.8000 1.0000 1.5000 0.0000 Constraint 279 636 0.8000 1.0000 1.5000 0.0000 Constraint 279 629 0.8000 1.0000 1.5000 0.0000 Constraint 279 622 0.8000 1.0000 1.5000 0.0000 Constraint 279 613 0.8000 1.0000 1.5000 0.0000 Constraint 279 604 0.8000 1.0000 1.5000 0.0000 Constraint 279 599 0.8000 1.0000 1.5000 0.0000 Constraint 279 590 0.8000 1.0000 1.5000 0.0000 Constraint 279 585 0.8000 1.0000 1.5000 0.0000 Constraint 279 577 0.8000 1.0000 1.5000 0.0000 Constraint 279 571 0.8000 1.0000 1.5000 0.0000 Constraint 279 557 0.8000 1.0000 1.5000 0.0000 Constraint 279 552 0.8000 1.0000 1.5000 0.0000 Constraint 279 544 0.8000 1.0000 1.5000 0.0000 Constraint 279 535 0.8000 1.0000 1.5000 0.0000 Constraint 279 527 0.8000 1.0000 1.5000 0.0000 Constraint 279 519 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 497 0.8000 1.0000 1.5000 0.0000 Constraint 279 489 0.8000 1.0000 1.5000 0.0000 Constraint 279 480 0.8000 1.0000 1.5000 0.0000 Constraint 279 473 0.8000 1.0000 1.5000 0.0000 Constraint 279 467 0.8000 1.0000 1.5000 0.0000 Constraint 279 461 0.8000 1.0000 1.5000 0.0000 Constraint 279 449 0.8000 1.0000 1.5000 0.0000 Constraint 279 442 0.8000 1.0000 1.5000 0.0000 Constraint 279 435 0.8000 1.0000 1.5000 0.0000 Constraint 279 429 0.8000 1.0000 1.5000 0.0000 Constraint 279 421 0.8000 1.0000 1.5000 0.0000 Constraint 279 412 0.8000 1.0000 1.5000 0.0000 Constraint 279 404 0.8000 1.0000 1.5000 0.0000 Constraint 279 399 0.8000 1.0000 1.5000 0.0000 Constraint 279 391 0.8000 1.0000 1.5000 0.0000 Constraint 279 382 0.8000 1.0000 1.5000 0.0000 Constraint 279 375 0.8000 1.0000 1.5000 0.0000 Constraint 279 368 0.8000 1.0000 1.5000 0.0000 Constraint 279 360 0.8000 1.0000 1.5000 0.0000 Constraint 279 355 0.8000 1.0000 1.5000 0.0000 Constraint 279 350 0.8000 1.0000 1.5000 0.0000 Constraint 279 341 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 729 0.8000 1.0000 1.5000 0.0000 Constraint 272 720 0.8000 1.0000 1.5000 0.0000 Constraint 272 713 0.8000 1.0000 1.5000 0.0000 Constraint 272 706 0.8000 1.0000 1.5000 0.0000 Constraint 272 698 0.8000 1.0000 1.5000 0.0000 Constraint 272 687 0.8000 1.0000 1.5000 0.0000 Constraint 272 676 0.8000 1.0000 1.5000 0.0000 Constraint 272 668 0.8000 1.0000 1.5000 0.0000 Constraint 272 657 0.8000 1.0000 1.5000 0.0000 Constraint 272 651 0.8000 1.0000 1.5000 0.0000 Constraint 272 644 0.8000 1.0000 1.5000 0.0000 Constraint 272 636 0.8000 1.0000 1.5000 0.0000 Constraint 272 629 0.8000 1.0000 1.5000 0.0000 Constraint 272 622 0.8000 1.0000 1.5000 0.0000 Constraint 272 613 0.8000 1.0000 1.5000 0.0000 Constraint 272 604 0.8000 1.0000 1.5000 0.0000 Constraint 272 599 0.8000 1.0000 1.5000 0.0000 Constraint 272 590 0.8000 1.0000 1.5000 0.0000 Constraint 272 585 0.8000 1.0000 1.5000 0.0000 Constraint 272 577 0.8000 1.0000 1.5000 0.0000 Constraint 272 571 0.8000 1.0000 1.5000 0.0000 Constraint 272 557 0.8000 1.0000 1.5000 0.0000 Constraint 272 552 0.8000 1.0000 1.5000 0.0000 Constraint 272 544 0.8000 1.0000 1.5000 0.0000 Constraint 272 535 0.8000 1.0000 1.5000 0.0000 Constraint 272 527 0.8000 1.0000 1.5000 0.0000 Constraint 272 519 0.8000 1.0000 1.5000 0.0000 Constraint 272 511 0.8000 1.0000 1.5000 0.0000 Constraint 272 497 0.8000 1.0000 1.5000 0.0000 Constraint 272 489 0.8000 1.0000 1.5000 0.0000 Constraint 272 480 0.8000 1.0000 1.5000 0.0000 Constraint 272 473 0.8000 1.0000 1.5000 0.0000 Constraint 272 467 0.8000 1.0000 1.5000 0.0000 Constraint 272 461 0.8000 1.0000 1.5000 0.0000 Constraint 272 449 0.8000 1.0000 1.5000 0.0000 Constraint 272 442 0.8000 1.0000 1.5000 0.0000 Constraint 272 435 0.8000 1.0000 1.5000 0.0000 Constraint 272 429 0.8000 1.0000 1.5000 0.0000 Constraint 272 421 0.8000 1.0000 1.5000 0.0000 Constraint 272 412 0.8000 1.0000 1.5000 0.0000 Constraint 272 404 0.8000 1.0000 1.5000 0.0000 Constraint 272 399 0.8000 1.0000 1.5000 0.0000 Constraint 272 391 0.8000 1.0000 1.5000 0.0000 Constraint 272 382 0.8000 1.0000 1.5000 0.0000 Constraint 272 375 0.8000 1.0000 1.5000 0.0000 Constraint 272 368 0.8000 1.0000 1.5000 0.0000 Constraint 272 360 0.8000 1.0000 1.5000 0.0000 Constraint 272 355 0.8000 1.0000 1.5000 0.0000 Constraint 272 350 0.8000 1.0000 1.5000 0.0000 Constraint 272 341 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 720 0.8000 1.0000 1.5000 0.0000 Constraint 267 713 0.8000 1.0000 1.5000 0.0000 Constraint 267 706 0.8000 1.0000 1.5000 0.0000 Constraint 267 698 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 676 0.8000 1.0000 1.5000 0.0000 Constraint 267 668 0.8000 1.0000 1.5000 0.0000 Constraint 267 657 0.8000 1.0000 1.5000 0.0000 Constraint 267 651 0.8000 1.0000 1.5000 0.0000 Constraint 267 644 0.8000 1.0000 1.5000 0.0000 Constraint 267 636 0.8000 1.0000 1.5000 0.0000 Constraint 267 629 0.8000 1.0000 1.5000 0.0000 Constraint 267 622 0.8000 1.0000 1.5000 0.0000 Constraint 267 613 0.8000 1.0000 1.5000 0.0000 Constraint 267 604 0.8000 1.0000 1.5000 0.0000 Constraint 267 599 0.8000 1.0000 1.5000 0.0000 Constraint 267 590 0.8000 1.0000 1.5000 0.0000 Constraint 267 585 0.8000 1.0000 1.5000 0.0000 Constraint 267 577 0.8000 1.0000 1.5000 0.0000 Constraint 267 571 0.8000 1.0000 1.5000 0.0000 Constraint 267 557 0.8000 1.0000 1.5000 0.0000 Constraint 267 552 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 535 0.8000 1.0000 1.5000 0.0000 Constraint 267 527 0.8000 1.0000 1.5000 0.0000 Constraint 267 519 0.8000 1.0000 1.5000 0.0000 Constraint 267 511 0.8000 1.0000 1.5000 0.0000 Constraint 267 497 0.8000 1.0000 1.5000 0.0000 Constraint 267 489 0.8000 1.0000 1.5000 0.0000 Constraint 267 480 0.8000 1.0000 1.5000 0.0000 Constraint 267 473 0.8000 1.0000 1.5000 0.0000 Constraint 267 467 0.8000 1.0000 1.5000 0.0000 Constraint 267 461 0.8000 1.0000 1.5000 0.0000 Constraint 267 449 0.8000 1.0000 1.5000 0.0000 Constraint 267 442 0.8000 1.0000 1.5000 0.0000 Constraint 267 435 0.8000 1.0000 1.5000 0.0000 Constraint 267 429 0.8000 1.0000 1.5000 0.0000 Constraint 267 421 0.8000 1.0000 1.5000 0.0000 Constraint 267 412 0.8000 1.0000 1.5000 0.0000 Constraint 267 404 0.8000 1.0000 1.5000 0.0000 Constraint 267 399 0.8000 1.0000 1.5000 0.0000 Constraint 267 391 0.8000 1.0000 1.5000 0.0000 Constraint 267 382 0.8000 1.0000 1.5000 0.0000 Constraint 267 375 0.8000 1.0000 1.5000 0.0000 Constraint 267 368 0.8000 1.0000 1.5000 0.0000 Constraint 267 360 0.8000 1.0000 1.5000 0.0000 Constraint 267 355 0.8000 1.0000 1.5000 0.0000 Constraint 267 350 0.8000 1.0000 1.5000 0.0000 Constraint 267 341 0.8000 1.0000 1.5000 0.0000 Constraint 267 330 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 713 0.8000 1.0000 1.5000 0.0000 Constraint 259 706 0.8000 1.0000 1.5000 0.0000 Constraint 259 698 0.8000 1.0000 1.5000 0.0000 Constraint 259 687 0.8000 1.0000 1.5000 0.0000 Constraint 259 676 0.8000 1.0000 1.5000 0.0000 Constraint 259 668 0.8000 1.0000 1.5000 0.0000 Constraint 259 657 0.8000 1.0000 1.5000 0.0000 Constraint 259 651 0.8000 1.0000 1.5000 0.0000 Constraint 259 644 0.8000 1.0000 1.5000 0.0000 Constraint 259 636 0.8000 1.0000 1.5000 0.0000 Constraint 259 629 0.8000 1.0000 1.5000 0.0000 Constraint 259 622 0.8000 1.0000 1.5000 0.0000 Constraint 259 613 0.8000 1.0000 1.5000 0.0000 Constraint 259 604 0.8000 1.0000 1.5000 0.0000 Constraint 259 599 0.8000 1.0000 1.5000 0.0000 Constraint 259 590 0.8000 1.0000 1.5000 0.0000 Constraint 259 585 0.8000 1.0000 1.5000 0.0000 Constraint 259 577 0.8000 1.0000 1.5000 0.0000 Constraint 259 571 0.8000 1.0000 1.5000 0.0000 Constraint 259 557 0.8000 1.0000 1.5000 0.0000 Constraint 259 552 0.8000 1.0000 1.5000 0.0000 Constraint 259 544 0.8000 1.0000 1.5000 0.0000 Constraint 259 535 0.8000 1.0000 1.5000 0.0000 Constraint 259 527 0.8000 1.0000 1.5000 0.0000 Constraint 259 519 0.8000 1.0000 1.5000 0.0000 Constraint 259 511 0.8000 1.0000 1.5000 0.0000 Constraint 259 497 0.8000 1.0000 1.5000 0.0000 Constraint 259 489 0.8000 1.0000 1.5000 0.0000 Constraint 259 480 0.8000 1.0000 1.5000 0.0000 Constraint 259 473 0.8000 1.0000 1.5000 0.0000 Constraint 259 467 0.8000 1.0000 1.5000 0.0000 Constraint 259 461 0.8000 1.0000 1.5000 0.0000 Constraint 259 449 0.8000 1.0000 1.5000 0.0000 Constraint 259 442 0.8000 1.0000 1.5000 0.0000 Constraint 259 435 0.8000 1.0000 1.5000 0.0000 Constraint 259 429 0.8000 1.0000 1.5000 0.0000 Constraint 259 421 0.8000 1.0000 1.5000 0.0000 Constraint 259 412 0.8000 1.0000 1.5000 0.0000 Constraint 259 404 0.8000 1.0000 1.5000 0.0000 Constraint 259 399 0.8000 1.0000 1.5000 0.0000 Constraint 259 391 0.8000 1.0000 1.5000 0.0000 Constraint 259 382 0.8000 1.0000 1.5000 0.0000 Constraint 259 375 0.8000 1.0000 1.5000 0.0000 Constraint 259 368 0.8000 1.0000 1.5000 0.0000 Constraint 259 360 0.8000 1.0000 1.5000 0.0000 Constraint 259 355 0.8000 1.0000 1.5000 0.0000 Constraint 259 350 0.8000 1.0000 1.5000 0.0000 Constraint 259 341 0.8000 1.0000 1.5000 0.0000 Constraint 259 330 0.8000 1.0000 1.5000 0.0000 Constraint 259 322 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 698 0.8000 1.0000 1.5000 0.0000 Constraint 250 687 0.8000 1.0000 1.5000 0.0000 Constraint 250 676 0.8000 1.0000 1.5000 0.0000 Constraint 250 668 0.8000 1.0000 1.5000 0.0000 Constraint 250 657 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 644 0.8000 1.0000 1.5000 0.0000 Constraint 250 636 0.8000 1.0000 1.5000 0.0000 Constraint 250 629 0.8000 1.0000 1.5000 0.0000 Constraint 250 622 0.8000 1.0000 1.5000 0.0000 Constraint 250 613 0.8000 1.0000 1.5000 0.0000 Constraint 250 604 0.8000 1.0000 1.5000 0.0000 Constraint 250 599 0.8000 1.0000 1.5000 0.0000 Constraint 250 590 0.8000 1.0000 1.5000 0.0000 Constraint 250 585 0.8000 1.0000 1.5000 0.0000 Constraint 250 577 0.8000 1.0000 1.5000 0.0000 Constraint 250 571 0.8000 1.0000 1.5000 0.0000 Constraint 250 557 0.8000 1.0000 1.5000 0.0000 Constraint 250 552 0.8000 1.0000 1.5000 0.0000 Constraint 250 544 0.8000 1.0000 1.5000 0.0000 Constraint 250 535 0.8000 1.0000 1.5000 0.0000 Constraint 250 527 0.8000 1.0000 1.5000 0.0000 Constraint 250 519 0.8000 1.0000 1.5000 0.0000 Constraint 250 511 0.8000 1.0000 1.5000 0.0000 Constraint 250 497 0.8000 1.0000 1.5000 0.0000 Constraint 250 489 0.8000 1.0000 1.5000 0.0000 Constraint 250 480 0.8000 1.0000 1.5000 0.0000 Constraint 250 473 0.8000 1.0000 1.5000 0.0000 Constraint 250 467 0.8000 1.0000 1.5000 0.0000 Constraint 250 461 0.8000 1.0000 1.5000 0.0000 Constraint 250 449 0.8000 1.0000 1.5000 0.0000 Constraint 250 442 0.8000 1.0000 1.5000 0.0000 Constraint 250 435 0.8000 1.0000 1.5000 0.0000 Constraint 250 429 0.8000 1.0000 1.5000 0.0000 Constraint 250 421 0.8000 1.0000 1.5000 0.0000 Constraint 250 412 0.8000 1.0000 1.5000 0.0000 Constraint 