# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 28.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 303 12.6414 15.8017 23.7026 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 237 303 13.3640 16.7051 25.0576 87.8820 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 303 13.3123 16.6403 24.9605 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 176 250 12.6418 15.8022 23.7034 87.7035 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 176 314 11.6621 14.5776 21.8664 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 303 13.4991 16.8738 25.3107 85.6452 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 285 12.3216 15.4020 23.1030 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 303 12.9819 16.2274 24.3411 84.8820 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 259 341 11.3503 14.1878 21.2818 84.0375 Constraint 210 341 12.6508 15.8135 23.7203 84.0375 Constraint 182 341 11.2596 14.0745 21.1117 84.0375 Constraint 259 330 11.5359 14.4199 21.6298 83.7480 Constraint 210 330 11.0715 13.8394 20.7591 83.7480 Constraint 182 330 8.6896 10.8619 16.2929 83.7480 Constraint 242 341 13.0172 16.2715 24.4072 83.0920 Constraint 176 341 15.1949 18.9936 28.4905 83.0212 Constraint 237 322 11.7486 14.6858 22.0286 82.8770 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 279 13.1785 16.4731 24.7096 82.8523 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 169 267 12.6140 15.7674 23.6512 82.8523 Constraint 169 250 12.3018 15.3772 23.0659 82.8085 Constraint 242 330 12.9573 16.1966 24.2949 82.8025 Constraint 176 330 12.3757 15.4696 23.2044 82.7317 Constraint 250 322 13.3027 16.6284 24.9426 82.6985 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 429 12.8937 16.1171 24.1756 82.3719 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 297 429 13.3226 16.6532 24.9798 82.3719 Constraint 297 421 9.9428 12.4285 18.6427 82.3719 Constraint 292 429 10.4885 13.1107 19.6660 82.3719 Constraint 292 421 6.8174 8.5217 12.7826 82.3719 Constraint 285 429 12.1290 15.1613 22.7419 82.3719 Constraint 285 421 8.4580 10.5724 15.8587 82.3719 Constraint 259 429 11.0406 13.8008 20.7012 82.3719 Constraint 259 421 7.4615 9.3269 13.9904 82.3719 Constraint 210 429 9.4549 11.8187 17.7280 82.3719 Constraint 210 421 6.5241 8.1551 12.2327 82.3719 Constraint 182 429 12.7309 15.9136 23.8704 82.3719 Constraint 182 421 9.4906 11.8633 17.7949 82.3719 Constraint 176 429 14.3254 17.9067 26.8601 82.3719 Constraint 176 421 11.6616 14.5771 21.8656 82.3719 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 242 429 8.6569 10.8212 16.2317 81.4263 Constraint 242 421 5.6483 7.0603 10.5905 81.4263 Constraint 303 404 13.0759 16.3449 24.5173 81.2632 Constraint 297 404 14.4708 18.0885 27.1328 81.2632 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 285 404 11.5874 14.4842 21.7264 81.2632 Constraint 259 404 10.3703 12.9628 19.4442 81.2632 Constraint 210 404 11.2483 14.0603 21.0905 81.2632 Constraint 182 404 14.4846 18.1058 27.1587 81.2632 Constraint 176 404 16.5479 20.6849 31.0273 81.2632 Constraint 279 341 9.0281 11.2851 16.9276 81.2447 Constraint 272 341 11.5722 14.4652 21.6978 81.2447 Constraint 267 341 11.3047 14.1309 21.1963 81.2447 Constraint 250 341 15.3432 19.1790 28.7685 81.2008 Constraint 285 350 7.5775 9.4719 14.2078 81.0433 Constraint 259 350 10.3451 12.9313 19.3970 81.0433 Constraint 221 341 12.3034 15.3792 23.0689 81.0375 Constraint 267 330 11.2804 14.1004 21.1507 80.9552 Constraint 250 330 15.8265 19.7832 29.6747 80.9113 Constraint 292 355 11.2271 14.0339 21.0508 80.7947 Constraint 285 355 9.7587 12.1983 18.2975 80.7947 Constraint 259 355 12.0846 15.1058 22.6587 80.7947 Constraint 210 355 14.3598 17.9497 26.9246 80.7947 Constraint 182 355 14.4113 18.0141 27.0211 80.7947 Constraint 169 330 13.1819 16.4774 24.7161 80.7942 Constraint 221 330 11.2591 14.0739 21.1109 80.7480 Constraint 303 435 14.7652 18.4565 27.6847 80.3872 Constraint 297 435 14.8758 18.5947 27.8921 80.3872 Constraint 292 435 11.5134 14.3917 21.5876 80.3872 Constraint 285 435 12.9189 16.1487 24.2230 80.3872 Constraint 259 435 10.8859 13.6074 20.4111 80.3872 Constraint 210 435 9.6710 12.0887 18.1331 80.3872 Constraint 182 435 13.5707 16.9634 25.4451 80.3872 Constraint 237 341 16.0975 20.1218 30.1827 80.3630 Constraint 242 404 8.4628 10.5785 15.8677 80.3177 Constraint 303 412 11.6876 14.6094 21.9142 80.2786 Constraint 297 412 12.4440 15.5550 23.3325 80.2786 Constraint 292 412 8.9687 11.2109 16.8164 80.2786 Constraint 285 412 9.2274 11.5342 17.3014 80.2786 Constraint 259 412 7.2353 9.0441 13.5661 80.2786 Constraint 210 412 8.5627 10.7034 16.0550 80.2786 Constraint 182 412 11.9103 14.8878 22.3317 80.2786 Constraint 176 412 13.7886 17.2358 25.8536 80.2786 Constraint 237 330 15.2991 19.1239 28.6859 80.0735 Constraint 201 330 14.0881 17.6101 26.4152 80.0735 Constraint 190 330 12.5317 15.6646 23.4969 80.0735 Constraint 210 350 12.3225 15.4031 23.1047 80.0270 Constraint 182 350 11.8465 14.8081 22.2122 80.0270 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 297 399 12.0253 15.0317 22.5475 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 259 399 9.5368 11.9210 17.8816 79.8809 Constraint 210 399 10.4189 13.0236 19.5354 79.8809 Constraint 182 399 12.8371 16.0464 24.0696 79.8809 Constraint 176 399 15.5734 19.4668 29.2002 79.8809 Constraint 226 322 12.2680 15.3350 23.0025 79.8770 Constraint 242 355 13.2029 16.5036 24.7554 79.8491 Constraint 237 429 10.2333 12.7916 19.1875 79.7136 Constraint 201 429 12.8139 16.0174 24.0261 79.7136 Constraint 190 429 14.8347 18.5434 27.8151 79.7136 Constraint 190 421 11.6223 14.5279 21.7919 79.7136 Constraint 279 429 15.4916 19.3645 29.0467 79.5790 Constraint 279 421 11.7956 14.7445 22.1168 79.5790 Constraint 272 429 14.4993 18.1241 27.1861 79.5790 Constraint 272 421 10.8405 13.5506 20.3259 79.5790 Constraint 267 429 14.5644 18.2055 27.3083 79.5790 Constraint 267 421 10.8601 13.5751 20.3627 79.5790 Constraint 250 421 9.3273 11.6591 17.4886 79.5351 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 169 429 11.3034 14.1293 21.1939 79.4460 Constraint 169 421 9.5254 11.9067 17.8601 79.4460 Constraint 242 435 7.9306 9.9132 14.8698 79.4417 Constraint 176 435 14.3766 17.9707 26.9561 79.3892 Constraint 221 429 11.9287 14.9109 22.3663 79.3719 Constraint 221 421 8.3665 10.4581 15.6871 79.3719 Constraint 242 412 5.0814 6.3517 9.5276 79.3331 Constraint 250 429 11.8908 14.8635 22.2953 79.2351 Constraint 242 350 11.7547 14.6934 22.0401 79.0814 Constraint 303 442 13.0089 16.2611 24.3917 79.0538 Constraint 297 442 12.2632 15.3290 22.9935 79.0538 Constraint 292 442 8.8647 11.0809 16.6213 79.0538 Constraint 285 442 11.0579 13.8223 20.7335 79.0538 Constraint 259 442 8.8733 11.0916 16.6374 79.0538 Constraint 210 442 6.2636 7.8295 11.7443 79.0538 Constraint 182 442 10.2804 12.8505 19.2757 79.0538 Constraint 242 399 8.5018 10.6273 15.9409 78.9353 Constraint 161 314 15.0348 18.7935 28.1902 78.9048 Constraint 161 303 17.2483 21.5604 32.3405 78.9048 Constraint 161 297 13.9721 17.4651 26.1976 78.9048 Constraint 161 292 12.3803 15.4753 23.2130 78.9048 Constraint 161 285 16.4548 20.5685 30.8528 78.9048 Constraint 161 279 16.8686 21.0858 31.6287 78.9048 Constraint 161 272 13.2272 16.5340 24.8011 78.9048 Constraint 161 267 16.5506 20.6882 31.0324 78.9048 Constraint 161 259 14.9702 18.7127 28.0691 78.9048 Constraint 237 421 7.9412 9.9264 14.8897 78.6973 Constraint 201 421 10.1985 12.7481 19.1222 78.6973 Constraint 201 341 15.9791 19.9739 29.9609 78.6441 Constraint 190 341 14.4889 18.1111 27.1667 78.6441 Constraint 237 404 10.9242 13.6553 20.4830 78.6050 Constraint 201 404 14.6213 18.2766 27.4149 78.6050 Constraint 190 404 16.1126 20.1407 30.2111 78.6050 Constraint 279 404 15.4358 19.2947 28.9421 78.4704 Constraint 272 404 15.1160 18.8950 28.3425 78.4704 Constraint 267 404 13.9388 17.4234 26.1352 78.4704 Constraint 250 404 10.4191 13.0238 19.5357 78.4265 Constraint 322 404 12.6266 15.7832 23.6749 78.3514 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 176 350 15.6146 19.5182 29.2774 78.3081 Constraint 221 404 12.4143 15.5179 23.2768 78.2633 Constraint 279 350 9.5044 11.8805 17.8208 78.2504 Constraint 267 350 10.8510 13.5638 20.3456 78.2504 Constraint 169 341 15.4983 19.3729 29.0594 78.1262 Constraint 176 355 17.9830 22.4787 33.7181 78.0595 Constraint 279 355 12.1387 15.1734 22.7601 78.0018 Constraint 272 355 14.4515 18.0643 27.0965 78.0018 Constraint 267 355 13.0818 16.3522 24.5283 78.0018 Constraint 161 242 13.1421 16.4276 24.6413 77.9592 Constraint 250 355 15.2555 19.0694 28.6040 77.9580 Constraint 221 355 14.1529 17.6911 26.5366 77.7947 Constraint 190 412 12.8694 16.0867 24.1301 77.6204 Constraint 279 435 16.2182 20.2727 30.4091 77.5944 Constraint 272 435 14.7295 18.4119 27.6178 77.5944 Constraint 267 435 14.5283 18.1604 27.2406 77.5944 Constraint 279 412 12.8848 16.1060 24.1590 77.4858 Constraint 272 412 12.0613 15.0766 22.6149 77.4858 Constraint 267 412 10.9032 13.6290 20.4436 77.4858 Constraint 314 435 11.4413 14.3017 21.4525 77.4754 Constraint 169 435 11.4649 14.3311 21.4967 77.4614 Constraint 221 435 11.7229 14.6536 21.9805 77.3872 Constraint 237 350 15.2729 19.0911 28.6367 77.3687 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 169 412 11.8530 14.8162 22.2244 77.3528 Constraint 169 404 14.0988 17.6235 26.4353 77.3528 Constraint 221 412 9.1466 11.4333 17.1499 77.2786 Constraint 272 350 11.7392 14.6740 22.0110 77.2341 Constraint 237 399 11.6225 14.5282 21.7922 77.2226 Constraint 201 399 14.3825 17.9781 26.9672 77.2226 Constraint 190 399 15.2879 19.1099 28.6649 77.2226 Constraint 250 350 13.9232 17.4040 26.1060 77.1902 Constraint 279 399 13.4741 16.8426 25.2639 77.0880 Constraint 272 399 13.7219 17.1524 25.7286 77.0880 Constraint 267 399 12.7295 15.9119 23.8678 77.0880 Constraint 226 330 15.2128 19.0160 28.5240 77.0735 Constraint 250 399 11.1765 13.9706 20.9559 77.0441 Constraint 221 350 11.9396 14.9245 22.3867 77.0270 Constraint 330 399 11.8276 14.7845 22.1767 76.9691 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 221 399 11.5527 14.4409 21.6613 76.8809 Constraint 341 404 14.5172 18.1465 27.2198 76.8538 Constraint 161 322 12.5736 15.7170 23.5756 76.8116 Constraint 201 435 11.9996 14.9995 22.4993 76.7309 Constraint 190 435 14.4184 18.0230 27.0344 76.7309 Constraint 226 429 13.3568 16.6960 25.0439 76.7136 Constraint 330 404 15.3390 19.1738 28.7607 76.5642 Constraint 128 303 11.5995 14.4993 21.7490 76.5309 Constraint 128 297 9.2039 11.5049 17.2573 76.5309 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 285 11.3731 14.2164 21.3246 76.5309 Constraint 128 279 12.6012 15.7515 23.6272 76.5309 Constraint 128 272 10.0640 12.5799 18.8699 76.5309 Constraint 128 267 12.6754 15.8442 23.7663 76.5309 Constraint 128 259 10.6591 13.3239 19.9858 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 303 10.4289 13.0361 19.5541 76.5309 Constraint 104 297 8.7699 10.9623 16.4435 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 285 11.7606 14.7007 22.0511 76.5309 Constraint 104 279 12.8234 16.0292 24.0438 76.5309 Constraint 104 272 11.5604 14.4505 21.6758 76.5309 Constraint 104 267 13.8683 17.3354 26.0031 76.5309 Constraint 104 259 12.2704 15.3380 23.0069 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 190 355 17.3510 21.6888 32.5332 76.4175 Constraint 242 442 5.5550 6.9437 10.4156 76.3893 Constraint 176 442 10.4534 13.0668 19.6002 76.3368 Constraint 279 442 13.8163 17.2704 25.9056 76.2609 Constraint 272 442 11.7301 14.6626 21.9939 76.2609 Constraint 267 442 12.2904 15.3631 23.0446 76.2609 Constraint 161 237 10.7659 13.4574 20.1860 76.2466 Constraint 314 442 9.9883 12.4854 18.7281 76.1419 Constraint 161 250 16.2246 20.2807 30.4211 76.0680 Constraint 221 442 8.7415 10.9268 16.3903 76.0538 Constraint 237 435 8.2345 10.2931 15.4396 76.0101 Constraint 169 399 13.5221 16.9026 25.3539 75.9705 Constraint 237 412 7.3442 9.1803 13.7704 75.9015 Constraint 201 412 11.3544 14.1931 21.2896 75.9015 Constraint 341 429 14.3255 17.9068 26.8602 75.8691 Constraint 341 421 11.4898 14.3622 21.5433 75.8691 Constraint 341 412 13.8049 17.2561 25.8842 75.8691 Constraint 250 412 6.6384 8.2980 12.4470 75.7230 Constraint 201 350 15.9830 19.9787 29.9681 75.6498 Constraint 190 350 14.8706 18.5882 27.8823 75.6498 Constraint 226 341 16.1471 20.1838 30.2758 75.6441 Constraint 226 404 13.7837 17.2296 25.8444 75.6050 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 104 242 11.4981 14.3726 21.5589 75.5853 Constraint 330 429 13.9294 17.4117 26.1176 75.5796 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 330 412 14.3025 17.8781 26.8172 75.5796 Constraint 136 303 14.4479 18.0599 27.0898 75.5603 Constraint 136 297 11.7726 14.7157 22.0736 75.5603 Constraint 136 292 10.8565 13.5706 20.3559 75.5603 Constraint 136 285 14.8782 18.5977 27.8966 75.5603 Constraint 136 279 15.5712 19.4640 29.1960 75.5603 Constraint 136 272 13.0259 16.2824 24.4236 75.5603 Constraint 136 267 16.0904 20.1130 30.1694 75.5603 Constraint 136 259 14.4178 18.0223 27.0335 75.5603 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 250 435 9.9535 12.4418 18.6628 75.5316 Constraint 237 355 16.6217 20.7772 31.1657 75.4012 Constraint 201 355 18.0777 22.5972 33.8958 75.4012 Constraint 322 435 13.1473 16.4341 24.6512 75.3822 Constraint 169 350 15.5080 19.3849 29.0774 75.1319 Constraint 350 429 12.6638 15.8298 23.7446 74.8711 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 350 412 11.9101 14.8876 22.3314 74.8711 Constraint 355 429 12.5629 15.7036 23.5554 74.6225 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 136 242 12.9478 16.1848 24.2771 74.6147 Constraint 226 399 13.9937 17.4922 26.2383 74.2226 Constraint 322 442 10.8722 13.5903 20.3854 74.0487 Constraint 161 330 16.2622 20.3278 30.4916 74.0081 Constraint 226 421 10.0567 12.5708 18.8562 73.9784 Constraint 341 435 16.9266 21.1582 31.7373 73.8845 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 303 13.6099 17.0124 25.5186 73.8727 Constraint 122 297 12.1073 15.1341 22.7012 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 285 13.3253 16.6566 24.9849 73.8727 Constraint 122 279 15.3646 19.2057 28.8086 73.8727 Constraint 122 272 13.1702 16.4628 24.6942 73.8727 Constraint 122 267 15.0953 18.8692 28.3037 73.8727 Constraint 122 259 12.3283 15.4103 23.1155 73.8727 Constraint 122 237 9.7652 12.2065 18.3097 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 303 14.0408 17.5510 26.3265 73.8727 Constraint 113 297 12.5651 15.7064 23.5596 73.8727 Constraint 113 292 11.4170 14.2712 21.4068 73.8727 Constraint 113 285 14.8791 18.5989 27.8983 73.8727 Constraint 113 279 16.4215 20.5269 30.7903 73.8727 Constraint 113 272 14.7221 18.4027 27.6040 73.8727 Constraint 113 267 16.9487 21.1859 31.7788 73.8727 Constraint 113 259 14.6934 18.3668 27.5502 73.8727 Constraint 113 237 13.0904 16.3630 24.5445 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 190 14.0933 17.6166 26.4250 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 237 12.3132 15.3916 23.0873 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 104 