250 404 0.8000 1.0000 1.5000 0.0000 Constraint 250 399 0.8000 1.0000 1.5000 0.0000 Constraint 250 391 0.8000 1.0000 1.5000 0.0000 Constraint 250 382 0.8000 1.0000 1.5000 0.0000 Constraint 250 375 0.8000 1.0000 1.5000 0.0000 Constraint 250 368 0.8000 1.0000 1.5000 0.0000 Constraint 250 360 0.8000 1.0000 1.5000 0.0000 Constraint 250 355 0.8000 1.0000 1.5000 0.0000 Constraint 250 350 0.8000 1.0000 1.5000 0.0000 Constraint 250 341 0.8000 1.0000 1.5000 0.0000 Constraint 250 330 0.8000 1.0000 1.5000 0.0000 Constraint 250 322 0.8000 1.0000 1.5000 0.0000 Constraint 250 314 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 742 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 713 0.8000 1.0000 1.5000 0.0000 Constraint 242 706 0.8000 1.0000 1.5000 0.0000 Constraint 242 698 0.8000 1.0000 1.5000 0.0000 Constraint 242 687 0.8000 1.0000 1.5000 0.0000 Constraint 242 676 0.8000 1.0000 1.5000 0.0000 Constraint 242 668 0.8000 1.0000 1.5000 0.0000 Constraint 242 657 0.8000 1.0000 1.5000 0.0000 Constraint 242 651 0.8000 1.0000 1.5000 0.0000 Constraint 242 644 0.8000 1.0000 1.5000 0.0000 Constraint 242 636 0.8000 1.0000 1.5000 0.0000 Constraint 242 629 0.8000 1.0000 1.5000 0.0000 Constraint 242 622 0.8000 1.0000 1.5000 0.0000 Constraint 242 613 0.8000 1.0000 1.5000 0.0000 Constraint 242 604 0.8000 1.0000 1.5000 0.0000 Constraint 242 590 0.8000 1.0000 1.5000 0.0000 Constraint 242 585 0.8000 1.0000 1.5000 0.0000 Constraint 242 577 0.8000 1.0000 1.5000 0.0000 Constraint 242 571 0.8000 1.0000 1.5000 0.0000 Constraint 242 557 0.8000 1.0000 1.5000 0.0000 Constraint 242 552 0.8000 1.0000 1.5000 0.0000 Constraint 242 544 0.8000 1.0000 1.5000 0.0000 Constraint 242 535 0.8000 1.0000 1.5000 0.0000 Constraint 242 527 0.8000 1.0000 1.5000 0.0000 Constraint 242 519 0.8000 1.0000 1.5000 0.0000 Constraint 242 511 0.8000 1.0000 1.5000 0.0000 Constraint 242 497 0.8000 1.0000 1.5000 0.0000 Constraint 242 489 0.8000 1.0000 1.5000 0.0000 Constraint 242 480 0.8000 1.0000 1.5000 0.0000 Constraint 242 473 0.8000 1.0000 1.5000 0.0000 Constraint 242 467 0.8000 1.0000 1.5000 0.0000 Constraint 242 461 0.8000 1.0000 1.5000 0.0000 Constraint 242 449 0.8000 1.0000 1.5000 0.0000 Constraint 242 435 0.8000 1.0000 1.5000 0.0000 Constraint 242 429 0.8000 1.0000 1.5000 0.0000 Constraint 242 421 0.8000 1.0000 1.5000 0.0000 Constraint 242 404 0.8000 1.0000 1.5000 0.0000 Constraint 242 399 0.8000 1.0000 1.5000 0.0000 Constraint 242 391 0.8000 1.0000 1.5000 0.0000 Constraint 242 382 0.8000 1.0000 1.5000 0.0000 Constraint 242 375 0.8000 1.0000 1.5000 0.0000 Constraint 242 368 0.8000 1.0000 1.5000 0.0000 Constraint 242 360 0.8000 1.0000 1.5000 0.0000 Constraint 242 355 0.8000 1.0000 1.5000 0.0000 Constraint 242 350 0.8000 1.0000 1.5000 0.0000 Constraint 242 341 0.8000 1.0000 1.5000 0.0000 Constraint 242 330 0.8000 1.0000 1.5000 0.0000 Constraint 242 322 0.8000 1.0000 1.5000 0.0000 Constraint 242 314 0.8000 1.0000 1.5000 0.0000 Constraint 242 303 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 742 0.8000 1.0000 1.5000 0.0000 Constraint 237 735 0.8000 1.0000 1.5000 0.0000 Constraint 237 729 0.8000 1.0000 1.5000 0.0000 Constraint 237 720 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 698 0.8000 1.0000 1.5000 0.0000 Constraint 237 687 0.8000 1.0000 1.5000 0.0000 Constraint 237 676 0.8000 1.0000 1.5000 0.0000 Constraint 237 668 0.8000 1.0000 1.5000 0.0000 Constraint 237 657 0.8000 1.0000 1.5000 0.0000 Constraint 237 651 0.8000 1.0000 1.5000 0.0000 Constraint 237 644 0.8000 1.0000 1.5000 0.0000 Constraint 237 636 0.8000 1.0000 1.5000 0.0000 Constraint 237 629 0.8000 1.0000 1.5000 0.0000 Constraint 237 622 0.8000 1.0000 1.5000 0.0000 Constraint 237 613 0.8000 1.0000 1.5000 0.0000 Constraint 237 604 0.8000 1.0000 1.5000 0.0000 Constraint 237 599 0.8000 1.0000 1.5000 0.0000 Constraint 237 590 0.8000 1.0000 1.5000 0.0000 Constraint 237 585 0.8000 1.0000 1.5000 0.0000 Constraint 237 577 0.8000 1.0000 1.5000 0.0000 Constraint 237 571 0.8000 1.0000 1.5000 0.0000 Constraint 237 557 0.8000 1.0000 1.5000 0.0000 Constraint 237 552 0.8000 1.0000 1.5000 0.0000 Constraint 237 544 0.8000 1.0000 1.5000 0.0000 Constraint 237 535 0.8000 1.0000 1.5000 0.0000 Constraint 237 527 0.8000 1.0000 1.5000 0.0000 Constraint 237 519 0.8000 1.0000 1.5000 0.0000 Constraint 237 511 0.8000 1.0000 1.5000 0.0000 Constraint 237 497 0.8000 1.0000 1.5000 0.0000 Constraint 237 489 0.8000 1.0000 1.5000 0.0000 Constraint 237 480 0.8000 1.0000 1.5000 0.0000 Constraint 237 473 0.8000 1.0000 1.5000 0.0000 Constraint 237 467 0.8000 1.0000 1.5000 0.0000 Constraint 237 461 0.8000 1.0000 1.5000 0.0000 Constraint 237 449 0.8000 1.0000 1.5000 0.0000 Constraint 237 435 0.8000 1.0000 1.5000 0.0000 Constraint 237 429 0.8000 1.0000 1.5000 0.0000 Constraint 237 421 0.8000 1.0000 1.5000 0.0000 Constraint 237 412 0.8000 1.0000 1.5000 0.0000 Constraint 237 404 0.8000 1.0000 1.5000 0.0000 Constraint 237 399 0.8000 1.0000 1.5000 0.0000 Constraint 237 391 0.8000 1.0000 1.5000 0.0000 Constraint 237 382 0.8000 1.0000 1.5000 0.0000 Constraint 237 375 0.8000 1.0000 1.5000 0.0000 Constraint 237 368 0.8000 1.0000 1.5000 0.0000 Constraint 237 360 0.8000 1.0000 1.5000 0.0000 Constraint 237 355 0.8000 1.0000 1.5000 0.0000 Constraint 237 350 0.8000 1.0000 1.5000 0.0000 Constraint 237 341 0.8000 1.0000 1.5000 0.0000 Constraint 237 330 0.8000 1.0000 1.5000 0.0000 Constraint 237 322 0.8000 1.0000 1.5000 0.0000 Constraint 237 314 0.8000 1.0000 1.5000 0.0000 Constraint 237 303 0.8000 1.0000 1.5000 0.0000 Constraint 237 297 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 742 0.8000 1.0000 1.5000 0.0000 Constraint 226 735 0.8000 1.0000 1.5000 0.0000 Constraint 226 729 0.8000 1.0000 1.5000 0.0000 Constraint 226 720 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 706 0.8000 1.0000 1.5000 0.0000 Constraint 226 698 0.8000 1.0000 1.5000 0.0000 Constraint 226 687 0.8000 1.0000 1.5000 0.0000 Constraint 226 676 0.8000 1.0000 1.5000 0.0000 Constraint 226 668 0.8000 1.0000 1.5000 0.0000 Constraint 226 657 0.8000 1.0000 1.5000 0.0000 Constraint 226 651 0.8000 1.0000 1.5000 0.0000 Constraint 226 644 0.8000 1.0000 1.5000 0.0000 Constraint 226 636 0.8000 1.0000 1.5000 0.0000 Constraint 226 629 0.8000 1.0000 1.5000 0.0000 Constraint 226 622 0.8000 1.0000 1.5000 0.0000 Constraint 226 613 0.8000 1.0000 1.5000 0.0000 Constraint 226 604 0.8000 1.0000 1.5000 0.0000 Constraint 226 599 0.8000 1.0000 1.5000 0.0000 Constraint 226 590 0.8000 1.0000 1.5000 0.0000 Constraint 226 585 0.8000 1.0000 1.5000 0.0000 Constraint 226 577 0.8000 1.0000 1.5000 0.0000 Constraint 226 571 0.8000 1.0000 1.5000 0.0000 Constraint 226 557 0.8000 1.0000 1.5000 0.0000 Constraint 226 552 0.8000 1.0000 1.5000 0.0000 Constraint 226 544 0.8000 1.0000 1.5000 0.0000 Constraint 226 535 0.8000 1.0000 1.5000 0.0000 Constraint 226 527 0.8000 1.0000 1.5000 0.0000 Constraint 226 519 0.8000 1.0000 1.5000 0.0000 Constraint 226 511 0.8000 1.0000 1.5000 0.0000 Constraint 226 497 0.8000 1.0000 1.5000 0.0000 Constraint 226 489 0.8000 1.0000 1.5000 0.0000 Constraint 226 480 0.8000 1.0000 1.5000 0.0000 Constraint 226 473 0.8000 1.0000 1.5000 0.0000 Constraint 226 467 0.8000 1.0000 1.5000 0.0000 Constraint 226 461 0.8000 1.0000 1.5000 0.0000 Constraint 226 449 0.8000 1.0000 1.5000 0.0000 Constraint 226 442 0.8000 1.0000 1.5000 0.0000 Constraint 226 435 0.8000 1.0000 1.5000 0.0000 Constraint 226 429 0.8000 1.0000 1.5000 0.0000 Constraint 226 421 0.8000 1.0000 1.5000 0.0000 Constraint 226 412 0.8000 1.0000 1.5000 0.0000 Constraint 226 404 0.8000 1.0000 1.5000 0.0000 Constraint 226 399 0.8000 1.0000 1.5000 0.0000 Constraint 226 391 0.8000 1.0000 1.5000 0.0000 Constraint 226 382 0.8000 1.0000 1.5000 0.0000 Constraint 226 375 0.8000 1.0000 1.5000 0.0000 Constraint 226 368 0.8000 1.0000 1.5000 0.0000 Constraint 226 360 0.8000 1.0000 1.5000 0.0000 Constraint 226 355 0.8000 1.0000 1.5000 0.0000 Constraint 226 350 0.8000 1.0000 1.5000 0.0000 Constraint 226 341 0.8000 1.0000 1.5000 0.0000 Constraint 226 330 0.8000 1.0000 1.5000 0.0000 Constraint 226 322 0.8000 1.0000 1.5000 0.0000 Constraint 226 314 0.8000 1.0000 1.5000 0.0000 Constraint 226 303 0.8000 1.0000 1.5000 0.0000 Constraint 226 297 0.8000 1.0000 1.5000 0.0000 Constraint 226 292 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 742 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 729 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 713 0.8000 1.0000 1.5000 0.0000 Constraint 221 706 0.8000 1.0000 1.5000 0.0000 Constraint 221 698 0.8000 1.0000 1.5000 0.0000 Constraint 221 687 0.8000 1.0000 1.5000 0.0000 Constraint 221 676 0.8000 1.0000 1.5000 0.0000 Constraint 221 668 0.8000 1.0000 1.5000 0.0000 Constraint 221 657 0.8000 1.0000 1.5000 0.0000 Constraint 221 651 0.8000 1.0000 1.5000 0.0000 Constraint 221 644 0.8000 1.0000 1.5000 0.0000 Constraint 221 636 0.8000 1.0000 1.5000 0.0000 Constraint 221 629 0.8000 1.0000 1.5000 0.0000 Constraint 221 622 0.8000 1.0000 1.5000 0.0000 Constraint 221 613 0.8000 1.0000 1.5000 0.0000 Constraint 221 604 0.8000 1.0000 1.5000 0.0000 Constraint 221 599 0.8000 1.0000 1.5000 0.0000 Constraint 221 590 0.8000 1.0000 1.5000 0.0000 Constraint 221 585 0.8000 1.0000 1.5000 0.0000 Constraint 221 577 0.8000 1.0000 1.5000 0.0000 Constraint 221 571 0.8000 1.0000 1.5000 0.0000 Constraint 221 557 0.8000 1.0000 1.5000 0.0000 Constraint 221 552 0.8000 1.0000 1.5000 0.0000 Constraint 221 544 0.8000 1.0000 1.5000 0.0000 Constraint 221 535 0.8000 1.0000 1.5000 0.0000 Constraint 221 527 0.8000 1.0000 1.5000 0.0000 Constraint 221 519 0.8000 1.0000 1.5000 0.0000 Constraint 221 511 0.8000 1.0000 1.5000 0.0000 Constraint 221 497 0.8000 1.0000 1.5000 0.0000 Constraint 221 489 0.8000 1.0000 1.5000 0.0000 Constraint 221 480 0.8000 1.0000 1.5000 0.0000 Constraint 221 473 0.8000 1.0000 1.5000 0.0000 Constraint 221 467 0.8000 1.0000 1.5000 0.0000 Constraint 221 461 0.8000 1.0000 1.5000 0.0000 Constraint 221 449 0.8000 1.0000 1.5000 0.0000 Constraint 221 442 0.8000 1.0000 1.5000 0.0000 Constraint 221 435 0.8000 1.0000 1.5000 0.0000 Constraint 221 429 0.8000 1.0000 1.5000 0.0000 Constraint 221 421 0.8000 1.0000 1.5000 0.0000 Constraint 221 412 0.8000 1.0000 1.5000 0.0000 Constraint 221 404 0.8000 1.0000 1.5000 0.0000 Constraint 221 399 0.8000 1.0000 1.5000 0.0000 Constraint 221 391 0.8000 1.0000 1.5000 0.0000 Constraint 221 382 0.8000 1.0000 1.5000 0.0000 Constraint 221 375 0.8000 1.0000 1.5000 0.0000 Constraint 221 368 0.8000 1.0000 1.5000 0.0000 Constraint 221 360 0.8000 1.0000 1.5000 0.0000 Constraint 221 355 0.8000 1.0000 