190 11.6819 14.6023 21.9035 73.8727 Constraint 128 250 13.0108 16.2634 24.3952 73.6941 Constraint 104 250 15.3472 19.1840 28.7760 73.6941 Constraint 190 442 10.6222 13.2777 19.9166 73.6786 Constraint 237 442 5.0372 6.2965 9.4448 73.6603 Constraint 136 314 11.9606 14.9507 22.4261 73.6191 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 330 435 16.6111 20.7638 31.1458 73.5950 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 250 442 8.4303 10.5379 15.8068 73.1818 Constraint 169 355 17.3621 21.7027 32.5540 73.1644 Constraint 122 242 10.0349 12.5437 18.8155 72.9271 Constraint 113 242 12.9781 16.2226 24.3339 72.9271 Constraint 136 237 12.1250 15.1562 22.7344 72.9020 Constraint 226 412 9.9147 12.3934 18.5901 72.9015 Constraint 350 435 15.0926 18.8657 28.2986 72.8864 Constraint 136 250 16.6952 20.8690 31.3035 72.7235 Constraint 161 435 14.5428 18.1785 27.2677 72.7056 Constraint 161 429 14.3778 17.9722 26.9584 72.7056 Constraint 201 442 7.8099 9.7623 14.6435 72.6622 Constraint 226 350 15.7188 19.6485 29.4728 72.6498 Constraint 355 435 15.3149 19.1436 28.7155 72.6378 Constraint 136 221 12.1229 15.1536 22.7304 72.5603 Constraint 341 442 15.3100 19.1374 28.7062 72.5510 Constraint 226 355 17.5831 21.9789 32.9684 72.4012 Constraint 169 442 7.3524 9.1905 13.7858 72.3946 Constraint 128 341 13.1039 16.3799 24.5699 72.3505 Constraint 104 341 10.7662 13.4578 20.1866 72.3505 Constraint 330 442 14.4053 18.0066 27.0100 72.2616 Constraint 226 435 11.4757 14.3446 21.5169 71.7120 Constraint 350 442 14.0108 17.5136 26.2703 71.5530 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 279 11.9043 14.8803 22.3205 71.4434 Constraint 96 272 10.8873 13.6091 20.4137 71.4434 Constraint 96 267 12.2068 15.2585 22.8877 71.4434 Constraint 96 259 9.8491 12.3114 18.4671 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 303 12.2685 15.3357 23.0035 71.4377 Constraint 88 297 12.0961 15.1201 22.6802 71.4377 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 285 13.0498 16.3123 24.4684 71.4377 Constraint 88 279 15.4296 19.2870 28.9305 71.4377 Constraint 88 272 14.5615 18.2019 27.3028 71.4377 Constraint 88 267 15.6937 19.6171 29.4256 71.4377 Constraint 88 259 13.0518 16.3148 24.4722 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 88 182 11.5724 14.4655 21.6983 71.4377 Constraint 88 176 13.2501 16.5626 24.8439 71.4377 Constraint 355 442 14.9023 18.6279 27.9419 71.3044 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 303 382 12.1960 15.2450 22.8675 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 297 382 14.3908 17.9885 26.9827 71.1209 Constraint 292 391 7.9484 9.9355 14.9032 71.1209 Constraint 292 382 11.5404 14.4255 21.6383 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 285 382 10.2339 12.7924 19.1885 71.1209 Constraint 259 391 6.6353 8.2941 12.4412 71.1209 Constraint 259 382 9.4031 11.7538 17.6308 71.1209 Constraint 237 382 12.0519 15.0648 22.5973 71.1209 Constraint 210 391 9.6662 12.0828 18.1242 71.1209 Constraint 210 382 12.6264 15.7830 23.6745 71.1209 Constraint 201 382 15.9987 19.9983 29.9975 71.1209 Constraint 190 391 13.4958 16.8698 25.3046 71.1209 Constraint 190 382 16.5549 20.6936 31.0404 71.1209 Constraint 182 391 11.7541 14.6926 22.0389 71.1209 Constraint 182 382 15.2742 19.0928 28.6392 71.1209 Constraint 176 391 14.7426 18.4282 27.6423 71.1209 Constraint 176 382 17.9048 22.3810 33.5715 71.1209 Constraint 122 250 13.9396 17.4245 26.1367 71.0359 Constraint 113 250 16.9112 21.1390 31.7085 71.0359 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 113 314 10.8516 13.5645 20.3467 70.9608 Constraint 128 226 10.2451 12.8064 19.2096 70.8727 Constraint 122 226 12.2553 15.3191 22.9787 70.8727 Constraint 122 221 11.0976 13.8720 20.8080 70.8727 Constraint 113 226 15.1378 18.9223 28.3834 70.8727 Constraint 113 221 13.4325 16.7907 25.1860 70.8727 Constraint 104 226 13.5350 16.9187 25.3781 70.8727 Constraint 303 449 13.1094 16.3868 24.5801 70.7960 Constraint 297 449 12.2309 15.2886 22.9329 70.7960 Constraint 292 449 9.4730 11.8412 17.7618 70.7960 Constraint 285 449 12.3231 15.4039 23.1058 70.7960 Constraint 182 449 10.4260 13.0326 19.5488 70.7960 Constraint 161 421 13.0491 16.3113 24.4670 70.6912 Constraint 161 404 17.6677 22.0846 33.1269 70.6124 Constraint 96 242 8.7861 10.9826 16.4739 70.4979 Constraint 88 242 11.4801 14.3501 21.5251 70.4921 Constraint 144 314 13.8053 17.2566 25.8850 70.3651 Constraint 144 303 16.9080 21.1350 31.7025 70.3651 Constraint 144 297 14.6034 18.2543 27.3815 70.3651 Constraint 144 292 12.8734 16.0918 24.1377 70.3651 Constraint 144 285 16.8376 21.0470 31.5704 70.3651 Constraint 144 279 18.1650 22.7062 34.0593 70.3651 Constraint 144 272 15.3928 19.2410 28.8615 70.3651 Constraint 144 267 18.0944 22.6180 33.9270 70.3651 Constraint 144 259 15.7303 19.6629 29.4944 70.3651 Constraint 144 237 12.1445 15.1806 22.7710 70.3651 Constraint 136 341 15.2189 19.0236 28.5354 70.3636 Constraint 128 435 11.3295 14.1619 21.2428 70.3317 Constraint 128 429 9.9404 12.4255 18.6383 70.3317 Constraint 128 421 7.9979 9.9974 14.9961 70.3317 Constraint 104 435 13.8044 17.2555 25.8833 70.3317 Constraint 104 429 11.4047 14.2559 21.3838 70.3317 Constraint 104 421 9.4483 11.8104 17.7156 70.3317 Constraint 242 391 6.5818 8.2273 12.3410 70.1753 Constraint 242 382 8.7756 10.9695 16.4543 70.1753 Constraint 136 226 13.3731 16.7164 25.0746 69.9020 Constraint 303 375 12.3813 15.4766 23.2149 69.8228 Constraint 297 375 15.0767 18.8458 28.2688 69.8228 Constraint 292 375 12.7174 15.8968 23.8451 69.8228 Constraint 285 375 11.6796 14.5995 21.8993 69.8228 Constraint 259 375 11.6638 14.5798 21.8697 69.8228 Constraint 237 375 14.4052 18.0065 27.0098 69.8228 Constraint 210 375 14.0296 17.5370 26.3055 69.8228 Constraint 201 375 17.8734 22.3417 33.5126 69.8228 Constraint 190 375 18.5430 23.1788 34.7682 69.8228 Constraint 182 375 16.4479 20.5598 30.8397 69.8228 Constraint 136 330 12.3760 15.4701 23.2051 69.7387 Constraint 128 330 10.6121 13.2651 19.8977 69.7387 Constraint 104 330 8.1029 10.1287 15.1930 69.7387 Constraint 122 341 14.6955 18.3694 27.5541 69.6923 Constraint 113 341 14.2338 17.7922 26.6884 69.6923 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 144 242 13.4383 16.7979 25.1969 69.4195 Constraint 237 391 10.0464 12.5580 18.8370 69.4020 Constraint 201 391 13.1425 16.4281 24.6422 69.4020 Constraint 226 442 8.0615 10.0769 15.1153 69.3622 Constraint 136 435 14.6021 18.2526 27.3789 69.3611 Constraint 136 429 13.0660 16.3325 24.4988 69.3611 Constraint 136 421 11.6968 14.6210 21.9315 69.3611 Constraint 128 350 13.1454 16.4318 24.6477 69.3563 Constraint 104 350 11.5460 14.4326 21.6488 69.3563 Constraint 96 350 9.5716 11.9645 17.9467 69.3563 Constraint 96 341 10.1789 12.7236 19.0855 69.3563 Constraint 88 341 12.3224 15.4031 23.1046 69.3505 Constraint 259 449 10.6353 13.2941 19.9411 69.0771 Constraint 210 449 6.7053 8.3817 12.5725 69.0771 Constraint 128 442 8.3577 10.4471 15.6707 68.9982 Constraint 104 442 11.2918 14.1148 21.1721 68.9982 Constraint 242 375 11.0519 13.8148 20.7222 68.8772 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 161 399 17.2387 21.5483 32.3225 68.8252 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 96 190 11.4113 14.2641 21.3962 68.7852 Constraint 88 237 12.8760 16.0951 24.1426 68.7794 Constraint 88 201 13.3038 16.6297 24.9446 68.7794 Constraint 88 190 14.8554 18.5692 27.8539 68.7794 Constraint 176 375 19.2885 24.1107 36.1660 68.6084 Constraint 96 250 12.6918 15.8648 23.7972 68.6067 Constraint 88 250 15.2774 19.0967 28.6451 68.6009 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 88 161 13.1158 16.3948 24.5921 68.5258 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 221 12.9491 16.1863 24.2795 68.4377 Constraint 279 391 10.9033 13.6291 20.4437 68.3280 Constraint 279 382 14.1760 17.7201 26.5801 68.3280 Constraint 272 391 11.4246 14.2807 21.4211 68.3280 Constraint 272 382 14.7051 18.3813 27.5720 68.3280 Constraint 267 391 9.6439 12.0548 18.0822 68.3280 Constraint 267 382 12.4450 15.5563 23.3344 68.3280 Constraint 250 391 8.3797 10.4747 15.7120 68.2841 Constraint 250 382 9.3891 11.7364 17.6046 68.2841 Constraint 144 322 11.4516 14.3145 21.4717 68.2719 Constraint 128 412 11.3330 14.1662 21.2493 68.2385 Constraint 128 404 13.0213 16.2766 24.4149 68.2385 Constraint 104 412 13.3598 16.6998 25.0496 68.2385 Constraint 104 404 14.4214 18.0267 27.0401 68.2385 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 322 382 13.6503 17.0629 25.5943 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 242 449 8.1569 10.1962 15.2942 68.1315 Constraint 226 382 14.0742 17.5927 26.3891 68.1209 Constraint 221 391 9.3794 11.7243 17.5864 68.1209 Constraint 221 382 12.3923 15.4904 23.2355 68.1209 Constraint 176 449 10.7089 13.3861 20.0792 68.0790 Constraint 279 449 14.9583 18.6978 28.0468 68.0031 Constraint 314 449 9.5514 11.9393 17.9089 67.8842 Constraint 161 412 15.3512 19.1891 28.7836 67.8772 Constraint 122 435 10.5257 13.1572 19.7357 67.6735 Constraint 122 429 8.3417 10.4271 15.6407 67.6735 Constraint 122 421 8.0108 10.0135 15.0202 67.6735 Constraint 113 435 13.9336 17.4170 26.1254 67.6735 Constraint 113 429 11.3022 14.1278 21.1917 67.6735 Constraint 113 421 10.6751 13.3439 20.0158 67.6735 Constraint 161 442 10.9055 13.6319 20.4479 67.6388 Constraint 144 250 17.1909 21.4886 32.2329 67.5284 Constraint 136 350 15.8440 19.8050 29.7075 67.3693 Constraint 144 226 14.2558 17.8197 26.7296 67.3651 Constraint 144 221 13.7347 17.1684 25.7526 67.3651 Constraint 136 412 15.1135 18.8919 28.3378 67.2679 Constraint 136 404 16.5409 20.6762 31.0143 67.2679 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 297 368 12.8890 16.1113 24.1669 67.2518 Constraint 297 360 9.7917 12.2396 18.3594 67.2518 Constraint 292 368 10.8154 13.5192 20.2788 67.2518 Constraint 292 360 8.1736 10.2170 15.3256 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 259 368 9.3375 11.6718 17.5077 67.2518 Constraint 259 360 8.5248 10.6561 15.9841 67.2518 Constraint 237 368 13.6639 17.0799 25.6199 67.2518 Constraint 237 360 12.5806 15.7257 23.5886 67.2518 Constraint 210 368 13.0708 16.3385 24.5078 67.2518 Constraint 210 360 10.5815 13.2269 19.8403 67.2518 Constraint 201 368 16.8525 21.0656 31.5984 67.2518 Constraint 190 368 16.7140 20.8925 31.3387 67.2518 Constraint 190 360 14.5238 18.1548 27.2322 67.2518 Constraint 182 368 14.8235 18.5294 27.7941 67.2518 Constraint 182 360 11.8307 14.7883 22.1825 67.2518 Constraint 96 435 10.6424 13.3030 19.9544 67.2404 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 421 5.9672 7.4590 11.1885 67.2404 Constraint 96 412 9.8431 12.3038 18.4557 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 169 449 7.3581 9.1976 13.7964 67.1359 Constraint 161 341 18.8725 23.5906 35.3859 67.0959 Constraint 144 330 15.3530 19.1913 28.7869 67.0804 Constraint 122 330 12.7247 15.9059 23.8588 67.0804 Constraint 113 330 11.9235 14.9043 22.3565 67.0804 Constraint 279 375 15.6412 19.5515 29.3273 67.0299 Constraint 272 375 16.5395 20.6744 31.0116 67.0299 Constraint 267 375 14.6461 18.3076 27.4614 67.0299 Constraint 136 442 11.6340 14.5425 21.8138 67.0113 Constraint 250 375 12.5102 15.6378 23.4567 66.9860 Constraint 341 449 14.6141 18.2677 27.4015 66.9156 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 128 399 11.4464 14.3080 21.4619 66.8561 Constraint 104 399 11.6909 14.6136 21.9205 66.8561 Constraint 226 375 16.6604 20.8255 31.2382 66.8228 Constraint 221 375 14.4295 18.0368 27.0552 66.8228 Constraint 128 355 14.9370 18.6712 28.0068 66.7853 Constraint 104 355 13.1450 16.4313 24.6469 66.7853 Constraint 96 355 10.7045 13.3806 20.0709 66.7853 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 88 330 10.9722 13.7153 20.5729 66.7387 Constraint 113 350 14.4859 18.1074 27.1611 66.6980 Constraint 161 350 19.0274 23.7842 35.6764 66.6726 Constraint 226 391 11.6281 14.5352 21.8028 66.4020 Constraint 88 350 11.8560 14.8200 22.2299 66.3563 Constraint 122 442 8.8749 11.0936 16.6404 66.3400 Constraint 242 368 9.8064 12.2580 18.3871 66.3063 Constraint 242 360 8.9070 11.1338 16.7006 66.3063 Constraint 272 449 12.8002 16.0002 24.0004 66.2842 Constraint 267 449 13.9955 17.4944 26.2415 66.2842 Constraint 201 360 14.5210 18.1513 27.2269 66.2355 Constraint 176 360 15.1392 18.9241 28.3861 66.2355 Constraint 169 391 13.6441 17.0552 25.5827 66.2258 Constraint 169 382 16.3709 20.4636 30.6955 66.2258 Constraint 153 314 13.0488 16.3110 24.4666 66.1384 Constraint 153 303 15.9968 19.9960 29.9940 66.1384 Constraint 153 297 13.4446 16.8058 25.2087 66.1384 Constraint 153 292 11.1345 13.9181 20.8772 66.1384 Constraint 153 285 15.1049 18.8811 28.3217 66.1384 Constraint 153 279 16.4474 20.5593 30.8389 66.1384 Constraint 153 272 13.1853 16.4816 24.7224 66.1384 Constraint 153 267 15.8291 19.7864 29.6795 66.1384 Constraint 153 259 13.4413 16.8017 25.2025 66.1384 Constraint 153 237 9.0638 11.3297 16.9946 66.1384 Constraint 221 449 10.2337 12.7922 19.1882 66.0771 Constraint 176 368 18.0172 22.5215 33.7822 66.0374 Constraint 350 449 13.4384 16.7979 25.1969 65.9175 Constraint 96 442 8.7214 10.9017 16.3526 65.9069 Constraint 136 399 14.8506 18.5632 27.8448 65.8855 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 322 449 9.5242 11.9052 17.8578 65.7909 Constraint 96 226 12.1570 15.1963 22.7945 65.7852 Constraint 88 226 15.2074 19.0093 28.5140 65.7794 Constraint 144 341 17.7793 22.2241 33.3361 65.7641 Constraint 122 350 14.0488 17.5610 26.3415 65.6817 Constraint 122 412 11.4740 14.3425 21.5137 65.5802 Constraint 122 404 11.9539 14.9423 22.4135 65.5802 Constraint 113 412 14.5360 18.1700 27.2550 65.5802 Constraint 113 404 14.8842 18.6053 27.9080 65.5802 Constraint 190 449 12.0064 15.0080 22.5120 65.4208 Constraint 237 449 8.1100 10.1375 15.2063 65.4025 Constraint 113 442 11.9166 14.8957 22.3436 65.3237 Constraint 88 435 12.2472 15.3091 22.9636 65.2385 Constraint 88 429 8.7777 10.9721 16.4582 65.2385 Constraint 88 421 8.6668 10.8336 16.2503 65.2385 Constraint 88 412 12.4138 15.5172 23.2759 65.2385 Constraint 88 404 11.9222 14.9028 22.3542 65.2385 Constraint 250 449 11.7046 14.6308 21.9462 65.2240 Constraint 153 242 10.9483 13.6854 20.5281 65.1928 Constraint 128 449 6.6636 8.3295 12.4943 65.0397 Constraint 104 449 9.0695 11.3369 17.0053 65.0397 Constraint 169 375 17.4876 21.8595 32.7892 64.9277 Constraint 279 368 12.6496 15.8119 23.7179 64.4590 Constraint 279 360 10.8108 13.5135 20.2702 64.4590 Constraint 272 368 14.1034 17.6292 26.4438 64.4590 Constraint 272 360 12.0089 15.0111 22.5167 64.4590 Constraint 267 368 11.6605 14.5756 21.8634 64.4590 Constraint 267 360 10.7038 13.3798 20.0697 64.4590 Constraint 250 368 10.7579 13.4474 20.1711 64.4151 Constraint 250 360 11.2648 14.0810 21.1214 64.4151 Constraint 201 449 9.1570 11.4463 17.1695 64.4044 Constraint 226 368 15.1240 18.9050 28.3575 64.2518 Constraint 226 360 13.9440 17.4300 26.1450 64.2518 Constraint 221 368 12.4653 15.5816 23.3724 64.2518 Constraint 221 360 10.6900 13.3625 20.0438 64.2518 Constraint 122 399 10.4540 13.0675 19.6013 64.1979 Constraint 113 399 12.5923 15.7404 23.6106 