1.5000 0.0000 Constraint 221 350 0.8000 1.0000 1.5000 0.0000 Constraint 221 341 0.8000 1.0000 1.5000 0.0000 Constraint 221 330 0.8000 1.0000 1.5000 0.0000 Constraint 221 322 0.8000 1.0000 1.5000 0.0000 Constraint 221 314 0.8000 1.0000 1.5000 0.0000 Constraint 221 303 0.8000 1.0000 1.5000 0.0000 Constraint 221 297 0.8000 1.0000 1.5000 0.0000 Constraint 221 285 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 742 0.8000 1.0000 1.5000 0.0000 Constraint 210 735 0.8000 1.0000 1.5000 0.0000 Constraint 210 729 0.8000 1.0000 1.5000 0.0000 Constraint 210 720 0.8000 1.0000 1.5000 0.0000 Constraint 210 713 0.8000 1.0000 1.5000 0.0000 Constraint 210 706 0.8000 1.0000 1.5000 0.0000 Constraint 210 698 0.8000 1.0000 1.5000 0.0000 Constraint 210 687 0.8000 1.0000 1.5000 0.0000 Constraint 210 676 0.8000 1.0000 1.5000 0.0000 Constraint 210 668 0.8000 1.0000 1.5000 0.0000 Constraint 210 657 0.8000 1.0000 1.5000 0.0000 Constraint 210 651 0.8000 1.0000 1.5000 0.0000 Constraint 210 644 0.8000 1.0000 1.5000 0.0000 Constraint 210 636 0.8000 1.0000 1.5000 0.0000 Constraint 210 629 0.8000 1.0000 1.5000 0.0000 Constraint 210 622 0.8000 1.0000 1.5000 0.0000 Constraint 210 613 0.8000 1.0000 1.5000 0.0000 Constraint 210 604 0.8000 1.0000 1.5000 0.0000 Constraint 210 599 0.8000 1.0000 1.5000 0.0000 Constraint 210 590 0.8000 1.0000 1.5000 0.0000 Constraint 210 585 0.8000 1.0000 1.5000 0.0000 Constraint 210 577 0.8000 1.0000 1.5000 0.0000 Constraint 210 571 0.8000 1.0000 1.5000 0.0000 Constraint 210 557 0.8000 1.0000 1.5000 0.0000 Constraint 210 552 0.8000 1.0000 1.5000 0.0000 Constraint 210 544 0.8000 1.0000 1.5000 0.0000 Constraint 210 535 0.8000 1.0000 1.5000 0.0000 Constraint 210 527 0.8000 1.0000 1.5000 0.0000 Constraint 210 519 0.8000 1.0000 1.5000 0.0000 Constraint 210 511 0.8000 1.0000 1.5000 0.0000 Constraint 210 497 0.8000 1.0000 1.5000 0.0000 Constraint 210 489 0.8000 1.0000 1.5000 0.0000 Constraint 210 480 0.8000 1.0000 1.5000 0.0000 Constraint 210 473 0.8000 1.0000 1.5000 0.0000 Constraint 210 467 0.8000 1.0000 1.5000 0.0000 Constraint 210 461 0.8000 1.0000 1.5000 0.0000 Constraint 210 449 0.8000 1.0000 1.5000 0.0000 Constraint 210 435 0.8000 1.0000 1.5000 0.0000 Constraint 210 429 0.8000 1.0000 1.5000 0.0000 Constraint 210 421 0.8000 1.0000 1.5000 0.0000 Constraint 210 412 0.8000 1.0000 1.5000 0.0000 Constraint 210 404 0.8000 1.0000 1.5000 0.0000 Constraint 210 399 0.8000 1.0000 1.5000 0.0000 Constraint 210 391 0.8000 1.0000 1.5000 0.0000 Constraint 210 382 0.8000 1.0000 1.5000 0.0000 Constraint 210 375 0.8000 1.0000 1.5000 0.0000 Constraint 210 368 0.8000 1.0000 1.5000 0.0000 Constraint 210 360 0.8000 1.0000 1.5000 0.0000 Constraint 210 355 0.8000 1.0000 1.5000 0.0000 Constraint 210 350 0.8000 1.0000 1.5000 0.0000 Constraint 210 341 0.8000 1.0000 1.5000 0.0000 Constraint 210 330 0.8000 1.0000 1.5000 0.0000 Constraint 210 322 0.8000 1.0000 1.5000 0.0000 Constraint 210 314 0.8000 1.0000 1.5000 0.0000 Constraint 210 303 0.8000 1.0000 1.5000 0.0000 Constraint 210 297 0.8000 1.0000 1.5000 0.0000 Constraint 210 292 0.8000 1.0000 1.5000 0.0000 Constraint 210 285 0.8000 1.0000 1.5000 0.0000 Constraint 210 279 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 742 0.8000 1.0000 1.5000 0.0000 Constraint 201 735 0.8000 1.0000 1.5000 0.0000 Constraint 201 729 0.8000 1.0000 1.5000 0.0000 Constraint 201 720 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 706 0.8000 1.0000 1.5000 0.0000 Constraint 201 698 0.8000 1.0000 1.5000 0.0000 Constraint 201 687 0.8000 1.0000 1.5000 0.0000 Constraint 201 676 0.8000 1.0000 1.5000 0.0000 Constraint 201 668 0.8000 1.0000 1.5000 0.0000 Constraint 201 657 0.8000 1.0000 1.5000 0.0000 Constraint 201 651 0.8000 1.0000 1.5000 0.0000 Constraint 201 644 0.8000 1.0000 1.5000 0.0000 Constraint 201 636 0.8000 1.0000 1.5000 0.0000 Constraint 201 629 0.8000 1.0000 1.5000 0.0000 Constraint 201 622 0.8000 1.0000 1.5000 0.0000 Constraint 201 613 0.8000 1.0000 1.5000 0.0000 Constraint 201 604 0.8000 1.0000 1.5000 0.0000 Constraint 201 599 0.8000 1.0000 1.5000 0.0000 Constraint 201 590 0.8000 1.0000 1.5000 0.0000 Constraint 201 585 0.8000 1.0000 1.5000 0.0000 Constraint 201 577 0.8000 1.0000 1.5000 0.0000 Constraint 201 571 0.8000 1.0000 1.5000 0.0000 Constraint 201 557 0.8000 1.0000 1.5000 0.0000 Constraint 201 552 0.8000 1.0000 1.5000 0.0000 Constraint 201 544 0.8000 1.0000 1.5000 0.0000 Constraint 201 535 0.8000 1.0000 1.5000 0.0000 Constraint 201 527 0.8000 1.0000 1.5000 0.0000 Constraint 201 519 0.8000 1.0000 1.5000 0.0000 Constraint 201 511 0.8000 1.0000 1.5000 0.0000 Constraint 201 497 0.8000 1.0000 1.5000 0.0000 Constraint 201 489 0.8000 1.0000 1.5000 0.0000 Constraint 201 480 0.8000 1.0000 1.5000 0.0000 Constraint 201 473 0.8000 1.0000 1.5000 0.0000 Constraint 201 467 0.8000 1.0000 1.5000 0.0000 Constraint 201 461 0.8000 1.0000 1.5000 0.0000 Constraint 201 449 0.8000 1.0000 1.5000 0.0000 Constraint 201 442 0.8000 1.0000 1.5000 0.0000 Constraint 201 435 0.8000 1.0000 1.5000 0.0000 Constraint 201 429 0.8000 1.0000 1.5000 0.0000 Constraint 201 421 0.8000 1.0000 1.5000 0.0000 Constraint 201 412 0.8000 1.0000 1.5000 0.0000 Constraint 201 404 0.8000 1.0000 1.5000 0.0000 Constraint 201 399 0.8000 1.0000 1.5000 0.0000 Constraint 201 391 0.8000 1.0000 1.5000 0.0000 Constraint 201 382 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 368 0.8000 1.0000 1.5000 0.0000 Constraint 201 360 0.8000 1.0000 1.5000 0.0000 Constraint 201 355 0.8000 1.0000 1.5000 0.0000 Constraint 201 350 0.8000 1.0000 1.5000 0.0000 Constraint 201 341 0.8000 1.0000 1.5000 0.0000 Constraint 201 330 0.8000 1.0000 1.5000 0.0000 Constraint 201 322 0.8000 1.0000 1.5000 0.0000 Constraint 201 314 0.8000 1.0000 1.5000 0.0000 Constraint 201 303 0.8000 1.0000 1.5000 0.0000 Constraint 201 297 0.8000 1.0000 1.5000 0.0000 Constraint 201 292 0.8000 1.0000 1.5000 0.0000 Constraint 201 285 0.8000 1.0000 1.5000 0.0000 Constraint 201 279 0.8000 1.0000 1.5000 0.0000 Constraint 201 272 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 742 0.8000 1.0000 1.5000 0.0000 Constraint 190 735 0.8000 1.0000 1.5000 0.0000 Constraint 190 729 0.8000 1.0000 1.5000 0.0000 Constraint 190 720 0.8000 1.0000 1.5000 0.0000 Constraint 190 713 0.8000 1.0000 1.5000 0.0000 Constraint 190 706 0.8000 1.0000 1.5000 0.0000 Constraint 190 698 0.8000 1.0000 1.5000 0.0000 Constraint 190 687 0.8000 1.0000 1.5000 0.0000 Constraint 190 676 0.8000 1.0000 1.5000 0.0000 Constraint 190 668 0.8000 1.0000 1.5000 0.0000 Constraint 190 657 0.8000 1.0000 1.5000 0.0000 Constraint 190 651 0.8000 1.0000 1.5000 0.0000 Constraint 190 644 0.8000 1.0000 1.5000 0.0000 Constraint 190 636 0.8000 1.0000 1.5000 0.0000 Constraint 190 629 0.8000 1.0000 1.5000 0.0000 Constraint 190 622 0.8000 1.0000 1.5000 0.0000 Constraint 190 613 0.8000 1.0000 1.5000 0.0000 Constraint 190 604 0.8000 1.0000 1.5000 0.0000 Constraint 190 599 0.8000 1.0000 1.5000 0.0000 Constraint 190 590 0.8000 1.0000 1.5000 0.0000 Constraint 190 585 0.8000 1.0000 1.5000 0.0000 Constraint 190 577 0.8000 1.0000 1.5000 0.0000 Constraint 190 571 0.8000 1.0000 1.5000 0.0000 Constraint 190 557 0.8000 1.0000 1.5000 0.0000 Constraint 190 552 0.8000 1.0000 1.5000 0.0000 Constraint 190 544 0.8000 1.0000 1.5000 0.0000 Constraint 190 535 0.8000 1.0000 1.5000 0.0000 Constraint 190 527 0.8000 1.0000 1.5000 0.0000 Constraint 190 519 0.8000 1.0000 1.5000 0.0000 Constraint 190 511 0.8000 1.0000 1.5000 0.0000 Constraint 190 497 0.8000 1.0000 1.5000 0.0000 Constraint 190 489 0.8000 1.0000 1.5000 0.0000 Constraint 190 480 0.8000 1.0000 1.5000 0.0000 Constraint 190 473 0.8000 1.0000 1.5000 0.0000 Constraint 190 467 0.8000 1.0000 1.5000 0.0000 Constraint 190 461 0.8000 1.0000 1.5000 0.0000 Constraint 190 449 0.8000 1.0000 1.5000 0.0000 Constraint 190 442 0.8000 1.0000 1.5000 0.0000 Constraint 190 435 0.8000 1.0000 1.5000 0.0000 Constraint 190 429 0.8000 1.0000 1.5000 0.0000 Constraint 190 421 0.8000 1.0000 1.5000 0.0000 Constraint 190 412 0.8000 1.0000 1.5000 0.0000 Constraint 190 404 0.8000 1.0000 1.5000 0.0000 Constraint 190 399 0.8000 1.0000 1.5000 0.0000 Constraint 190 391 0.8000 1.0000 1.5000 0.0000 Constraint 190 382 0.8000 1.0000 1.5000 0.0000 Constraint 190 375 0.8000 1.0000 1.5000 0.0000 Constraint 190 368 0.8000 1.0000 1.5000 0.0000 Constraint 190 360 0.8000 1.0000 1.5000 0.0000 Constraint 190 355 0.8000 1.0000 1.5000 0.0000 Constraint 190 350 0.8000 1.0000 1.5000 0.0000 Constraint 190 341 0.8000 1.0000 1.5000 0.0000 Constraint 190 330 0.8000 1.0000 1.5000 0.0000 Constraint 190 322 0.8000 1.0000 1.5000 0.0000 Constraint 190 314 0.8000 1.0000 1.5000 0.0000 Constraint 190 303 0.8000 1.0000 1.5000 0.0000 Constraint 190 297 0.8000 1.0000 1.5000 0.0000 Constraint 190 292 0.8000 1.0000 1.5000 0.0000 Constraint 190 285 0.8000 1.0000 1.5000 0.0000 Constraint 190 279 0.8000 1.0000 1.5000 0.0000 Constraint 190 272 0.8000 1.0000 1.5000 0.0000 Constraint 190 267 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 742 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 720 0.8000 1.0000 1.5000 0.0000 Constraint 182 713 0.8000 1.0000 1.5000 0.0000 Constraint 182 706 0.8000 1.0000 1.5000 0.0000 Constraint 182 698 0.8000 1.0000 1.5000 0.0000 Constraint 182 687 0.8000 1.0000 1.5000 0.0000 Constraint 182 676 0.8000 1.0000 1.5000 0.0000 Constraint 182 668 0.8000 1.0000 1.5000 0.0000 Constraint 182 657 0.8000 1.0000 1.5000 0.0000 Constraint 182 651 0.8000 1.0000 1.5000 0.0000 Constraint 182 644 0.8000 1.0000 1.5000 0.0000 Constraint 182 636 0.8000 1.0000 1.5000 0.0000 Constraint 182 629 0.8000 1.0000 1.5000 0.0000 Constraint 182 622 0.8000 1.0000 1.5000 0.0000 Constraint 182 613 0.8000 1.0000 1.5000 0.0000 Constraint 182 604 0.8000 1.0000 1.5000 0.0000 Constraint 182 599 0.8000 1.0000 1.5000 0.0000 Constraint 182 590 0.8000 1.0000 1.5000 0.0000 Constraint 182 585 0.8000 1.0000 1.5000 0.0000 Constraint 182 577 0.8000 1.0000 1.5000 0.0000 Constraint 182 571 0.8000 1.0000 1.5000 0.0000 Constraint 182 557 0.8000 1.0000 1.5000 0.0000 Constraint 182 552 0.8000 1.0000 1.5000 0.0000 Constraint 182 544 0.8000 1.0000 1.5000 0.0000 Constraint 182 535 0.8000 1.0000 1.5000 0.0000 Constraint 182 527 0.8000 1.0000 1.5000 0.0000 Constraint 182 519 0.8000 1.0000 1.5000 0.0000 Constraint 182 511 0.8000 1.0000 1.5000 0.0000 Constraint 182 497 0.8000 1.0000 1.5000 0.0000 Constraint 182 489 0.8000 1.0000 1.5000 0.0000 Constraint 182 480 0.8000 1.0000 1.5000 0.0000 Constraint 182 473 0.8000 1.0000 1.5000 0.0000 Constraint 182 467 0.8000 1.0000 1.5000 0.0000 Constraint 182 461 0.8000 1.0000 1.5000 