64.1979 Constraint 144 435 13.5204 16.9005 25.3508 64.1659 Constraint 144 429 11.9727 14.9659 22.4488 64.1659 Constraint 122 355 15.1090 18.8862 28.3294 64.1271 Constraint 113 355 15.4372 19.2965 28.9447 64.1271 Constraint 136 355 17.6092 22.0115 33.0172 64.0958 Constraint 136 449 9.8028 12.2535 18.3802 64.0691 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 153 330 15.1837 18.9796 28.4694 64.0452 Constraint 153 322 11.1467 13.9334 20.9000 64.0452 Constraint 303 467 17.5720 21.9650 32.9475 64.0416 Constraint 303 461 15.6253 19.5316 29.2974 64.0416 Constraint 297 467 17.6355 22.0444 33.0666 64.0416 Constraint 297 461 15.0957 18.8697 28.3045 64.0416 Constraint 292 467 15.1832 18.9791 28.4686 64.0416 Constraint 292 461 12.6116 15.7645 23.6467 64.0416 Constraint 285 461 15.2428 19.0535 28.5803 64.0416 Constraint 279 461 17.9048 22.3810 33.5715 64.0416 Constraint 272 461 16.2829 20.3537 30.5305 64.0416 Constraint 267 461 17.3266 21.6583 32.4874 64.0416 Constraint 259 461 13.9814 17.4767 26.2151 64.0416 Constraint 210 461 10.6273 13.2841 19.9261 64.0416 Constraint 182 467 16.6290 20.7862 31.1793 64.0416 Constraint 182 461 13.6385 17.0481 25.5722 64.0416 Constraint 176 461 14.3706 17.9632 26.9448 64.0416 Constraint 128 467 12.4955 15.6194 23.4291 64.0416 Constraint 128 461 9.1306 11.4132 17.1199 64.0416 Constraint 104 467 13.6752 17.0941 25.6411 64.0416 Constraint 104 461 10.7731 13.4664 20.1997 64.0416 Constraint 330 449 13.2472 16.5590 24.8385 64.0038 Constraint 88 442 11.3327 14.1659 21.2488 63.9050 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 88 355 12.0749 15.0937 22.6405 63.7853 Constraint 355 449 14.1716 17.7146 26.5718 63.3466 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 153 250 14.4503 18.0628 27.0942 63.3017 Constraint 144 421 11.7317 14.6646 21.9970 63.1496 Constraint 153 226 11.1331 13.9164 20.8746 63.1384 Constraint 144 350 17.7531 22.1914 33.2870 62.7699 Constraint 226 449 11.0877 13.8596 20.7895 62.4025 Constraint 113 449 9.1549 11.4437 17.1655 62.3815 Constraint 169 368 17.1135 21.3919 32.0879 62.3568 Constraint 169 360 14.2884 17.8606 26.7908 62.3568 Constraint 285 467 17.0545 21.3181 31.9771 62.3227 Constraint 272 467 18.8224 23.5281 35.2921 62.3227 Constraint 267 467 19.3302 24.1628 36.2442 62.3227 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 360 435 10.9784 13.7230 20.5845 62.0836 Constraint 144 404 15.7542 19.6928 29.5392 62.0727 Constraint 136 467 14.6988 18.3734 27.5602 62.0547 Constraint 136 461 11.2644 14.0806 21.1208 62.0547 Constraint 404 467 8.6062 10.7577 16.1365 61.9484 Constraint 96 467 10.9026 13.6283 20.4424 61.9484 Constraint 96 461 8.2043 10.2554 15.3831 61.9484 Constraint 96 449 6.4940 8.1175 12.1762 61.9484 Constraint 153 341 17.1473 21.4342 32.1512 61.4742 Constraint 190 461 15.9409 19.9261 29.8892 61.3834 Constraint 161 449 9.9768 12.4710 18.7065 61.3580 Constraint 259 467 15.6711 19.5889 29.3833 61.3064 Constraint 210 467 13.2030 16.5038 24.7556 61.3064 Constraint 176 467 17.3814 21.7268 32.5901 61.3064 Constraint 144 399 14.7018 18.3772 27.5658 61.2860 Constraint 314 467 13.8978 17.3723 26.0584 61.1298 Constraint 314 461 11.7460 14.6825 22.0237 61.1298 Constraint 169 461 10.3797 12.9746 19.4619 61.0841 Constraint 153 350 16.8883 21.1103 31.6655 61.0510 Constraint 221 461 14.0084 17.5105 26.2657 61.0416 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 360 442 10.5877 13.2346 19.8519 60.7501 Constraint 122 449 5.3720 6.7150 10.0724 60.6626 Constraint 201 461 13.1752 16.4690 24.7036 60.3671 Constraint 122 467 9.5473 11.9341 17.9012 60.3671 Constraint 122 461 6.4221 8.0276 12.0414 60.3671 Constraint 113 467 12.1316 15.1645 22.7468 60.3671 Constraint 113 461 9.4689 11.8362 17.7542 60.3671 Constraint 242 467 13.1929 16.4912 24.7367 60.3608 Constraint 242 461 11.0461 13.8077 20.7115 60.3608 Constraint 399 467 8.9970 11.2463 16.8694 60.1612 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 350 467 16.2382 20.2978 30.4467 60.1612 Constraint 350 461 15.0219 18.7774 28.1660 60.1612 Constraint 341 467 18.3556 22.9445 34.4168 60.1612 Constraint 341 461 16.8026 21.0033 31.5050 60.1612 Constraint 161 461 12.3573 15.4466 23.1699 60.1135 Constraint 144 442 11.0201 13.7751 20.6626 60.0972 Constraint 88 449 8.2624 10.3279 15.4919 59.9465 Constraint 153 435 10.5821 13.2276 19.8413 59.9392 Constraint 153 429 10.2938 12.8672 19.3008 59.9392 Constraint 153 421 9.6523 12.0654 18.0981 59.9392 Constraint 279 467 19.9789 24.9736 37.4604 59.4860 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 297 11.5214 14.4017 21.6026 59.4573 Constraint 80 292 11.3872 14.2340 21.3511 59.4573 Constraint 80 285 13.7436 17.1796 25.7693 59.4573 Constraint 80 279 15.3431 19.1788 28.7682 59.4573 Constraint 80 272 15.0930 18.8662 28.2993 59.4573 Constraint 80 267 16.5109 20.6386 30.9580 59.4573 Constraint 80 259 14.6814 18.3517 27.5276 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 80 182 11.9628 14.9535 22.4303 59.4573 Constraint 80 176 13.9781 17.4726 26.2090 59.4573 Constraint 80 169 12.2715 15.3394 23.0090 59.4573 Constraint 80 161 14.2582 17.8228 26.7341 59.4573 Constraint 169 467 13.7110 17.1388 25.7082 59.3652 Constraint 144 412 14.6061 18.2576 27.3864 59.3374 Constraint 322 467 14.6646 18.3308 27.4962 59.0366 Constraint 322 461 11.7030 14.6288 21.9432 59.0366 Constraint 88 467 9.8977 12.3721 18.5582 58.9484 Constraint 88 461 7.9832 9.9790 14.9685 58.9484 Constraint 237 467 13.9341 17.4176 26.1263 58.6481 Constraint 237 461 11.4038 14.2547 21.3821 58.6481 Constraint 201 467 16.0136 20.0170 30.0254 58.6481 Constraint 190 467 18.6642 23.3303 34.9954 58.6481 Constraint 153 442 7.8647 9.8308 14.7463 58.6058 Constraint 80 242 13.8726 17.3408 26.0111 58.5117 Constraint 153 355 18.3886 22.9857 34.4786 58.4800 Constraint 250 461 14.5534 18.1918 27.2877 58.4696 Constraint 161 467 15.8119 19.7648 29.6472 58.3946 Constraint 221 467 16.2474 20.3092 30.4638 58.3064 Constraint 80 330 8.8597 11.0746 16.6119 58.2658 Constraint 153 399 13.3627 16.7034 25.0550 58.2508 Constraint 80 355 12.3486 15.4358 23.1536 58.1658 Constraint 80 350 11.4497 14.3122 21.4683 58.1658 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 153 412 11.9549 14.9436 22.4154 57.8460 Constraint 153 404 13.6982 17.1227 25.6841 57.8460 Constraint 355 467 15.5985 19.4981 29.2472 57.5903 Constraint 355 461 15.0302 18.7877 28.1816 57.5903 Constraint 330 467 17.9410 22.4262 33.6393 57.2494 Constraint 330 461 15.4076 19.2595 28.8893 57.2494 Constraint 128 391 12.0854 15.1068 22.6602 57.1115 Constraint 128 382 15.1864 18.9830 28.4745 57.1115 Constraint 122 391 12.4687 15.5858 23.3787 57.1115 Constraint 122 382 14.9938 18.7422 28.1133 57.1115 Constraint 113 391 14.6419 18.3024 27.4536 57.1115 Constraint 113 382 17.5753 21.9692 32.9538 57.1115 Constraint 104 391 12.6815 15.8518 23.7778 57.1115 Constraint 104 382 16.1573 20.1966 30.2949 57.1115 Constraint 314 473 11.5381 14.4226 21.6340 56.9395 Constraint 303 473 15.1901 18.9876 28.4814 56.9395 Constraint 297 473 15.8813 19.8516 29.7773 56.9395 Constraint 136 473 15.5399 19.4249 29.1374 56.9395 Constraint 128 473 12.6468 15.8085 23.7127 56.9395 Constraint 104 473 13.4631 16.8289 25.2434 56.9395 Constraint 144 467 12.6839 15.8548 23.7822 56.8595 Constraint 144 461 9.2378 11.5472 17.3209 56.8595 Constraint 80 237 15.5348 19.4186 29.1278 56.7990 Constraint 80 201 15.0369 18.7961 28.1942 56.7990 Constraint 80 190 15.8660 19.8325 29.7488 56.7990 Constraint 250 467 16.0499 20.0623 30.0935 56.6825 Constraint 80 250 17.6755 22.0944 33.1416 56.6205 Constraint 104 480 14.3951 17.9938 26.9908 56.5369 Constraint 80 221 14.3677 17.9597 26.9395 56.4573 Constraint 382 449 11.9282 14.9103 22.3654 56.3613 Constraint 161 355 20.7826 25.9782 38.9674 56.2097 Constraint 136 391 15.8212 19.7765 29.6648 56.1409 Constraint 136 382 18.9301 23.6627 35.4940 56.1409 Constraint 144 449 8.3740 10.4676 15.7013 56.1387 Constraint 96 391 9.1738 11.4673 17.2009 56.1134 Constraint 96 382 12.4647 15.5809 23.3713 56.1134 Constraint 80 435 15.4644 19.3305 28.9958 56.0639 Constraint 80 429 12.0844 15.1055 22.6582 56.0639 Constraint 80 421 11.1311 13.9138 20.8708 56.0639 Constraint 80 412 15.0555 18.8194 28.2291 56.0639 Constraint 80 404 15.0448 18.8060 28.2090 56.0639 Constraint 314 480 13.5055 16.8819 25.3228 55.8344 Constraint 303 480 17.1608 21.4510 32.1766 55.8344 Constraint 128 375 15.7178 19.6473 29.4709 55.8134 Constraint 122 375 14.6804 18.3505 27.5258 55.8134 Constraint 113 375 16.8144 21.0180 31.5271 55.8134 Constraint 104 375 15.8625 19.8281 29.7422 55.8134 Constraint 96 375 11.9794 14.9742 22.4613 55.8134 Constraint 226 467 17.2078 21.5098 32.2647 55.6481 Constraint 226 461 14.6148 18.2685 27.4028 55.6481 Constraint 136 480 16.3875 20.4844 30.7266 55.5389 Constraint 161 391 17.2772 21.5965 32.3948 55.5357 Constraint 161 382 20.0355 25.0444 37.5666 55.5357 Constraint 144 355 18.7134 23.3917 35.0875 55.4800 Constraint 341 480 17.0513 21.3142 31.9713 55.4600 Constraint 330 480 17.1267 21.4084 32.1126 55.4600 Constraint 322 480 14.8543 18.5678 27.8518 55.4600 Constraint 375 449 12.4316 15.5394 23.3092 55.3633 Constraint 421 480 10.4981 13.1226 19.6839 55.3408 Constraint 292 473 13.1206 16.4007 24.6011 55.2206 Constraint 285 473 14.5550 18.1937 27.2906 55.2206 Constraint 279 473 17.8913 22.3642 33.5462 55.2206 Constraint 272 473 17.2012 21.5015 32.2523 55.2206 Constraint 267 473 17.1169 21.3961 32.0942 55.2206 Constraint 182 473 15.3557 19.1946 28.7919 55.2206 Constraint 412 473 8.9148 11.1434 16.7152 55.0347 Constraint 404 473 6.1353 7.6691 11.5037 55.0347 Constraint 153 449 6.3721 7.9651 11.9477 54.9472 Constraint 80 399 11.6889 14.6111 21.9166 54.8724 Constraint 322 473 13.0305 16.2881 24.4321 54.8463 Constraint 96 473 10.2539 12.8174 19.2260 54.8463 Constraint 297 480 17.9075 22.3844 33.5766 54.8363 Constraint 285 480 17.3095 21.6368 32.4552 54.8180 Constraint 80 442 13.8777 17.3471 26.0207 54.7304 Constraint 161 375 21.1066 26.3833 39.5749 54.6506 Constraint 259 473 13.4035 16.7543 25.1315 54.2042 Constraint 210 473 12.2964 15.3705 23.0558 54.2042 Constraint 176 473 17.0504 21.3130 31.9696 54.2042 Constraint 169 473 13.7872 17.2340 25.8510 54.2042 Constraint 88 391 11.8314 14.7893 22.1839 54.1115 Constraint 88 382 14.4142 18.0178 27.0267 54.1115 Constraint 341 473 15.7503 19.6879 29.5318 54.0572 Constraint 153 467 11.9314 14.9143 22.3714 53.9491 Constraint 153 461 8.1479 10.1849 15.2774 53.9491 Constraint 292 480 15.6135 19.5169 29.2754 53.8200 Constraint 272 480 19.8375 24.7969 37.1954 53.8200 Constraint 267 480 19.9833 24.9791 37.4686 53.8200 Constraint 259 480 16.5408 20.6760 31.0140 53.8200 Constraint 210 480 14.9194 18.6493 27.9739 53.8200 Constraint 182 480 17.5854 21.9817 32.9726 53.8200 Constraint 176 480 19.3251 24.1564 36.2346 53.8200 Constraint 169 480 15.8474 19.8092 29.7138 53.8200 Constraint 161 480 18.2764 22.8455 34.2683 53.8200 Constraint 128 480 13.9592 17.4490 26.1735 53.8200 Constraint 80 226 17.2108 21.5135 32.2703 53.7990 Constraint 399 480 8.8126 11.0157 16.5236 53.6524 Constraint 161 473 16.7035 20.8794 31.3191 53.3946 Constraint 122 473 10.5958 13.2447 19.8671 53.2649 Constraint 113 473 12.9923 16.2403 24.3605 53.2649 Constraint 242 473 11.4534 14.3168 21.4752 53.2587 Constraint 412 480 12.4549 15.5686 23.3529 53.2475 Constraint 404 480 9.7235 12.1544 18.2316 53.2475 Constraint 399 473 5.6590 7.0738 10.6107 53.2475 Constraint 128 368 15.3056 19.1320 28.6981 53.2425 Constraint 128 360 11.8528 14.8161 22.2241 53.2425 Constraint 122 368 15.1560 18.9450 28.4175 53.2425 Constraint 122 360 11.8004 14.7506 22.1258 53.2425 Constraint 113 368 17.0331 21.2914 31.9371 53.2425 Constraint 113 360 13.0997 16.3746 24.5619 53.2425 Constraint 104 368 15.2357 19.0447 28.5670 53.2425 Constraint 104 360 11.1395 13.9244 20.8866 53.2425 Constraint 96 368 11.6186 14.5232 21.7848 53.2425 Constraint 96 360 7.7682 9.7103 14.5654 53.2425 Constraint 350 473 13.1449 16.4311 24.6467 53.0591 Constraint 330 473 15.8812 19.8515 29.7772 53.0591 Constraint 242 480 14.6633 18.3292 27.4938 52.8744 Constraint 88 375 12.9312 16.1640 24.2460 52.8134 Constraint 368 449 12.9133 16.1416 24.2124 52.7923 Constraint 360 449 10.3388 12.9234 19.3852 52.7923 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 144 473 14.1511 17.6888 26.5332 52.6692 Constraint 136 360 15.2613 19.0766 28.6149 52.2719 Constraint 113 480 13.0066 16.2583 24.3875 52.1598 Constraint 279 480 20.3709 25.4637 38.1955 51.9995 Constraint 88 473 10.1493 12.6866 19.0299 51.8463 Constraint 350 480 14.9533 18.6916 28.0374 51.7450 Constraint 96 480 11.3505 14.1881 21.2822 51.7450 Constraint 144 375 18.8122 23.5152 35.2728 51.6872 Constraint 161 360 17.7882 22.2352 33.3528 51.6667 Constraint 237 473 13.3230 16.6537 24.9805 51.5460 Constraint 201 473 15.7398 19.6748 29.5122 51.5460 Constraint 190 473 17.6705 22.0882 33.1322 51.5460 Constraint 144 391 16.1937 20.2421 30.3631 51.4644 Constraint 250 473 14.3353 17.9191 26.8787 51.3675 Constraint 144 382 18.7562 23.4452 35.1678 51.2663 Constraint 221 473 14.6129 18.2662 27.3992 51.2042 Constraint 153 391 14.3310 17.9137 26.8706 51.1644 Constraint 237 480 16.3639 20.4548 30.6822 51.1617 Constraint 201 480 18.3194 22.8992 34.3488 51.1617 Constraint 190 480 20.3489 25.4361 38.1542 51.1617 Constraint 153 480 14.4429 18.0537 27.0805 51.1617 Constraint 144 480 14.2512 17.8141 26.7211 51.1617 Constraint 122 480 11.0746 13.8433 20.7649 51.1617 Constraint 136 368 18.9146 23.6433 35.4649 51.0574 Constraint 250 480 17.7012 22.1264 33.1897 50.9832 Constraint 80 449 11.0067 13.7584 20.6376 50.9718 Constraint 221 480 17.5083 21.8853 32.8280 50.8200 Constraint 355 473 12.1684 15.2105 22.8158 50.4881 Constraint 88 368 13.4767 16.8458 25.2687 50.2425 Constraint 88 360 9.7651 12.2064 18.3096 50.2425 Constraint 80 467 13.4173 16.7717 25.1575 49.9555 Constraint 80 461 11.0165 13.7706 20.6560 49.9555 Constraint 153 382 16.5907 20.7384 31.1076 49.9500 Constraint 153 473 13.1588 16.4485 24.6727 49.7588 Constraint 88 480 9.5905 11.9881 17.9821 49.7248 Constraint 391 467 12.5117 15.6397 23.4595 49.6070 Constraint 391 461 11.5202 14.4002 21.6004 49.6070 Constraint 382 467 12.8879 16.1098 24.1647 49.6070 Constraint 382 461 12.8336 16.0420 24.0629 49.6070 Constraint 375 467 11.7133 14.6416 21.9624 49.6070 Constraint 375 461 12.3793 15.4741 23.2112 49.6070 Constraint 161 368 20.8948 26.1184 39.1777 49.3444 Constraint 144 360 16.0086 20.0108 30.0162 49.3143 Constraint 355 480 13.4912 16.8640 25.2960 49.1740 Constraint 153 375 17.4758 21.8448 32.7672 48.9519 Constraint 226 473 16.2488 20.3110 30.4665 48.5460 Constraint 226 480 19.2850 24.1063 36.1594 48.1617 Constraint 136 375 18.6792 23.3489 35.0234 47.6380 Constraint 153 360 14.6711 18.3388 27.5083 47.5954 Constraint 368 467 14.2511 17.8138 26.7208 47.0360 Constraint 368 461 13.9886 17.4858 26.2286 47.0360 Constraint 360 467 12.6759 15.8448 23.7672 47.0360 Constraint 360 461 11.6849 14.6061 21.9091 47.0360 Constraint 80 391 13.6811 17.1013 25.6520 46.6210 