0.0000 Constraint 182 449 0.8000 1.0000 1.5000 0.0000 Constraint 182 442 0.8000 1.0000 1.5000 0.0000 Constraint 182 435 0.8000 1.0000 1.5000 0.0000 Constraint 182 429 0.8000 1.0000 1.5000 0.0000 Constraint 182 421 0.8000 1.0000 1.5000 0.0000 Constraint 182 412 0.8000 1.0000 1.5000 0.0000 Constraint 182 404 0.8000 1.0000 1.5000 0.0000 Constraint 182 399 0.8000 1.0000 1.5000 0.0000 Constraint 182 391 0.8000 1.0000 1.5000 0.0000 Constraint 182 382 0.8000 1.0000 1.5000 0.0000 Constraint 182 375 0.8000 1.0000 1.5000 0.0000 Constraint 182 368 0.8000 1.0000 1.5000 0.0000 Constraint 182 360 0.8000 1.0000 1.5000 0.0000 Constraint 182 355 0.8000 1.0000 1.5000 0.0000 Constraint 182 350 0.8000 1.0000 1.5000 0.0000 Constraint 182 341 0.8000 1.0000 1.5000 0.0000 Constraint 182 330 0.8000 1.0000 1.5000 0.0000 Constraint 182 322 0.8000 1.0000 1.5000 0.0000 Constraint 182 314 0.8000 1.0000 1.5000 0.0000 Constraint 182 303 0.8000 1.0000 1.5000 0.0000 Constraint 182 297 0.8000 1.0000 1.5000 0.0000 Constraint 182 292 0.8000 1.0000 1.5000 0.0000 Constraint 182 285 0.8000 1.0000 1.5000 0.0000 Constraint 182 279 0.8000 1.0000 1.5000 0.0000 Constraint 182 267 0.8000 1.0000 1.5000 0.0000 Constraint 182 259 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 742 0.8000 1.0000 1.5000 0.0000 Constraint 176 735 0.8000 1.0000 1.5000 0.0000 Constraint 176 729 0.8000 1.0000 1.5000 0.0000 Constraint 176 720 0.8000 1.0000 1.5000 0.0000 Constraint 176 713 0.8000 1.0000 1.5000 0.0000 Constraint 176 706 0.8000 1.0000 1.5000 0.0000 Constraint 176 698 0.8000 1.0000 1.5000 0.0000 Constraint 176 687 0.8000 1.0000 1.5000 0.0000 Constraint 176 676 0.8000 1.0000 1.5000 0.0000 Constraint 176 668 0.8000 1.0000 1.5000 0.0000 Constraint 176 657 0.8000 1.0000 1.5000 0.0000 Constraint 176 651 0.8000 1.0000 1.5000 0.0000 Constraint 176 644 0.8000 1.0000 1.5000 0.0000 Constraint 176 636 0.8000 1.0000 1.5000 0.0000 Constraint 176 629 0.8000 1.0000 1.5000 0.0000 Constraint 176 622 0.8000 1.0000 1.5000 0.0000 Constraint 176 613 0.8000 1.0000 1.5000 0.0000 Constraint 176 604 0.8000 1.0000 1.5000 0.0000 Constraint 176 599 0.8000 1.0000 1.5000 0.0000 Constraint 176 590 0.8000 1.0000 1.5000 0.0000 Constraint 176 585 0.8000 1.0000 1.5000 0.0000 Constraint 176 577 0.8000 1.0000 1.5000 0.0000 Constraint 176 571 0.8000 1.0000 1.5000 0.0000 Constraint 176 557 0.8000 1.0000 1.5000 0.0000 Constraint 176 552 0.8000 1.0000 1.5000 0.0000 Constraint 176 544 0.8000 1.0000 1.5000 0.0000 Constraint 176 535 0.8000 1.0000 1.5000 0.0000 Constraint 176 527 0.8000 1.0000 1.5000 0.0000 Constraint 176 519 0.8000 1.0000 1.5000 0.0000 Constraint 176 511 0.8000 1.0000 1.5000 0.0000 Constraint 176 497 0.8000 1.0000 1.5000 0.0000 Constraint 176 489 0.8000 1.0000 1.5000 0.0000 Constraint 176 480 0.8000 1.0000 1.5000 0.0000 Constraint 176 473 0.8000 1.0000 1.5000 0.0000 Constraint 176 467 0.8000 1.0000 1.5000 0.0000 Constraint 176 461 0.8000 1.0000 1.5000 0.0000 Constraint 176 449 0.8000 1.0000 1.5000 0.0000 Constraint 176 442 0.8000 1.0000 1.5000 0.0000 Constraint 176 435 0.8000 1.0000 1.5000 0.0000 Constraint 176 429 0.8000 1.0000 1.5000 0.0000 Constraint 176 421 0.8000 1.0000 1.5000 0.0000 Constraint 176 412 0.8000 1.0000 1.5000 0.0000 Constraint 176 404 0.8000 1.0000 1.5000 0.0000 Constraint 176 399 0.8000 1.0000 1.5000 0.0000 Constraint 176 391 0.8000 1.0000 1.5000 0.0000 Constraint 176 382 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 368 0.8000 1.0000 1.5000 0.0000 Constraint 176 360 0.8000 1.0000 1.5000 0.0000 Constraint 176 355 0.8000 1.0000 1.5000 0.0000 Constraint 176 350 0.8000 1.0000 1.5000 0.0000 Constraint 176 341 0.8000 1.0000 1.5000 0.0000 Constraint 176 330 0.8000 1.0000 1.5000 0.0000 Constraint 176 322 0.8000 1.0000 1.5000 0.0000 Constraint 176 314 0.8000 1.0000 1.5000 0.0000 Constraint 176 303 0.8000 1.0000 1.5000 0.0000 Constraint 176 297 0.8000 1.0000 1.5000 0.0000 Constraint 176 292 0.8000 1.0000 1.5000 0.0000 Constraint 176 285 0.8000 1.0000 1.5000 0.0000 Constraint 176 279 0.8000 1.0000 1.5000 0.0000 Constraint 176 272 0.8000 1.0000 1.5000 0.0000 Constraint 176 267 0.8000 1.0000 1.5000 0.0000 Constraint 176 259 0.8000 1.0000 1.5000 0.0000 Constraint 176 250 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 742 0.8000 1.0000 1.5000 0.0000 Constraint 169 735 0.8000 1.0000 1.5000 0.0000 Constraint 169 729 0.8000 1.0000 1.5000 0.0000 Constraint 169 720 0.8000 1.0000 1.5000 0.0000 Constraint 169 713 0.8000 1.0000 1.5000 0.0000 Constraint 169 706 0.8000 1.0000 1.5000 0.0000 Constraint 169 698 0.8000 1.0000 1.5000 0.0000 Constraint 169 687 0.8000 1.0000 1.5000 0.0000 Constraint 169 676 0.8000 1.0000 1.5000 0.0000 Constraint 169 668 0.8000 1.0000 1.5000 0.0000 Constraint 169 657 0.8000 1.0000 1.5000 0.0000 Constraint 169 651 0.8000 1.0000 1.5000 0.0000 Constraint 169 644 0.8000 1.0000 1.5000 0.0000 Constraint 169 636 0.8000 1.0000 1.5000 0.0000 Constraint 169 629 0.8000 1.0000 1.5000 0.0000 Constraint 169 622 0.8000 1.0000 1.5000 0.0000 Constraint 169 613 0.8000 1.0000 1.5000 0.0000 Constraint 169 604 0.8000 1.0000 1.5000 0.0000 Constraint 169 599 0.8000 1.0000 1.5000 0.0000 Constraint 169 590 0.8000 1.0000 1.5000 0.0000 Constraint 169 585 0.8000 1.0000 1.5000 0.0000 Constraint 169 577 0.8000 1.0000 1.5000 0.0000 Constraint 169 571 0.8000 1.0000 1.5000 0.0000 Constraint 169 557 0.8000 1.0000 1.5000 0.0000 Constraint 169 552 0.8000 1.0000 1.5000 0.0000 Constraint 169 544 0.8000 1.0000 1.5000 0.0000 Constraint 169 535 0.8000 1.0000 1.5000 0.0000 Constraint 169 527 0.8000 1.0000 1.5000 0.0000 Constraint 169 519 0.8000 1.0000 1.5000 0.0000 Constraint 169 511 0.8000 1.0000 1.5000 0.0000 Constraint 169 497 0.8000 1.0000 1.5000 0.0000 Constraint 169 489 0.8000 1.0000 1.5000 0.0000 Constraint 169 480 0.8000 1.0000 1.5000 0.0000 Constraint 169 473 0.8000 1.0000 1.5000 0.0000 Constraint 169 467 0.8000 1.0000 1.5000 0.0000 Constraint 169 461 0.8000 1.0000 1.5000 0.0000 Constraint 169 449 0.8000 1.0000 1.5000 0.0000 Constraint 169 442 0.8000 1.0000 1.5000 0.0000 Constraint 169 435 0.8000 1.0000 1.5000 0.0000 Constraint 169 429 0.8000 1.0000 1.5000 0.0000 Constraint 169 421 0.8000 1.0000 1.5000 0.0000 Constraint 169 412 0.8000 1.0000 1.5000 0.0000 Constraint 169 404 0.8000 1.0000 1.5000 0.0000 Constraint 169 399 0.8000 1.0000 1.5000 0.0000 Constraint 169 391 0.8000 1.0000 1.5000 0.0000 Constraint 169 382 0.8000 1.0000 1.5000 0.0000 Constraint 169 375 0.8000 1.0000 1.5000 0.0000 Constraint 169 368 0.8000 1.0000 1.5000 0.0000 Constraint 169 360 0.8000 1.0000 1.5000 0.0000 Constraint 169 355 0.8000 1.0000 1.5000 0.0000 Constraint 169 350 0.8000 1.0000 1.5000 0.0000 Constraint 169 341 0.8000 1.0000 1.5000 0.0000 Constraint 169 330 0.8000 1.0000 1.5000 0.0000 Constraint 169 322 0.8000 1.0000 1.5000 0.0000 Constraint 169 314 0.8000 1.0000 1.5000 0.0000 Constraint 169 303 0.8000 1.0000 1.5000 0.0000 Constraint 169 297 0.8000 1.0000 1.5000 0.0000 Constraint 169 292 0.8000 1.0000 1.5000 0.0000 Constraint 169 285 0.8000 1.0000 1.5000 0.0000 Constraint 169 279 0.8000 1.0000 1.5000 0.0000 Constraint 169 272 0.8000 1.0000 1.5000 0.0000 Constraint 169 267 0.8000 1.0000 1.5000 0.0000 Constraint 169 259 0.8000 1.0000 1.5000 0.0000 Constraint 169 250 0.8000 1.0000 1.5000 0.0000 Constraint 169 242 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 742 0.8000 1.0000 1.5000 0.0000 Constraint 161 735 0.8000 1.0000 1.5000 0.0000 Constraint 161 729 0.8000 1.0000 1.5000 0.0000 Constraint 161 720 0.8000 1.0000 1.5000 0.0000 Constraint 161 713 0.8000 1.0000 1.5000 0.0000 Constraint 161 706 0.8000 1.0000 1.5000 0.0000 Constraint 161 698 0.8000 1.0000 1.5000 0.0000 Constraint 161 687 0.8000 1.0000 1.5000 0.0000 Constraint 161 676 0.8000 1.0000 1.5000 0.0000 Constraint 161 668 0.8000 1.0000 1.5000 0.0000 Constraint 161 657 0.8000 1.0000 1.5000 0.0000 Constraint 161 651 0.8000 1.0000 1.5000 0.0000 Constraint 161 644 0.8000 1.0000 1.5000 0.0000 Constraint 161 636 0.8000 1.0000 1.5000 0.0000 Constraint 161 629 0.8000 1.0000 1.5000 0.0000 Constraint 161 622 0.8000 1.0000 1.5000 0.0000 Constraint 161 613 0.8000 1.0000 1.5000 0.0000 Constraint 161 604 0.8000 1.0000 1.5000 0.0000 Constraint 161 599 0.8000 1.0000 1.5000 0.0000 Constraint 161 590 0.8000 1.0000 1.5000 0.0000 Constraint 161 585 0.8000 1.0000 1.5000 0.0000 Constraint 161 577 0.8000 1.0000 1.5000 0.0000 Constraint 161 571 0.8000 1.0000 1.5000 0.0000 Constraint 161 557 0.8000 1.0000 1.5000 0.0000 Constraint 161 552 0.8000 1.0000 1.5000 0.0000 Constraint 161 544 0.8000 1.0000 1.5000 0.0000 Constraint 161 535 0.8000 1.0000 1.5000 0.0000 Constraint 161 527 0.8000 1.0000 1.5000 0.0000 Constraint 161 519 0.8000 1.0000 1.5000 0.0000 Constraint 161 511 0.8000 1.0000 1.5000 0.0000 Constraint 161 497 0.8000 1.0000 1.5000 0.0000 Constraint 161 489 0.8000 1.0000 1.5000 0.0000 Constraint 161 480 0.8000 1.0000 1.5000 0.0000 Constraint 161 473 0.8000 1.0000 1.5000 0.0000 Constraint 161 467 0.8000 1.0000 1.5000 0.0000 Constraint 161 461 0.8000 1.0000 1.5000 0.0000 Constraint 161 449 0.8000 1.0000 1.5000 0.0000 Constraint 161 442 0.8000 1.0000 1.5000 0.0000 Constraint 161 435 0.8000 1.0000 1.5000 0.0000 Constraint 161 429 0.8000 1.0000 1.5000 0.0000 Constraint 161 421 0.8000 1.0000 1.5000 0.0000 Constraint 161 412 0.8000 1.0000 1.5000 0.0000 Constraint 161 404 0.8000 1.0000 1.5000 0.0000 Constraint 161 399 0.8000 1.0000 1.5000 0.0000 Constraint 161 391 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 360 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 350 0.8000 1.0000 1.5000 0.0000 Constraint 161 341 0.8000 1.0000 1.5000 0.0000 Constraint 161 330 0.8000 1.0000 1.5000 0.0000 Constraint 161 322 0.8000 1.0000 1.5000 0.0000 Constraint 161 314 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 297 0.8000 1.0000 1.5000 0.0000 Constraint 161 292 0.8000 1.0000 1.5000 0.0000 Constraint 161 285 0.8000 1.0000 1.5000 0.0000 Constraint 161 279 0.8000 1.0000 1.5000 0.0000 Constraint 161 272 0.8000 1.0000 1.5000 0.0000 Constraint 161 267 0.8000 1.0000 1.5000 0.0000 Constraint 161 259 0.8000 1.0000 1.5000 0.0000 Constraint 161 250 0.8000 1.0000 1.5000 0.0000 Constraint 161 242 0.8000 1.0000 1.5000 0.0000 Constraint 161 237 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 742 0.8000 1.0000 1.5000 0.0000 Constraint 153 735 0.8000 1.0000 1.5000 0.0000 Constraint 153 729 0.8000 1.0000 1.5000 0.0000 Constraint 153 720 0.8000 1.0000 1.5000 0.0000 Constraint 153 713 0.8000 1.0000 1.5000 0.0000 Constraint 153 706 0.8000 1.0000 1.5000 0.0000 Constraint 153 698 0.8000 