Constraint 80 382 16.8194 21.0243 31.5364 46.6210 Constraint 80 375 15.1809 18.9761 28.4641 46.5210 Constraint 80 368 15.1524 18.9405 28.4108 46.5210 Constraint 80 360 10.9690 13.7112 20.5668 46.5210 Constraint 153 368 17.5292 21.9115 32.8673 46.3810 Constraint 144 368 19.2169 24.0212 36.0317 46.3810 Constraint 80 473 13.4264 16.7830 25.1746 46.3767 Constraint 80 480 13.0595 16.3244 24.4866 44.1689 Constraint 391 480 12.7626 15.9533 23.9299 43.9077 Constraint 382 480 13.1898 16.4873 24.7309 43.9077 Constraint 391 473 9.5624 11.9530 17.9296 43.5029 Constraint 382 473 9.9022 12.3778 18.5667 43.5029 Constraint 375 480 10.7807 13.4759 20.2139 42.9096 Constraint 375 473 7.8248 9.7810 14.6715 42.5048 Constraint 360 480 12.0384 15.0480 22.5720 40.3387 Constraint 368 473 10.5715 13.2144 19.8216 39.9339 Constraint 360 473 9.4098 11.7622 17.6433 39.9339 Constraint 303 489 16.0683 20.0853 30.1280 39.5726 Constraint 368 480 13.2016 16.5020 24.7530 38.6198 Constraint 314 489 12.4112 15.5140 23.2711 38.5745 Constraint 297 489 15.9435 19.9294 29.8942 38.5745 Constraint 429 489 6.7792 8.4740 12.7110 38.3582 Constraint 421 489 9.0995 11.3744 17.0615 38.3582 Constraint 136 489 13.2511 16.5638 24.8457 37.5582 Constraint 128 489 11.2404 14.0505 21.0757 37.5582 Constraint 104 489 11.5526 14.4407 21.6610 37.5582 Constraint 341 489 16.1817 20.2272 30.3407 37.4794 Constraint 330 489 15.3793 19.2241 28.8362 37.4794 Constraint 279 489 18.7547 23.4434 35.1651 36.8556 Constraint 399 489 9.1411 11.4264 17.1395 36.6698 Constraint 350 489 14.7651 18.4564 27.6846 36.4813 Constraint 322 489 12.5155 15.6444 23.4665 36.4813 Constraint 96 489 9.2763 11.5954 17.3932 36.4813 Constraint 314 497 9.4807 11.8508 17.7763 36.3036 Constraint 303 497 13.1228 16.4035 24.6053 36.3036 Constraint 297 497 13.5196 16.8995 25.3493 36.3036 Constraint 292 497 11.5682 14.4603 21.6904 36.3036 Constraint 285 497 13.5291 16.9114 25.3670 36.3036 Constraint 182 497 13.5497 16.9371 25.4057 36.3036 Constraint 128 497 10.3763 12.9704 19.4556 36.3036 Constraint 104 497 10.2809 12.8511 19.2767 36.3036 Constraint 412 489 11.7543 14.6929 22.0393 36.2650 Constraint 404 489 10.3346 12.9183 19.3774 36.2650 Constraint 435 497 9.0386 11.2982 16.9473 36.0872 Constraint 429 497 5.5055 6.8819 10.3228 36.0872 Constraint 421 497 6.5914 8.2393 12.3589 36.0872 Constraint 292 489 13.5271 16.9088 25.3633 35.8393 Constraint 285 489 15.8672 19.8340 29.7510 35.8393 Constraint 272 489 17.6497 22.0621 33.0932 35.8393 Constraint 267 489 18.4157 23.0197 34.5295 35.8393 Constraint 259 489 15.0921 18.8651 28.2977 35.8393 Constraint 210 489 12.3674 15.4593 23.1889 35.8393 Constraint 182 489 14.8375 18.5469 27.8204 35.8393 Constraint 176 489 16.3222 20.4028 30.6041 35.8393 Constraint 169 489 12.7824 15.9780 23.9670 35.8393 Constraint 161 489 14.9901 18.7376 28.1064 35.8393 Constraint 136 497 12.5924 15.7405 23.6108 35.2873 Constraint 113 489 10.5398 13.1747 19.7621 34.9000 Constraint 242 489 13.1149 16.3937 24.5905 34.8937 Constraint 221 489 15.3423 19.1778 28.7668 34.8393 Constraint 279 497 16.0308 20.0385 30.0577 34.5847 Constraint 272 497 15.3422 19.1777 28.7666 34.5847 Constraint 259 497 12.5506 15.6883 23.5324 34.5847 Constraint 399 497 6.1548 7.6934 11.5402 34.3988 Constraint 267 497 15.6667 19.5833 29.3750 34.2847 Constraint 330 497 12.7120 15.8899 23.8349 34.2104 Constraint 322 497 10.0365 12.5456 18.8185 34.2104 Constraint 96 497 7.2143 9.0179 13.5269 34.2104 Constraint 88 497 6.9196 8.6495 12.9743 34.2104 Constraint 412 497 9.3652 11.7065 17.5597 33.9940 Constraint 404 497 8.2217 10.2772 15.4158 33.9940 Constraint 355 497 10.3835 12.9794 19.4690 33.9104 Constraint 355 489 13.5930 16.9913 25.4869 33.9104 Constraint 350 497 11.5111 14.3889 21.5833 33.9104 Constraint 341 497 13.0055 16.2568 24.3853 33.9104 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 210 497 10.4353 13.0442 19.5663 33.5683 Constraint 176 497 14.9365 18.6706 28.0059 33.5683 Constraint 169 497 11.8476 14.8095 22.2142 33.5683 Constraint 161 497 14.8553 18.5691 27.8537 33.5683 Constraint 237 489 14.6771 18.3463 27.5195 33.1810 Constraint 201 489 15.5721 19.4651 29.1976 33.1810 Constraint 190 489 17.6705 22.0881 33.1321 33.1810 Constraint 153 489 11.4660 14.3325 21.4987 33.1810 Constraint 144 489 10.9881 13.7351 20.6027 33.1810 Constraint 122 489 7.9151 9.8939 14.8408 33.1810 Constraint 250 489 16.4933 20.6167 30.9250 33.0025 Constraint 122 497 8.3203 10.4003 15.6005 32.6290 Constraint 113 497 10.0390 12.5487 18.8230 32.6290 Constraint 242 497 10.5759 13.2199 19.8298 32.6228 Constraint 221 497 12.8995 16.1244 24.1866 32.5683 Constraint 226 489 17.2115 21.5144 32.2716 32.1810 Constraint 80 497 10.1617 12.7022 19.0533 31.3027 Constraint 201 497 14.0853 17.6066 26.4100 30.9101 Constraint 144 497 11.3562 14.1952 21.2929 30.9101 Constraint 237 497 12.6556 15.8195 23.7293 30.6101 Constraint 190 497 15.7600 19.7001 29.5501 30.6101 Constraint 153 497 11.1774 13.9718 20.9577 30.6101 Constraint 250 497 13.8580 17.3225 25.9837 30.4316 Constraint 80 489 10.8320 13.5399 20.3099 30.1864 Constraint 330 511 14.9977 18.7471 28.1206 29.6490 Constraint 314 511 12.0551 15.0689 22.6033 29.6490 Constraint 104 511 13.8958 17.3698 26.0546 29.6490 Constraint 226 497 14.9919 18.7399 28.1098 29.6101 Constraint 341 511 14.4054 18.0067 27.0100 29.3490 Constraint 399 511 7.5655 9.4569 14.1853 28.8394 Constraint 322 511 12.9618 16.2023 24.3034 28.6510 Constraint 435 511 11.3719 14.2149 21.3224 28.4346 Constraint 429 511 8.1092 10.1365 15.2047 28.4346 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 412 511 11.6291 14.5364 21.8046 28.4346 Constraint 404 511 9.7793 12.2241 18.3362 28.4346 Constraint 355 511 10.4991 13.1239 19.6859 28.3510 Constraint 350 511 12.6694 15.8367 23.7551 28.3510 Constraint 303 511 14.9836 18.7294 28.0942 27.9301 Constraint 80 511 12.3230 15.4038 23.1057 27.6413 Constraint 136 511 16.2217 20.2771 30.4156 27.6346 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 322 604 13.7541 17.1926 25.7890 27.0357 Constraint 297 511 16.0765 20.0956 30.1435 26.9321 Constraint 292 511 14.0571 17.5714 26.3571 26.9321 Constraint 285 511 15.1659 18.9574 28.4361 26.9321 Constraint 279 511 18.4658 23.0823 34.6234 26.9321 Constraint 128 511 13.7110 17.1387 25.7081 26.9321 Constraint 96 511 9.8797 12.3496 18.5244 26.9321 Constraint 88 511 8.8674 11.0843 16.6264 26.9321 Constraint 391 489 12.2902 15.3627 23.0441 26.9251 Constraint 382 489 13.7153 17.1441 25.7161 26.9251 Constraint 314 604 13.5970 16.9963 25.4944 26.7357 Constraint 292 604 14.6236 18.2796 27.4193 26.1627 Constraint 259 604 16.1771 20.2214 30.3321 26.1627 Constraint 285 613 18.0032 22.5040 33.7561 26.1506 Constraint 375 489 12.1843 15.2304 22.8456 25.9271 Constraint 210 511 13.8611 17.3264 25.9896 25.9157 Constraint 182 511 16.3870 20.4838 30.7257 25.9157 Constraint 169 511 15.6929 19.6162 29.4242 25.9157 Constraint 161 511 18.7462 23.4327 35.1491 25.9157 Constraint 272 511 18.2162 22.7703 34.1554 25.6157 Constraint 267 511 17.6693 22.0866 33.1300 25.6157 Constraint 259 511 14.4652 18.0815 27.1223 25.6157 Constraint 221 511 15.6642 19.5803 29.3704 25.6157 Constraint 176 511 18.6169 23.2711 34.9067 25.6157 Constraint 210 599 14.5908 18.2385 27.3578 25.5029 Constraint 303 622 16.9005 21.1256 31.6884 25.4838 Constraint 303 613 16.7772 20.9715 31.4573 25.4838 Constraint 297 622 17.5472 21.9339 32.9009 25.4838 Constraint 341 613 16.6960 20.8700 31.3050 25.4156 Constraint 113 585 16.8605 21.0756 31.6134 25.3864 Constraint 182 599 15.3280 19.1600 28.7400 25.2790 Constraint 297 604 14.7717 18.4646 27.6969 25.2560 Constraint 297 613 17.3368 21.6710 32.5065 25.1506 Constraint 330 613 17.0955 21.3694 32.0541 24.9364 Constraint 303 604 14.2985 17.8731 26.8096 24.7357 Constraint 242 511 12.7588 15.9485 23.9228 24.6701 Constraint 391 497 9.4664 11.8330 17.7496 24.6542 Constraint 382 497 11.2760 14.0950 21.1425 24.6542 Constraint 104 604 17.2420 21.5525 32.3288 24.5437 Constraint 279 622 18.3925 22.9907 34.4860 24.4838 Constraint 88 585 16.1364 20.1705 30.2557 24.3095 Constraint 297 599 14.7210 18.4012 27.6018 24.2791 Constraint 297 590 16.5693 20.7117 31.0675 24.2791 Constraint 341 622 17.5076 21.8845 32.8268 24.2696 Constraint 330 622 17.7245 22.1557 33.2335 24.2696 Constraint 210 585 16.9088 21.1360 31.7039 24.2067 Constraint 314 585 15.2569 19.0712 28.6068 24.1896 Constraint 285 604 15.1179 18.8973 28.3460 24.1628 Constraint 182 613 17.3353 21.6692 32.5038 24.1342 Constraint 341 604 14.3406 17.9257 26.8886 24.0945 Constraint 391 511 11.1040 13.8800 20.8201 23.9909 Constraint 382 511 12.2997 15.3746 23.0619 23.9909 Constraint 303 629 16.1086 20.1358 30.2037 23.8546 Constraint 285 629 16.3516 20.4395 30.6592 23.6864 Constraint 176 590 18.8050 23.5062 35.2593 23.5962 Constraint 176 599 16.5647 20.7059 31.0588 23.5029 Constraint 375 497 9.4339 11.7923 17.6885 23.3561 Constraint 368 497 10.7808 13.4760 20.2141 23.3561 Constraint 368 489 13.9653 17.4566 26.1849 23.3561 Constraint 360 497 8.1803 10.2254 15.3380 23.3561 Constraint 360 489 11.4809 14.3511 21.5266 23.3561 Constraint 272 629 17.1913 21.4891 32.2336 23.3531 Constraint 182 629 16.1819 20.2274 30.3411 23.3531 Constraint 303 599 13.8992 17.3740 26.0611 23.3318 Constraint 355 604 16.1953 20.2441 30.3661 23.2887 Constraint 292 590 16.4448 20.5560 30.8340 23.2627 Constraint 182 590 16.8983 21.1229 31.6843 23.2627 Constraint 144 511 14.6605 18.3257 27.4885 23.2575 Constraint 122 511 10.6985 13.3732 20.0597 23.2575 Constraint 113 511 12.4865 15.6081 23.4121 23.2575 Constraint 322 599 13.4896 16.8621 25.2931 23.1858 Constraint 314 599 13.0929 16.3662 24.5492 23.1858 Constraint 292 599 13.9940 17.4925 26.2388 23.1858 Constraint 279 604 15.8097 19.7622 29.6432 23.1628 Constraint 272 604 15.9534 19.9417 29.9126 23.1628 Constraint 267 604 16.6828 20.8535 31.2803 23.1628 Constraint 190 604 16.9937 21.2421 31.8632 23.1628 Constraint 182 604 14.4787 18.0984 27.1476 23.1628 Constraint 237 511 15.4244 19.2805 28.9208 22.9575 Constraint 226 511 17.8535 22.3169 33.4753 22.9575 Constraint 201 511 17.4179 21.7723 32.6585 22.9575 Constraint 190 511 19.0843 23.8554 35.7831 22.9575 Constraint 153 511 14.6527 18.3159 27.4739 22.9575 Constraint 104 599 16.7167 20.8958 31.3438 22.9545 Constraint 330 604 14.4609 18.0761 27.1142 22.9486 Constraint 421 604 12.3039 15.3798 23.0697 22.8535 Constraint 421 613 13.9530 17.4412 26.1618 22.8433 Constraint 250 511 15.7306 19.6632 29.4948 22.7790 Constraint 375 511 9.5925 11.9906 17.9859 22.6928 Constraint 368 511 11.4803 14.3504 21.5256 22.6928 Constraint 360 511 9.7306 12.1633 18.2449 22.6928 Constraint 297 629 16.1506 20.1883 30.2825 22.6864 Constraint 267 629 17.5086 21.8857 32.8286 22.6864 Constraint 350 613 18.0156 22.5195 33.7793 22.6098 Constraint 128 585 16.7293 20.9116 31.3674 22.5496 Constraint 104 585 15.9460 19.9326 29.8988 22.5496 Constraint 360 585 16.3249 20.4061 30.6091 22.5195 Constraint 322 590 14.9860 18.7324 28.0987 22.4858 Constraint 314 636 16.9474 21.1843 31.7764 22.3522 Constraint 96 585 17.5210 21.9012 32.8518 22.3133 Constraint 279 629 16.8897 21.1122 31.6683 22.2816 Constraint 297 585 15.7998 19.7498 29.6247 22.1896 Constraint 182 585 16.6521 20.8152 31.2228 22.1896 Constraint 314 590 14.5520 18.1900 27.2850 22.1858 Constraint 303 590 15.2990 19.1237 28.6855 22.1858 Constraint 285 599 14.1882 17.7352 26.6028 22.1858 Constraint 285 590 16.6635 20.8293 31.2440 22.1858 Constraint 279 599 15.0727 18.8409 28.2614 22.1858 Constraint 272 599 15.4284 19.2855 28.9282 22.1858 Constraint 267 599 15.7583 19.6978 29.5467 22.1858 Constraint 267 590 18.5009 23.1261 34.6891 22.1858 Constraint 259 599 14.7744 18.4680 27.7020 22.1858 Constraint 585 651 12.2057 15.2572 22.8858 22.1681 Constraint 221 604 15.4576 19.3220 28.9830 22.1628 Constraint 104 519 14.4610 18.0763 27.1145 21.9745 Constraint 242 604 13.2459 16.5574 24.8361 21.9068 Constraint 237 604 13.9216 17.4020 26.1031 21.9068 Constraint 210 604 12.6337 15.7921 23.6882 21.9068 Constraint 285 622 16.5577 20.6971 31.0457 21.8943 Constraint 303 585 15.3118 19.1397 28.7096 21.8896 Constraint 292 585 16.2234 20.2793 30.4190 21.8896 Constraint 429 604 10.9050 13.6313 20.4469 21.8554 Constraint 259 585 18.1836 22.7295 34.0943 21.7963 Constraint 435 519 13.3743 16.7179 25.0769 21.7764 Constraint 429 519 10.5964 13.2455 19.8683 21.7764 Constraint 429 613 12.1009 15.1261 22.6891 21.6973 Constraint 590 657 12.4963 15.6204 23.4305 21.5939 Constraint 136 585 17.2587 21.5734 32.3601 21.5496 Constraint 341 590 15.3520 19.1899 28.7849 21.5446 Constraint 330 599 14.7721 18.4651 27.6976 21.5446 Constraint 279 590 17.3559 21.6948 32.5422 21.5191 Constraint 341 629 16.6788 20.8485 31.2728 21.4722 Constraint 330 629 16.6591 20.8239 31.2358 21.4722 Constraint 429 552 16.0214 20.0268 30.0402 21.2967 Constraint 421 552 15.7499 19.6874 29.5311 21.2967 Constraint 350 604 15.5639 19.4548 29.1823 21.2887 Constraint 303 651 18.3566 22.9457 34.4186 21.2516 Constraint 176 585 18.3146 22.8932 34.3399 21.2068 Constraint 399 519 10.7996 13.4996 20.2493 21.1813 Constraint 272 590 17.8960 22.3700 33.5550 21.1695 Constraint 190 599 16.1761 20.2202 30.3302 21.1695 Constraint 272 613 18.3396 22.9245 34.3867 21.1602 Constraint 169 604 14.9866 18.7333 28.1000 21.0462 Constraint 322 519 14.0935 17.6168 26.4253 20.9928 Constraint 330 519 15.3764 19.2205 28.8308 20.9909 Constraint 104 590 17.1635 21.4543 32.1815 20.9545 Constraint 242 613 14.5435 18.1794 27.2690 20.8947 Constraint 237 613 15.0748 18.8435 28.2652 20.8947 Constraint 272 622 17.7625 22.2031 33.3046 20.8943 Constraint 272 585 17.9990 22.4987 33.7481 20.8896 Constraint 210 577 15.4914 19.3643 29.0464 20.8781 Constraint 341 599 13.9095 17.3869 26.0803 20.8779 Constraint 435 604 13.8364 17.2955 25.9432 20.8689 Constraint 303 644 19.1972 23.9965 35.9948 20.8468 Constraint 421 519 11.3542 14.1928 21.2892 20.7765 Constraint 412 613 14.5973 18.2466 27.3699 20.7500 Constraint 404 604 12.1916 15.2395 22.8592 20.7468 Constraint 330 590 15.7183 19.6479 29.4719 20.6987 Constraint 341 519 15.3610 19.2012 28.8019 20.6909 Constraint 303 636 17.6938 22.1173 33.1759 20.6855 Constraint 285 636 18.4823 23.1029 34.6543 20.6855 Constraint 429 622 12.5757 15.7196 23.5793 20.6022 Constraint 421 622 13.2748 16.5935 24.8903 20.6022 Constraint 599 668 11.6152 14.5190 21.7785 20.5939 Constraint 590 668 13.6246 17.0308 25.5462 20.5939 Constraint 404 613 12.8277 16.0346 24.0519 20.5887 Constraint 322 622 14.3862 17.9827 26.9741 20.5775 Constraint 322 613 13.8439 17.3049 25.9573 20.5775 Constraint 314 622 13.6873 17.1092 25.6638 20.5775 Constraint 314 613 13.5213 16.9016 25.3524 20.5775 Constraint 292 613 15.2262 19.0327 28.5491 20.5775 Constraint 442 613 15.2501 19.0626 28.5939 20.5232 Constraint 279 613 18.0529 22.5661 33.8492 20.4935 Constraint 442 519 13.7850 17.2313 25.8470 20.4430 Constraint 128 599 16.3284 20.4105 30.6158 20.3812 Constraint 429 599 11.8571 14.8214 22.2320 20.3036 Constraint 421 599 12.0018 15.0022 22.5034 20.3036 