1.0000 1.5000 0.0000 Constraint 153 687 0.8000 1.0000 1.5000 0.0000 Constraint 153 676 0.8000 1.0000 1.5000 0.0000 Constraint 153 668 0.8000 1.0000 1.5000 0.0000 Constraint 153 657 0.8000 1.0000 1.5000 0.0000 Constraint 153 651 0.8000 1.0000 1.5000 0.0000 Constraint 153 644 0.8000 1.0000 1.5000 0.0000 Constraint 153 636 0.8000 1.0000 1.5000 0.0000 Constraint 153 629 0.8000 1.0000 1.5000 0.0000 Constraint 153 622 0.8000 1.0000 1.5000 0.0000 Constraint 153 613 0.8000 1.0000 1.5000 0.0000 Constraint 153 604 0.8000 1.0000 1.5000 0.0000 Constraint 153 599 0.8000 1.0000 1.5000 0.0000 Constraint 153 590 0.8000 1.0000 1.5000 0.0000 Constraint 153 585 0.8000 1.0000 1.5000 0.0000 Constraint 153 577 0.8000 1.0000 1.5000 0.0000 Constraint 153 571 0.8000 1.0000 1.5000 0.0000 Constraint 153 557 0.8000 1.0000 1.5000 0.0000 Constraint 153 552 0.8000 1.0000 1.5000 0.0000 Constraint 153 544 0.8000 1.0000 1.5000 0.0000 Constraint 153 535 0.8000 1.0000 1.5000 0.0000 Constraint 153 527 0.8000 1.0000 1.5000 0.0000 Constraint 153 519 0.8000 1.0000 1.5000 0.0000 Constraint 153 511 0.8000 1.0000 1.5000 0.0000 Constraint 153 497 0.8000 1.0000 1.5000 0.0000 Constraint 153 489 0.8000 1.0000 1.5000 0.0000 Constraint 153 480 0.8000 1.0000 1.5000 0.0000 Constraint 153 473 0.8000 1.0000 1.5000 0.0000 Constraint 153 467 0.8000 1.0000 1.5000 0.0000 Constraint 153 461 0.8000 1.0000 1.5000 0.0000 Constraint 153 449 0.8000 1.0000 1.5000 0.0000 Constraint 153 442 0.8000 1.0000 1.5000 0.0000 Constraint 153 435 0.8000 1.0000 1.5000 0.0000 Constraint 153 429 0.8000 1.0000 1.5000 0.0000 Constraint 153 421 0.8000 1.0000 1.5000 0.0000 Constraint 153 412 0.8000 1.0000 1.5000 0.0000 Constraint 153 404 0.8000 1.0000 1.5000 0.0000 Constraint 153 399 0.8000 1.0000 1.5000 0.0000 Constraint 153 391 0.8000 1.0000 1.5000 0.0000 Constraint 153 382 0.8000 1.0000 1.5000 0.0000 Constraint 153 375 0.8000 1.0000 1.5000 0.0000 Constraint 153 368 0.8000 1.0000 1.5000 0.0000 Constraint 153 360 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 350 0.8000 1.0000 1.5000 0.0000 Constraint 153 341 0.8000 1.0000 1.5000 0.0000 Constraint 153 330 0.8000 1.0000 1.5000 0.0000 Constraint 153 322 0.8000 1.0000 1.5000 0.0000 Constraint 153 314 0.8000 1.0000 1.5000 0.0000 Constraint 153 303 0.8000 1.0000 1.5000 0.0000 Constraint 153 297 0.8000 1.0000 1.5000 0.0000 Constraint 153 292 0.8000 1.0000 1.5000 0.0000 Constraint 153 285 0.8000 1.0000 1.5000 0.0000 Constraint 153 279 0.8000 1.0000 1.5000 0.0000 Constraint 153 272 0.8000 1.0000 1.5000 0.0000 Constraint 153 267 0.8000 1.0000 1.5000 0.0000 Constraint 153 259 0.8000 1.0000 1.5000 0.0000 Constraint 153 250 0.8000 1.0000 1.5000 0.0000 Constraint 153 242 0.8000 1.0000 1.5000 0.0000 Constraint 153 237 0.8000 1.0000 1.5000 0.0000 Constraint 153 226 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 742 0.8000 1.0000 1.5000 0.0000 Constraint 144 735 0.8000 1.0000 1.5000 0.0000 Constraint 144 729 0.8000 1.0000 1.5000 0.0000 Constraint 144 720 0.8000 1.0000 1.5000 0.0000 Constraint 144 713 0.8000 1.0000 1.5000 0.0000 Constraint 144 706 0.8000 1.0000 1.5000 0.0000 Constraint 144 698 0.8000 1.0000 1.5000 0.0000 Constraint 144 687 0.8000 1.0000 1.5000 0.0000 Constraint 144 676 0.8000 1.0000 1.5000 0.0000 Constraint 144 668 0.8000 1.0000 1.5000 0.0000 Constraint 144 657 0.8000 1.0000 1.5000 0.0000 Constraint 144 651 0.8000 1.0000 1.5000 0.0000 Constraint 144 644 0.8000 1.0000 1.5000 0.0000 Constraint 144 636 0.8000 1.0000 1.5000 0.0000 Constraint 144 629 0.8000 1.0000 1.5000 0.0000 Constraint 144 622 0.8000 1.0000 1.5000 0.0000 Constraint 144 613 0.8000 1.0000 1.5000 0.0000 Constraint 144 604 0.8000 1.0000 1.5000 0.0000 Constraint 144 599 0.8000 1.0000 1.5000 0.0000 Constraint 144 590 0.8000 1.0000 1.5000 0.0000 Constraint 144 585 0.8000 1.0000 1.5000 0.0000 Constraint 144 577 0.8000 1.0000 1.5000 0.0000 Constraint 144 571 0.8000 1.0000 1.5000 0.0000 Constraint 144 557 0.8000 1.0000 1.5000 0.0000 Constraint 144 552 0.8000 1.0000 1.5000 0.0000 Constraint 144 544 0.8000 1.0000 1.5000 0.0000 Constraint 144 535 0.8000 1.0000 1.5000 0.0000 Constraint 144 527 0.8000 1.0000 1.5000 0.0000 Constraint 144 519 0.8000 1.0000 1.5000 0.0000 Constraint 144 511 0.8000 1.0000 1.5000 0.0000 Constraint 144 497 0.8000 1.0000 1.5000 0.0000 Constraint 144 489 0.8000 1.0000 1.5000 0.0000 Constraint 144 480 0.8000 1.0000 1.5000 0.0000 Constraint 144 473 0.8000 1.0000 1.5000 0.0000 Constraint 144 467 0.8000 1.0000 1.5000 0.0000 Constraint 144 461 0.8000 1.0000 1.5000 0.0000 Constraint 144 449 0.8000 1.0000 1.5000 0.0000 Constraint 144 442 0.8000 1.0000 1.5000 0.0000 Constraint 144 435 0.8000 1.0000 1.5000 0.0000 Constraint 144 429 0.8000 1.0000 1.5000 0.0000 Constraint 144 421 0.8000 1.0000 1.5000 0.0000 Constraint 144 412 0.8000 1.0000 1.5000 0.0000 Constraint 144 404 0.8000 1.0000 1.5000 0.0000 Constraint 144 399 0.8000 1.0000 1.5000 0.0000 Constraint 144 391 0.8000 1.0000 1.5000 0.0000 Constraint 144 382 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 368 0.8000 1.0000 1.5000 0.0000 Constraint 144 360 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 350 0.8000 1.0000 1.5000 0.0000 Constraint 144 341 0.8000 1.0000 1.5000 0.0000 Constraint 144 330 0.8000 1.0000 1.5000 0.0000 Constraint 144 322 0.8000 1.0000 1.5000 0.0000 Constraint 144 314 0.8000 1.0000 1.5000 0.0000 Constraint 144 303 0.8000 1.0000 1.5000 0.0000 Constraint 144 297 0.8000 1.0000 1.5000 0.0000 Constraint 144 292 0.8000 1.0000 1.5000 0.0000 Constraint 144 285 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 272 0.8000 1.0000 1.5000 0.0000 Constraint 144 267 0.8000 1.0000 1.5000 0.0000 Constraint 144 259 0.8000 1.0000 1.5000 0.0000 Constraint 144 250 0.8000 1.0000 1.5000 0.0000 Constraint 144 242 0.8000 1.0000 1.5000 0.0000 Constraint 144 237 0.8000 1.0000 1.5000 0.0000 Constraint 144 226 0.8000 1.0000 1.5000 0.0000 Constraint 144 221 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 742 0.8000 1.0000 1.5000 0.0000 Constraint 136 735 0.8000 1.0000 1.5000 0.0000 Constraint 136 729 0.8000 1.0000 1.5000 0.0000 Constraint 136 720 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 698 0.8000 1.0000 1.5000 0.0000 Constraint 136 687 0.8000 1.0000 1.5000 0.0000 Constraint 136 676 0.8000 1.0000 1.5000 0.0000 Constraint 136 668 0.8000 1.0000 1.5000 0.0000 Constraint 136 657 0.8000 1.0000 1.5000 0.0000 Constraint 136 651 0.8000 1.0000 1.5000 0.0000 Constraint 136 644 0.8000 1.0000 1.5000 0.0000 Constraint 136 636 0.8000 1.0000 1.5000 0.0000 Constraint 136 622 0.8000 1.0000 1.5000 0.0000 Constraint 136 613 0.8000 1.0000 1.5000 0.0000 Constraint 136 604 0.8000 1.0000 1.5000 0.0000 Constraint 136 599 0.8000 1.0000 1.5000 0.0000 Constraint 136 590 0.8000 1.0000 1.5000 0.0000 Constraint 136 585 0.8000 1.0000 1.5000 0.0000 Constraint 136 577 0.8000 1.0000 1.5000 0.0000 Constraint 136 571 0.8000 1.0000 1.5000 0.0000 Constraint 136 557 0.8000 1.0000 1.5000 0.0000 Constraint 136 552 0.8000 1.0000 1.5000 0.0000 Constraint 136 544 0.8000 1.0000 1.5000 0.0000 Constraint 136 535 0.8000 1.0000 1.5000 0.0000 Constraint 136 527 0.8000 1.0000 1.5000 0.0000 Constraint 136 519 0.8000 1.0000 1.5000 0.0000 Constraint 136 511 0.8000 1.0000 1.5000 0.0000 Constraint 136 497 0.8000 1.0000 1.5000 0.0000 Constraint 136 489 0.8000 1.0000 1.5000 0.0000 Constraint 136 480 0.8000 1.0000 1.5000 0.0000 Constraint 136 473 0.8000 1.0000 1.5000 0.0000 Constraint 136 467 0.8000 1.0000 1.5000 0.0000 Constraint 136 461 0.8000 1.0000 1.5000 0.0000 Constraint 136 449 0.8000 1.0000 1.5000 0.0000 Constraint 136 442 0.8000 1.0000 1.5000 0.0000 Constraint 136 435 0.8000 1.0000 1.5000 0.0000 Constraint 136 429 0.8000 1.0000 1.5000 0.0000 Constraint 136 421 0.8000 1.0000 1.5000 0.0000 Constraint 136 412 0.8000 1.0000 1.5000 0.0000 Constraint 136 404 0.8000 1.0000 1.5000 0.0000 Constraint 136 399 0.8000 1.0000 1.5000 0.0000 Constraint 136 391 0.8000 1.0000 1.5000 0.0000 Constraint 136 382 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 360 0.8000 1.0000 1.5000 0.0000 Constraint 136 355 0.8000 1.0000 1.5000 0.0000 Constraint 136 350 0.8000 1.0000 1.5000 0.0000 Constraint 136 341 0.8000 1.0000 1.5000 0.0000 Constraint 136 330 0.8000 1.0000 1.5000 0.0000 Constraint 136 322 0.8000 1.0000 1.5000 0.0000 Constraint 136 314 0.8000 1.0000 1.5000 0.0000 Constraint 136 303 0.8000 1.0000 1.5000 0.0000 Constraint 136 297 0.8000 1.0000 1.5000 0.0000 Constraint 136 292 0.8000 1.0000 1.5000 0.0000 Constraint 136 285 0.8000 1.0000 1.5000 0.0000 Constraint 136 279 0.8000 1.0000 1.5000 0.0000 Constraint 136 272 0.8000 1.0000 1.5000 0.0000 Constraint 136 267 0.8000 1.0000 1.5000 0.0000 Constraint 136 259 0.8000 1.0000 1.5000 0.0000 Constraint 136 250 0.8000 1.0000 1.5000 0.0000 Constraint 136 242 0.8000 1.0000 1.5000 0.0000 Constraint 136 237 0.8000 1.0000 1.5000 0.0000 Constraint 136 226 0.8000 1.0000 1.5000 0.0000 Constraint 136 221 0.8000 1.0000 1.5000 0.0000 Constraint 136 210 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 742 0.8000 1.0000 1.5000 0.0000 Constraint 128 735 0.8000 1.0000 1.5000 0.0000 Constraint 128 729 0.8000 1.0000 1.5000 0.0000 Constraint 128 720 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 698 0.8000 1.0000 1.5000 0.0000 Constraint 128 687 0.8000 1.0000 1.5000 0.0000 Constraint 128 676 0.8000 1.0000 1.5000 0.0000 Constraint 128 668 0.8000 1.0000 1.5000 0.0000 Constraint 128 657 0.8000 1.0000 1.5000 0.0000 Constraint 128 651 0.8000 1.0000 1.5000 0.0000 Constraint 128 644 0.8000 1.0000 1.5000 0.0000 Constraint 128 636 0.8000 1.0000 1.5000 0.0000 Constraint 128 629 0.8000 1.0000 1.5000 0.0000 Constraint 128 622 0.8000 1.0000 1.5000 0.0000 Constraint 128 613 0.8000 1.0000 1.5000 0.0000 Constraint 128 604 0.8000 1.0000 1.5000 0.0000 Constraint 128 599 0.8000 1.0000 1.5000 0.0000 Constraint 128 590 0.8000 1.0000 1.5000 0.0000 Constraint 128 585 0.8000 1.0000 1.5000 0.0000 Constraint 128 577 0.8000 1.0000 1.5000 0.0000 Constraint 128 571 0.8000 1.0000 1.5000 0.0000 Constraint 128 557 0.8000 1.0000 1.5000 0.0000 Constraint 128 552 0.8000 1.0000 1.5000 0.0000 Constraint 128 544 0.8000 1.0000 1.5000 0.0000 Constraint 128 535 0.8000 1.0000 1.5000 0.0000 Constraint 128 527 0.8000 1.0000 1.5000 0.0000 Constraint 128 519 0.8000 1.0000 1.5000 0.0000 Constraint 128 511 0.8000 1.0000 1.5000 0.0000 Constraint 128 497 0.8000 1.0000 1.5000 0.0000 Constraint 128 489 0.8000 1.0000 1.5000 0.0000 Constraint 128 480 0.8000 1.0000 1.5000 0.0000 Constraint 128 473 0.8000 1.0000 1.5000 0.0000 Constraint 128 467 0.8000 1.0000 1.5000 0.0000 Constraint 128 461 0.8000 1.0000 1.5000 0.0000 Constraint 128 449 0.8000 1.0000 1.5000 0.0000 Constraint 128 442 0.8000 1.0000 1.5000 0.0000 Constraint 128 435 0.8000 1.0000 1.5000 0.0000 Constraint 128 429 0.8000 1.0000 1.5000 0.0000 Constraint 128 421 0.8000 1.0000 1.5000 0.0000 Constraint 128 412 0.8000 1.0000 1.5000 0.0000 Constraint 128 404 0.8000 1.0000 1.5000 0.0000 Constraint 128 399 0.8000 1.0000 1.5000 0.0000 Constraint 128 391 0.8000 1.0000 1.5000 0.0000 Constraint 128 382 0.8000 1.0000 1.5000 0.0000 Constraint 128 375 0.8000 1.0000 1.5000 0.0000 Constraint 128 368 0.8000 1.0000 1.5000 0.0000 Constraint 128 360 0.8000 1.0000 1.5000 0.0000 Constraint 128 355 0.8000 1.0000 1.5000 0.0000 Constraint 128 350 0.8000 1.0000 1.5000 0.0000 Constraint 128 341 0.8000 1.0000 1.5000 0.0000 Constraint 128 330 0.8000 1.0000 1.5000 0.0000 Constraint 128 322 0.8000 1.0000 1.5000 0.0000 Constraint 128 314 0.8000 1.0000 1.5000 0.0000 Constraint 128 303 0.8000 1.0000 1.5000 0.0000 Constraint 128 297 0.8000 1.0000 1.5000 0.0000 Constraint 128 292 0.8000 1.0000 1.5000 0.0000 Constraint 128 285 0.8000 1.0000 1.5000 0.0000 Constraint 128 279 0.8000 1.0000 1.5000 0.0000 Constraint 128 272 0.8000 1.0000 1.5000 0.0000 Constraint 128 267 0.8000 1.0000 1.5000 0.0000 Constraint 128 259 0.8000 1.0000 1.5000 0.0000 Constraint 128 250 0.8000 1.0000 1.5000 0.0000 Constraint 128 242 0.8000 1.0000 1.5000 0.0000 Constraint 128 237 0.8000 1.0000 1.5000 0.0000 Constraint 128 226 0.8000 1.0000 1.5000 0.0000 Constraint 128 221 0.8000 1.0000 1.5000 0.0000 Constraint 128 210 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 698 0.8000 1.0000 1.5000 0.0000 Constraint 122 687 0.8000 1.0000 1.5000 0.0000 Constraint 122 676 0.8000 1.0000 1.5000 0.0000 Constraint 122 668 0.8000 1.0000 1.5000 0.0000 Constraint 122 657 0.8000 1.0000 1.5000 0.0000 Constraint 122 651 0.8000 1.0000 1.5000 0.0000 Constraint 122 644 0.8000 1.0000 1.5000 0.0000 Constraint 122 636 0.8000 1.0000 1.5000 0.0000 Constraint 122 629 0.8000 1.0000 1.5000 0.0000 Constraint 122 622 0.8000 1.0000 1.5000 0.0000 Constraint 122 613 0.8000 1.0000 1.5000 0.0000 Constraint 122 604 0.8000 1.0000 1.5000 0.0000 Constraint 122 599 0.8000 1.0000 1.5000 0.0000 Constraint 122 590 0.8000 1.0000 1.5000 0.0000 Constraint 122 585 0.8000 1.0000 1.5000 0.0000 Constraint 122 577 0.8000 1.0000 1.5000 0.0000 Constraint 122 571 0.8000 1.0000 1.5000 0.0000 Constraint 122 557 0.8000 1.0000 1.5000 0.0000 Constraint 122 552 0.8000 1.0000 1.5000 0.0000 Constraint 122 544 0.8000 1.0000 1.5000 0.0000 Constraint 122 535 0.8000 1.0000 1.5000 0.0000 Constraint 122 527 0.8000 1.0000 1.5000 0.0000 Constraint 122 519 0.8000 1.0000 1.5000 0.0000 Constraint 122 511 0.8000 1.0000 1.5000 0.0000 Constraint 122 497 0.8000 1.0000 1.5000 0.0000 Constraint 122 489 0.8000 1.0000 1.5000 0.0000 Constraint 122 480 0.8000 1.0000 1.5000 0.0000 Constraint 122 473 0.8000 1.0000 1.5000 0.0000 Constraint 122 467 0.8000 1.0000 1.5000 0.0000 Constraint 122 461 0.8000 1.0000 1.5000 0.0000 Constraint 122 449 0.8000 1.0000 1.5000 0.0000 Constraint 122 442 0.8000 1.0000 1.5000 0.0000 Constraint 122 435 0.8000 1.0000 1.5000 0.0000 Constraint 122 429 0.8000 1.0000 1.5000 0.0000 Constraint 122 421 0.8000 1.0000 1.5000 0.0000 Constraint 122 412 0.8000 1.0000 1.5000 0.0000 Constraint 122 404 0.8000 1.0000 1.5000 0.0000 Constraint 122 399 0.8000 1.0000 1.5000 0.0000 Constraint 122 391 0.8000 1.0000 1.5000 0.0000 Constraint 122 382 0.8000 1.0000 1.5000 0.0000 Constraint 122 375 0.8000 1.0000 1.5000 0.0000 Constraint 122 368 0.8000 1.0000 1.5000 0.0000 Constraint 122 360 0.8000 1.0000 1.5000 0.0000 Constraint 122 355 0.8000 1.0000 1.5000 0.0000 Constraint 122 350 0.8000 1.0000 1.5000 0.0000 Constraint 122 341 0.8000 1.0000 1.5000 0.0000 Constraint 122 330 0.8000 1.0000 1.5000 0.0000 Constraint 122 322 0.8000 1.0000 1.5000 0.0000 Constraint 122 314 0.8000 1.0000 1.5000 0.0000 Constraint 122 303 0.8000 1.0000 1.5000 0.0000 Constraint 122 297 0.8000 1.0000 1.5000 0.0000 Constraint 122 292 0.8000 1.0000 1.5000 0.0000 Constraint 122 285 0.8000 1.0000 1.5000 0.0000 Constraint 122 279 0.8000 1.0000 1.5000 0.0000 Constraint 122 272 0.8000 1.0000 1.5000 0.0000 Constraint 122 267 0.8000 1.0000 1.5000 0.0000 Constraint 122 259 0.8000 1.0000 1.5000 0.0000 Constraint 122 250 0.8000 1.0000 1.5000 0.0000 Constraint 122 242 0.8000 1.0000 1.5000 0.0000 Constraint 122 237 0.8000 1.0000 1.5000 0.0000 Constraint 122 226 0.8000 1.0000 1.5000 0.0000 Constraint 122 221 0.8000 1.0000 1.5000 0.0000 Constraint 122 210 0.8000 1.0000 1.5000 0.0000 Constraint 122 201 0.8000 1.0000 1.5000 0.0000 Constraint 122 190 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 713 0.8000 1.0000 1.5000 0.0000 Constraint 113 706 0.8000 1.0000 1.5000 0.0000 Constraint 113 698 0.8000 1.0000 1.5000 0.0000 Constraint 113 687 0.8000 1.0000 1.5000 0.0000 Constraint 113 676 0.8000 1.0000 1.5000 0.0000 Constraint 113 668 0.8000 1.0000 1.5000 0.0000 Constraint 113 657 0.8000 1.0000 1.5000 0.0000 Constraint 113 651 0.8000 1.0000 1.5000 0.0000 Constraint 113 644 0.8000 1.0000 1.5000 0.0000 Constraint 113 636 0.8000 1.0000 1.5000 0.0000 Constraint 113 629 0.8000 1.0000 1.5000 0.0000 Constraint 113 622 0.8000 1.0000 1.5000 0.0000 Constraint 113 613 0.8000 1.0000 1.5000 0.0000 Constraint 113 604 0.8000 1.0000 1.5000 0.0000 Constraint 113 599 0.8000 1.0000 1.5000 0.0000 Constraint 113 590 0.8000 1.0000 1.5000 0.0000 Constraint 113 585 0.8000 1.0000 1.5000 0.0000 Constraint 113 577 0.8000 1.0000 1.5000 0.0000 Constraint 113 571 0.8000 1.0000 1.5000 0.0000 Constraint 113 557 0.8000 1.0000 1.5000 0.0000 Constraint 113 552 0.8000 1.0000 1.5000 0.0000 Constraint 113 544 0.8000 1.0000 1.5000 0.0000 Constraint 113 535 0.8000 1.0000 1.5000 0.0000 Constraint 113 527 0.8000 1.0000 1.5000 0.0000 Constraint 113 519 0.8000 1.0000 1.5000 0.0000 Constraint 113 511 0.8000 1.0000 1.5000 0.0000 Constraint 113 497 0.8000 1.0000 1.5000 0.0000 Constraint 113 489 0.8000 1.0000 1.5000 0.0000 Constraint 113 480 0.8000 1.0000 1.5000 0.0000 Constraint 113 473 0.8000 1.0000 1.5000 0.0000 Constraint 113 467 0.8000 1.0000 1.5000 0.0000 Constraint 113 461 0.8000 1.0000 1.5000 0.0000 Constraint 113 449 0.8000 1.0000 1.5000 0.0000 Constraint 113 442 0.8000 1.0000 1.5000 0.0000 Constraint 113 435 0.8000 1.0000 1.5000 0.0000 Constraint 113 429 0.8000 1.0000 1.5000 0.0000 Constraint 113 421 0.8000 1.0000 1.5000 0.0000 Constraint 113 412 0.8000 1.0000 1.5000 0.0000 Constraint 113 404 0.8000 1.0000 1.5000 0.0000 Constraint 113 399 0.8000 1.0000 1.5000 0.0000 Constraint 113 391 0.8000 1.0000 1.5000 0.0000 Constraint 113 382 0.8000 1.0000 1.5000 0.0000 Constraint 113 375 0.8000 1.0000 1.5000 0.0000 Constraint 113 368 0.8000 1.0000 1.5000 0.0000 Constraint 113 360 0.8000 1.0000 1.5000 0.0000 Constraint 113 355 0.8000 1.0000 1.5000 0.0000 Constraint 113 350 0.8000 1.0000 1.5000 0.0000 Constraint 113 341 0.8000 1.0000 1.5000 0.0000 Constraint 113 330 0.8000 1.0000 1.5000 0.0000 Constraint 113 322 0.8000 1.0000 1.5000 0.0000 Constraint 113 314 0.8000 1.0000 1.5000 0.0000 Constraint 113 303 0.8000 1.0000 1.5000 0.0000 Constraint 113 297 0.8000 1.0000 1.5000 0.0000 Constraint 113 292 0.8000 1.0000 1.5000 0.0000 Constraint 113 285 0.8000 1.0000 1.5000 0.0000 Constraint 113 279 0.8000 1.0000 1.5000 0.0000 Constraint 113 272 0.8000 1.0000 1.5000 0.0000 Constraint 113 267 0.8000 1.0000 1.5000 0.0000 Constraint 113 259 0.8000 1.0000 1.5000 0.0000 Constraint 113 250 0.8000 1.0000 1.5000 0.0000 Constraint 113 242 0.8000 1.0000 1.5000 0.0000 Constraint 113 237 0.8000 1.0000 1.5000 0.0000 Constraint 113 226 0.8000 1.0000 1.5000 0.0000 Constraint 113 221 0.8000 1.0000 1.5000 0.0000 Constraint 113 210 0.8000 1.0000 1.5000 0.0000 Constraint 113 201 0.8000 1.0000 1.5000 0.0000 Constraint 113 190 0.8000 1.0000 1.5000 0.0000 Constraint 113 182 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 713 0.8000 1.0000 1.5000 0.0000 Constraint 104 706 0.8000 1.0000 1.5000 0.0000 Constraint 104 698 0.8000 1.0000 1.5000 0.0000 Constraint 104 687 0.8000 1.0000 1.5000 0.0000 Constraint 104 676 0.8000 1.0000 1.5000 0.0000 Constraint 104 668 0.8000 1.0000 1.5000 0.0000 Constraint 104 657 0.8000 1.0000 1.5000 0.0000 Constraint 104 651 0.8000 1.0000 1.5000 0.0000 Constraint 104 644 0.8000 1.0000 1.5000 0.0000 Constraint 104 636 0.8000 1.0000 1.5000 0.0000 Constraint 104 629 0.8000 1.0000 1.5000 0.0000 Constraint 104 622 0.8000 1.0000 1.5000 0.0000 Constraint 104 613 0.8000 1.0000 1.5000 0.0000 Constraint 104 604 0.8000 1.0000 1.5000 0.0000 Constraint 104 599 0.8000 1.0000 1.5000 0.0000 Constraint 104 590 0.8000 1.0000 1.5000 0.0000 Constraint 104 585 0.8000 1.0000 1.5000 0.0000 Constraint 104 577 0.8000 1.0000 1.5000 0.0000 Constraint 104 571 0.8000 1.0000 1.5000 0.0000 Constraint 104 557 0.8000 1.0000 1.5000 0.0000 Constraint 104 552 0.8000 1.0000 1.5000 0.0000 Constraint 104 544 0.8000 1.0000 1.5000 0.0000 Constraint 104 535 0.8000 1.0000 1.5000 0.0000 Constraint 104 527 0.8000 1.0000 1.5000 0.0000 Constraint 104 519 0.8000 1.0000 1.5000 0.0000 Constraint 104 511 0.8000 1.0000 1.5000 0.0000 Constraint 104 497 0.8000 1.0000 1.5000 0.0000 Constraint 104 489 0.8000 1.0000 1.5000 0.0000 Constraint 104 480 0.8000 1.0000 1.5000 0.0000 Constraint 104 473 0.8000 1.0000 1.5000 0.0000 Constraint 104 467 0.8000 1.0000 1.5000 0.0000 Constraint 104 461 0.8000 1.0000 1.5000 0.0000 Constraint 104 449 0.8000 1.0000 1.5000 0.0000 Constraint 104 442 0.8000 1.0000 1.5000 0.0000 Constraint 104 435 0.8000 1.0000 1.5000 0.0000 Constraint 104 429 0.8000 1.0000 1.5000 0.0000 Constraint 104 421 0.8000 1.0000 1.5000 0.0000 Constraint 104 412 0.8000 1.0000 1.5000 0.0000 Constraint 104 404 0.8000 1.0000 1.5000 0.0000 Constraint 104 399 0.8000 1.0000 1.5000 0.0000 Constraint 104 391 0.8000 1.0000 1.5000 0.0000 Constraint 104 382 0.8000 1.0000 1.5000 0.0000 Constraint 104 375 0.8000 1.0000 1.5000 0.0000 Constraint 104 368 0.8000 1.0000 1.5000 0.0000 Constraint 104 360 0.8000 1.0000 1.5000 0.0000 Constraint 104 355 0.8000 1.0000 1.5000 0.0000 Constraint 104 350 0.8000 1.0000 1.5000 0.0000 Constraint 104 341 0.8000 1.0000 1.5000 0.0000 Constraint 104 330 0.8000 1.0000 1.5000 0.0000 Constraint 104 322 0.8000 1.0000 1.5000 0.0000 Constraint 104 314 0.8000 1.0000 1.5000 0.0000 Constraint 104 303 0.8000 1.0000 1.5000 0.0000 Constraint 104 297 0.8000 1.0000 1.5000 0.0000 Constraint 104 292 0.8000 1.0000 1.5000 0.0000 Constraint 104 285 0.8000 1.0000 1.5000 0.0000 Constraint 104 279 0.8000 1.0000 1.5000 0.0000 Constraint 104 272 0.8000 1.0000 1.5000 0.0000 Constraint 104 267 0.8000 1.0000 1.5000 0.0000 Constraint 104 259 0.8000 1.0000 1.5000 0.0000 Constraint 104 250 0.8000 1.0000 1.5000 0.0000 Constraint 104 242 0.8000 1.0000 1.5000 0.0000 Constraint 104 237 0.8000 1.0000 1.5000 0.0000 Constraint 104 226 0.8000 1.0000 1.5000 0.0000 Constraint 104 221 0.8000 1.0000 1.5000 0.0000 Constraint 104 210 0.8000 1.0000 1.5000 0.0000 Constraint 104 201 0.8000 1.0000 1.5000 0.0000 Constraint 104 190 0.8000 1.0000 1.5000 0.0000 Constraint 104 182 0.8000 1.0000 1.5000 0.0000 Constraint 104 176 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 698 0.8000 1.0000 1.5000 0.0000 Constraint 96 687 0.8000 1.0000 1.5000 0.0000 Constraint 96 676 0.8000 1.0000 1.5000 0.0000 Constraint 96 668 0.8000 1.0000 1.5000 0.0000 Constraint 96 657 0.8000 1.0000 1.5000 0.0000 Constraint 96 651 0.8000 1.0000 1.5000 0.0000 Constraint 96 644 0.8000 1.0000 1.5000 0.0000 Constraint 96 636 0.8000 1.0000 1.5000 0.0000 Constraint 96 629 0.8000 1.0000 1.5000 0.0000 Constraint 96 622 0.8000 1.0000 1.5000 0.0000 Constraint 96 613 0.8000 1.0000 1.5000 0.0000 Constraint 96 604 0.8000 1.0000 1.5000 0.0000 Constraint 96 599 0.8000 1.0000 1.5000 0.0000 Constraint 96 590 0.8000 1.0000 1.5000 0.0000 Constraint 96 585 0.8000 1.0000 1.5000 0.0000 Constraint 96 577 0.8000 1.0000 1.5000 0.0000 Constraint 96 571 0.8000 1.0000 1.5000 0.0000 Constraint 96 557 0.8000 1.0000 1.5000 0.0000 Constraint 96 552 0.8000 1.0000 1.5000 0.0000 Constraint 96 544 0.8000 1.0000 1.5000 0.0000 Constraint 96 535 0.8000 1.0000 1.5000 0.0000 Constraint 96 527 0.8000 1.0000 1.5000 0.0000 Constraint 96 519 0.8000 1.0000 1.5000 0.0000 Constraint 96 511 0.8000 1.0000 1.5000 0.0000 Constraint 96 497 0.8000 1.0000 1.5000 0.0000 Constraint 96 489 0.8000 1.0000 1.5000 0.0000 Constraint 96 480 0.8000 1.0000 1.5000 0.0000 Constraint 96 473 0.8000 1.0000 1.5000 0.0000 Constraint 96 467 0.8000 1.0000 1.5000 0.0000 Constraint 96 461 0.8000 1.0000 1.5000 0.0000 Constraint 96 449 0.8000 1.0000 1.5000 0.0000 Constraint 96 442 0.8000 1.0000 1.5000 0.0000 Constraint 96 435 0.8000 1.0000 1.5000 0.0000 Constraint 96 429 0.8000 1.0000 1.5000 0.0000 Constraint 96 421 0.8000 1.0000 1.5000 0.0000 Constraint 96 412 0.8000 1.0000 1.5000 0.0000 Constraint 96 404 0.8000 1.0000 1.5000 0.0000 Constraint 96 399 0.8000 1.0000 1.5000 0.0000 Constraint 96 391 0.8000 1.0000 1.5000 0.0000 Constraint 96 382 0.8000 1.0000 1.5000 0.0000 Constraint 96 375 0.8000 1.0000 1.5000 0.0000 Constraint 96 368 0.8000 1.0000 1.5000 0.0000 Constraint 96 360 0.8000 1.0000 1.5000 0.0000 Constraint 96 355 0.8000 1.0000 1.5000 0.0000 Constraint 96 350 0.8000 1.0000 1.5000 0.0000 Constraint 96 341 0.8000 1.0000 1.5000 0.0000 Constraint 96 330 0.8000 1.0000 1.5000 0.0000 Constraint 96 322 0.8000 1.0000 1.5000 0.0000 Constraint 96 314 0.8000 1.0000 1.5000 0.0000 Constraint 96 303 0.8000 1.0000 1.5000 0.0000 Constraint 96 297 0.8000 1.0000 1.5000 0.0000 Constraint 96 292 0.8000 1.0000 1.5000 0.0000 Constraint 96 285 0.8000 1.0000 1.5000 0.0000 Constraint 96 279 0.8000 1.0000 1.5000 0.0000 Constraint 96 272 0.8000 1.0000 1.5000 0.0000 Constraint 96 267 0.8000 1.0000 1.5000 0.0000 Constraint 96 259 0.8000 1.0000 1.5000 0.0000 Constraint 96 250 0.8000 1.0000 1.5000 0.0000 Constraint 96 242 0.8000 1.0000 1.5000 0.0000 Constraint 96 237 0.8000 1.0000 1.5000 0.0000 Constraint 96 226 0.8000 1.0000 1.5000 0.0000 Constraint 96 221 0.8000 1.0000 1.5000 0.0000 Constraint 96 210 0.8000 1.0000 1.5000 0.0000 Constraint 96 201 0.8000 1.0000 1.5000 0.0000 Constraint 96 190 0.8000 1.0000 1.5000 0.0000 Constraint 96 182 0.8000 1.0000 1.5000 0.0000 Constraint 96 176 0.8000 1.0000 1.5000 0.0000 Constraint 96 169 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 713 0.8000 1.0000 1.5000 0.0000 Constraint 88 706 0.8000 1.0000 1.5000 0.0000 Constraint 88 698 0.8000 1.0000 1.5000 0.0000 Constraint 88 687 0.8000 1.0000 1.5000 0.0000 Constraint 88 676 0.8000 1.0000 1.5000 0.0000 Constraint 88 668 0.8000 1.0000 1.5000 0.0000 Constraint 88 657 0.8000 1.0000 1.5000 0.0000 Constraint 88 651 0.8000 1.0000 1.5000 0.0000 Constraint 88 644 0.8000 1.0000 1.5000 0.0000 Constraint 88 636 0.8000 1.0000 1.5000 0.0000 Constraint 88 629 0.8000 1.0000 1.5000 0.0000 Constraint 88 622 0.8000 1.0000 1.5000 0.0000 Constraint 88 613 0.8000 1.0000 1.5000 0.0000 Constraint 88 604 0.8000 1.0000 1.5000 0.0000 Constraint 88 599 0.8000 1.0000 1.5000 0.0000 Constraint 88 590 0.8000 1.0000 1.5000 0.0000 Constraint 88 585 0.8000 1.0000 1.5000 0.0000 Constraint 88 577 0.8000 1.0000 1.5000 0.0000 Constraint 88 571 0.8000 1.0000 1.5000 0.0000 Constraint 88 557 0.8000 1.0000 1.5000 0.0000 Constraint 88 552 0.8000 1.0000 1.5000 0.0000 Constraint 88 544 0.8000 1.0000 1.5000 0.0000 Constraint 88 535 0.8000 1.0000 1.5000 0.0000 Constraint 88 527 0.8000 1.0000 1.5000 0.0000 Constraint 88 519 0.8000 1.0000 1.5000 0.0000 Constraint 88 511 0.8000 1.0000 1.5000 0.0000 Constraint 88 497 0.8000 1.0000 1.5000 0.0000 Constraint 88 489 0.8000 1.0000 1.5000 0.0000 Constraint 88 480 0.8000 1.0000 1.5000 0.0000 Constraint 88 473 0.8000 1.0000 1.5000 0.0000 Constraint 88 467 0.8000 1.0000 1.5000 0.0000 Constraint 88 461 0.8000 1.0000 1.5000 0.0000 Constraint 88 449 0.8000 1.0000 1.5000 0.0000 Constraint 88 442 0.8000 1.0000 1.5000 0.0000 Constraint 88 435 0.8000 1.0000 1.5000 0.0000 Constraint 88 429 0.8000 1.0000 1.5000 0.0000 Constraint 88 421 0.8000 1.0000 1.5000 0.0000 Constraint 88 412 0.8000 1.0000 1.5000 0.0000 Constraint 88 404 0.8000 1.0000 1.5000 0.0000 Constraint 88 399 0.8000 1.0000 1.5000 0.0000 Constraint 88 391 0.8000 1.0000 1.5000 0.0000 Constraint 88 382 0.8000 1.0000 1.5000 0.0000 Constraint 88 375 0.8000 1.0000 1.5000 0.0000 Constraint 88 368 0.8000 1.0000 1.5000 0.0000 Constraint 88 360 0.8000 1.0000 1.5000 0.0000 Constraint 88 355 0.8000 1.0000 1.5000 0.0000 Constraint 88 350 0.8000 1.0000 1.5000 0.0000 Constraint 88 341 0.8000 1.0000 1.5000 0.0000 Constraint 88 330 0.8000 1.0000 1.5000 0.0000 Constraint 88 322 0.8000 1.0000 1.5000 0.0000 Constraint 88 314 0.8000 1.0000 1.5000 0.0000 Constraint 88 303 0.8000 1.0000 1.5000 0.0000 Constraint 88 297 0.8000 1.0000 1.5000 0.0000 Constraint 88 292 0.8000 1.0000 1.5000 0.0000 Constraint 88 285 0.8000 1.0000 1.5000 0.0000 Constraint 88 279 0.8000 1.0000 1.5000 0.0000 Constraint 88 272 0.8000 1.0000 1.5000 0.0000 Constraint 88 267 0.8000 1.0000 1.5000 0.0000 Constraint 88 259 0.8000 1.0000 1.5000 0.0000 Constraint 88 250 0.8000 1.0000 1.5000 0.0000 Constraint 88 242 0.8000 1.0000 1.5000 0.0000 Constraint 88 237 0.8000 1.0000 1.5000 0.0000 Constraint 88 226 0.8000 1.0000 1.5000 0.0000 Constraint 88 221 0.8000 1.0000 1.5000 0.0000 Constraint 88 210 0.8000 1.0000 1.5000 0.0000 Constraint 88 201 0.8000 1.0000 1.5000 0.0000 Constraint 88 190 0.8000 1.0000 1.5000 0.0000 Constraint 88 182 0.8000 1.0000 1.5000 0.0000 Constraint 88 176 0.8000 1.0000 1.5000 0.0000 Constraint 88 169 0.8000 1.0000 1.5000 0.0000 Constraint 88 161 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 687 0.8000 1.0000 1.5000 0.0000 Constraint 80 676 0.8000 1.0000 1.5000 0.0000 Constraint 80 668 0.8000 1.0000 1.5000 0.0000 Constraint 80 657 0.8000 1.0000 1.5000 0.0000 Constraint 80 651 0.8000 1.0000 1.5000 0.0000 Constraint 80 644 0.8000 1.0000 1.5000 0.0000 Constraint 80 636 0.8000 1.0000 1.5000 0.0000 Constraint 80 629 0.8000 1.0000 1.5000 0.0000 Constraint 80 622 0.8000 1.0000 1.5000 0.0000 Constraint 80 613 0.8000 1.0000 1.5000 0.0000 Constraint 80 604 0.8000 1.0000 1.5000 0.0000 Constraint 80 599 0.8000 1.0000 1.5000 0.0000 Constraint 80 590 0.8000 1.0000 1.5000 0.0000 Constraint 80 585 0.8000 1.0000 1.5000 0.0000 Constraint 80 577 0.8000 1.0000 1.5000 0.0000 Constraint 80 571 0.8000 1.0000 1.5000 0.0000 Constraint 80 557 0.8000 1.0000 1.5000 0.0000 Constraint 80 552 0.8000 1.0000 1.5000 0.0000 Constraint 80 544 0.8000 1.0000 1.5000 0.0000 Constraint 80 535 0.8000 1.0000 1.5000 0.0000 Constraint 80 527 0.8000 1.0000 1.5000 0.0000 Constraint 80 519 0.8000 1.0000 1.5000 0.0000 Constraint 80 511 0.8000 1.0000 1.5000 0.0000 Constraint 80 497 0.8000 1.0000 1.5000 0.0000 Constraint 80 489 0.8000 1.0000 1.5000 0.0000 Constraint 80 480 0.8000 1.0000 1.5000 0.0000 Constraint 80 473 0.8000 1.0000 1.5000 0.0000 Constraint 80 467 0.8000 1.0000 1.5000 0.0000 Constraint 80 461 0.8000 1.0000 1.5000 0.0000 Constraint 80 449 0.8000 1.0000 1.5000 0.0000 Constraint 80 442 0.8000 1.0000 1.5000 0.0000 Constraint 80 435 0.8000 1.0000 1.5000 0.0000 Constraint 80 429 0.8000 1.0000 1.5000 0.0000 Constraint 80 421 0.8000 1.0000 1.5000 0.0000 Constraint 80 412 0.8000 1.0000 1.5000 0.0000 Constraint 80 404 0.8000 1.0000 1.5000 0.0000 Constraint 80 399 0.8000 1.0000 1.5000 0.0000 Constraint 80 391 0.8000 1.0000 1.5000 0.0000 Constraint 80 382 0.8000 1.0000 1.5000 0.0000 Constraint 80 375 0.8000 1.0000 1.5000 0.0000 Constraint 80 368 0.8000 1.0000 1.5000 0.0000 Constraint 80 360 0.8000 1.0000 1.5000 0.0000 Constraint 80 355 0.8000 1.0000 1.5000 0.0000 Constraint 80 350 0.8000 1.0000 1.5000 0.0000 Constraint 80 341 0.8000 1.0000 1.5000 0.0000 Constraint 80 330 0.8000 1.0000 1.5000 0.0000 Constraint 80 322 0.8000 1.0000 1.5000 0.0000 Constraint 80 314 0.8000 1.0000 1.5000 0.0000 Constraint 80 303 0.8000 1.0000 1.5000 0.0000 Constraint 80 297 0.8000 1.0000 1.5000 0.0000 Constraint 80 292 0.8000 1.0000 1.5000 0.0000 Constraint 80 285 0.8000 1.0000 1.5000 0.0000 Constraint 80 279 0.8000 1.0000 1.5000 0.0000 Constraint 80 272 0.8000 1.0000 1.5000 0.0000 Constraint 80 267 0.8000 1.0000 1.5000 0.0000 Constraint 80 259 0.8000 1.0000 1.5000 0.0000 Constraint 80 250 0.8000 1.0000 1.5000 0.0000 Constraint 80 242 0.8000 1.0000 1.5000 0.0000 Constraint 80 237 0.8000 1.0000 1.5000 0.0000 Constraint 80 226 0.8000 1.0000 1.5000 0.0000 Constraint 80 221 0.8000 1.0000 1.5000 0.0000 Constraint 80 210 0.8000 1.0000 1.5000 0.0000 Constraint 80 201 0.8000 1.0000 1.5000 0.0000 Constraint 80 190 0.8000 1.0000 1.5000 0.0000 Constraint 80 182 0.8000 1.0000 1.5000 0.0000 Constraint 80 176 0.8000 1.0000 1.5000 0.0000 Constraint 80 169 0.8000 1.0000 1.5000 0.0000 Constraint 80 161 0.8000 1.0000 1.5000 0.0000 Constraint 80 153 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 577 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 552 0.8000 1.0000 1.5000 0.0000 Constraint 69 544 0.8000 1.0000 1.5000 0.0000 Constraint 69 535 0.8000 1.0000 1.5000 0.0000 Constraint 69 527 0.8000 1.0000 1.5000 0.0000 Constraint 69 519 0.8000 1.0000 1.5000 0.0000 Constraint 69 511 0.8000 1.0000 1.5000 0.0000 Constraint 69 497 0.8000 1.0000 1.5000 0.0000 Constraint 69 489 0.8000 1.0000 1.5000 0.0000 Constraint 69 480 0.8000 1.0000 1.5000 0.0000 Constraint 69 473 0.8000 1.0000 1.5000 0.0000 Constraint 69 467 0.8000 1.0000 1.5000 0.0000 Constraint 69 461 0.8000 1.0000 1.5000 0.0000 Constraint 69 449 0.8000 1.0000 1.5000 0.0000 Constraint 69 442 0.8000 1.0000 1.5000 0.0000 Constraint 69 435 0.8000 1.0000 1.5000 0.0000 Constraint 69 429 0.8000 1.0000 1.5000 0.0000 Constraint 69 421 0.8000 1.0000 1.5000 0.0000 Constraint 69 412 0.8000 1.0000 1.5000 0.0000 Constraint 69 404 0.8000 1.0000 1.5000 0.0000 Constraint 69 399 0.8000 1.0000 1.5000 0.0000 Constraint 69 391 0.8000 1.0000 1.5000 0.0000 Constraint 69 382 0.8000 1.0000 1.5000 0.0000 Constraint 69 375 0.8000 1.0000 1.5000 0.0000 Constraint 69 368 0.8000 1.0000 1.5000 0.0000 Constraint 69 360 0.8000 1.0000 1.5000 0.0000 Constraint 69 355 0.8000 1.0000 1.5000 0.0000 Constraint 69 350 0.8000 1.0000 1.5000 0.0000 Constraint 69 341 0.8000 1.0000 1.5000 0.0000 Constraint 69 330 0.8000 1.0000 1.5000 0.0000 Constraint 69 322 0.8000 1.0000 1.5000 0.0000 Constraint 69 314 0.8000 1.0000 1.5000 0.0000 Constraint 69 303 0.8000 1.0000 1.5000 0.0000 Constraint 69 297 0.8000 1.0000 1.5000 0.0000 Constraint 69 292 0.8000 1.0000 1.5000 0.0000 Constraint 69 285 0.8000 1.0000 1.5000 0.0000 Constraint 69 279 0.8000 1.0000 1.5000 0.0000 Constraint 69 272 0.8000 1.0000 1.5000 0.0000 Constraint 69 267 0.8000 1.0000 1.5000 0.0000 Constraint 69 259 0.8000 1.0000 1.5000 0.0000 Constraint 69 250 0.8000 1.0000 1.5000 0.0000 Constraint 69 242 0.8000 1.0000 1.5000 0.0000 Constraint 69 237 0.8000 1.0000 1.5000 0.0000 Constraint 69 226 0.8000 1.0000 1.5000 0.0000 Constraint 69 221 0.8000 1.0000 1.5000 0.0000 Constraint 69 210 0.8000 1.0000 1.5000 0.0000 Constraint 69 201 0.8000 1.0000 1.5000 0.0000 Constraint 69 190 0.8000 1.0000 1.5000 0.0000 Constraint 69 182 0.8000 1.0000 1.5000 0.0000 Constraint 69 176 0.8000 1.0000 1.5000 0.0000 Constraint 69 169 0.8000 1.0000 1.5000 0.0000 Constraint 69 161 0.8000 1.0000 1.5000 0.0000 Constraint 69 153 0.8000 1.0000 1.5000 0.0000 Constraint 69 144 0.8000 1.0000 1.5000 0.0000 Constraint 69 136 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 585 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 557 0.8000 1.0000 1.5000 0.0000 Constraint 58 552 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 535 0.8000 1.0000 1.5000 0.0000 Constraint 58 527 0.8000 1.0000 1.5000 0.0000 Constraint 58 519 0.8000 1.0000 1.5000 0.0000 Constraint 58 511 0.8000 1.0000 1.5000 0.0000 Constraint 58 497 0.8000 1.0000 1.5000 0.0000 Constraint 58 489 0.8000 1.0000 1.5000 0.0000 Constraint 58 480 0.8000 1.0000 1.5000 0.0000 Constraint 58 473 0.8000 1.0000 1.5000 0.0000 Constraint 58 467 0.8000 1.0000 1.5000 0.0000 Constraint 58 461 0.8000 1.0000 1.5000 0.0000 Constraint 58 449 0.8000 1.0000 1.5000 0.0000 Constraint 58 442 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 429 0.8000 1.0000 1.5000 0.0000 Constraint 58 421 0.8000 1.0000 1.5000 0.0000 Constraint 58 412 0.8000 1.0000 1.5000 0.0000 Constraint 58 404 0.8000 1.0000 1.5000 0.0000 Constraint 58 399 0.8000 1.0000 1.5000 0.0000 Constraint 58 391 0.8000 1.0000 1.5000 0.0000 Constraint 58 382 0.8000 1.0000 1.5000 0.0000 Constraint 58 375 0.8000 1.0000 1.5000 0.0000 Constraint 58 368 0.8000 1.0000 1.5000 0.0000 Constraint 58 360 0.8000 1.0000 1.5000 0.0000 Constraint 58 355 0.8000 1.0000 1.5000 0.0000 Constraint 58 350 0.8000 1.0000 1.5000 0.0000 Constraint 58 341 0.8000 1.0000 1.5000 0.0000 Constraint 58 330 0.8000 1.0000 1.5000 0.0000 Constraint 58 322 0.8000 1.0000 1.5000 0.0000 Constraint 58 314 0.8000 1.0000 1.5000 0.0000 Constraint 58 303 0.8000 1.0000 1.5000 0.0000 Constraint 58 297 0.8000 1.0000 1.5000 0.0000 Constraint 58 292 0.8000 1.0000 1.5000 0.0000 Constraint 58 285 0.8000 1.0000 1.5000 0.0000 Constraint 58 279 0.8000 1.0000 1.5000 0.0000 Constraint 58 272 0.8000 1.0000 1.5000 0.0000 Constraint 58 267 0.8000 1.0000 1.5000 0.0000 Constraint 58 259 0.8000 1.0000 1.5000 0.0000 Constraint 58 250 0.8000 1.0000 1.5000 0.0000 Constraint 58 242 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 221 0.8000 1.0000 1.5000 0.0000 Constraint 58 210 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 182 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 169 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 153 0.8000 1.0000 1.5000 0.0000 Constraint 58 144 0.8000 1.0000 1.5000 0.0000 Constraint 58 136 0.8000 1.0000 1.5000 0.0000 Constraint 58 128 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 511 0.8000 1.0000 1.5000 0.0000 Constraint 51 497 0.8000 1.0000 1.5000 0.0000 Constraint 51 489 0.8000 1.0000 1.5000 0.0000 Constraint 51 480 0.8000 1.0000 1.5000 0.0000 Constraint 51 473 0.8000 1.0000 1.5000 0.0000 Constraint 51 467 0.8000 1.0000 1.5000 0.0000 Constraint 51 461 0.8000 1.0000 1.5000 0.0000 Constraint 51 449 0.8000 1.0000 1.5000 0.0000 Constraint 51 442 0.8000 1.0000 1.5000 0.0000 Constraint 51 435 0.8000 1.0000 1.5000 0.0000 Constraint 51 429 0.8000 1.0000 1.5000 0.0000 Constraint 51 421 0.8000 1.0000 1.5000 0.0000 Constraint 51 412 0.8000 1.0000 1.5000 0.0000 Constraint 51 404 0.8000 1.0000 1.5000 0.0000 Constraint 51 399 0.8000 1.0000 1.5000 0.0000 Constraint 51 391 0.8000 1.0000 1.5000 0.0000 Constraint 51 382 0.8000 1.0000 1.5000 0.0000 Constraint 51 375 0.8000 1.0000 1.5000 0.0000 Constraint 51 368 0.8000 1.0000 1.5000 0.0000 Constraint 51 360 0.8000 1.0000 1.5000 0.0000 Constraint 51 355 0.8000 1.0000 1.5000 0.0000 Constraint 51 350 0.8000 1.0000 1.5000 0.0000 Constraint 51 341 0.8000 1.0000 1.5000 0.0000 Constraint 51 330 0.8000 1.0000 1.5000 0.0000 Constraint 51 322 0.8000 1.0000 1.5000 0.0000 Constraint 51 314 0.8000 1.0000 1.5000 0.0000 Constraint 51 303 0.8000 1.0000 1.5000 0.0000 Constraint 51 297 0.8000 1.0000 1.5000 0.0000 Constraint 51 292 0.8000 1.0000 1.5000 0.0000 Constraint 51 285 0.8000 1.0000 1.5000 0.0000 Constraint 51 279 0.8000 1.0000 1.5000 0.0000 Constraint 51 272 0.8000 1.0000 1.5000 0.0000 Constraint 51 267 0.8000 1.0000 1.5000 0.0000 Constraint 51 259 0.8000 1.0000 1.5000 0.0000 Constraint 51 250 0.8000 1.0000 1.5000 0.0000 Constraint 51 242 0.8000 1.0000 1.5000 0.0000 Constraint 51 237 0.8000 1.0000 1.5000 0.0000 Constraint 51 226 0.8000 1.0000 1.5000 0.0000 Constraint 51 221 0.8000 1.0000 1.5000 0.0000 Constraint 51 210 0.8000 1.0000 1.5000 0.0000 Constraint 51 201 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 182 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 169 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 153 0.8000 1.0000 1.5000 0.0000 Constraint 51 144 0.8000 1.0000 1.5000 0.0000 Constraint 51 136 0.8000 1.0000 1.5000 0.0000 Constraint 51 128 0.8000 1.0000 1.5000 0.0000 Constraint 51 122 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 511 0.8000 1.0000 1.5000 0.0000 Constraint 41 497 0.8000 1.0000 1.5000 0.0000 Constraint 41 489 0.8000 1.0000 1.5000 0.0000 Constraint 41 480 0.8000 1.0000 1.5000 0.0000 Constraint 41 473 0.8000 1.0000 1.5000 0.0000 Constraint 41 467 0.8000 1.0000 1.5000 0.0000 Constraint 41 461 0.8000 1.0000 1.5000 0.0000 Constraint 41 449 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 429 0.8000 1.0000 1.5000 0.0000 Constraint 41 421 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 399 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 375 0.8000 1.0000 1.5000 0.0000 Constraint 41 368 0.8000 1.0000 1.5000 0.0000 Constraint 41 360 0.8000 1.0000 1.5000 0.0000 Constraint 41 355 0.8000 1.0000 1.5000 0.0000 Constraint 41 350 0.8000 1.0000 1.5000 0.0000 Constraint 41 341 0.8000 1.0000 1.5000 0.0000 Constraint 41 330 0.8000 1.0000 1.5000 0.0000 Constraint 41 322 0.8000 1.0000 1.5000 0.0000 Constraint 41 314 0.8000 1.0000 1.5000 0.0000 Constraint 41 303 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 292 0.8000 1.0000 1.5000 0.0000 Constraint 41 285 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 267 0.8000 1.0000 1.5000 0.0000 Constraint 41 259 0.8000 1.0000 1.5000 0.0000 Constraint 41 250 0.8000 1.0000 1.5000 0.0000 Constraint 41 242 0.8000 1.0000 1.5000 0.0000 Constraint 41 237 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 221 0.8000 1.0000 1.5000 0.0000 Constraint 41 210 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 144 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 122 0.8000 1.0000 1.5000 0.0000 Constraint 41 113 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 511 0.8000 1.0000 1.5000 0.0000 Constraint 33 497 0.8000 1.0000 1.5000 0.0000 Constraint 33 489 0.8000 1.0000 1.5000 0.0000 Constraint 33 480 0.8000 1.0000 1.5000 0.0000 Constraint 33 473 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 461 0.8000 1.0000 1.5000 0.0000 Constraint 33 449 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 429 0.8000 1.0000 1.5000 0.0000 Constraint 33 421 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 404 0.8000 1.0000 1.5000 0.0000 Constraint 33 399 0.8000 1.0000 1.5000 0.0000 Constraint 33 391 0.8000 1.0000 1.5000 0.0000 Constraint 33 382 0.8000 1.0000 1.5000 0.0000 Constraint 33 375 0.8000 1.0000 1.5000 0.0000 Constraint 33 368 0.8000 1.0000 1.5000 0.0000 Constraint 33 360 0.8000 1.0000 1.5000 0.0000 Constraint 33 355 0.8000 1.0000 1.5000 0.0000 Constraint 33 350 0.8000 1.0000 1.5000 0.0000 Constraint 33 341 0.8000 1.0000 1.5000 0.0000 Constraint 33 330 0.8000 1.0000 1.5000 0.0000 Constraint 33 322 0.8000 1.0000 1.5000 0.0000 Constraint 33 314 0.8000 1.0000 1.5000 0.0000 Constraint 33 303 0.8000 1.0000 1.5000 0.0000 Constraint 33 297 0.8000 1.0000 1.5000 0.0000 Constraint 33 292 0.8000 1.0000 1.5000 0.0000 Constraint 33 285 0.8000 1.0000 1.5000 0.0000 Constraint 33 279 0.8000 1.0000 1.5000 0.0000 Constraint 33 272 0.8000 1.0000 1.5000 0.0000 Constraint 33 267 0.8000 1.0000 1.5000 0.0000 Constraint 33 259 0.8000 1.0000 1.5000 0.0000 Constraint 33 250 0.8000 1.0000 1.5000 0.0000 Constraint 33 242 0.8000 1.0000 1.5000 0.0000 Constraint 33 237 0.8000 1.0000 1.5000 0.0000 Constraint 33 226 0.8000 1.0000 1.5000 0.0000 Constraint 33 221 0.8000 1.0000 1.5000 0.0000 Constraint 33 210 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 144 0.8000 1.0000 1.5000 0.0000 Constraint 33 136 0.8000 1.0000 1.5000 0.0000 Constraint 33 128 0.8000 1.0000 1.5000 0.0000 Constraint 33 122 0.8000 1.0000 1.5000 0.0000 Constraint 33 113 0.8000 1.0000 1.5000 0.0000 Constraint 33 104 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: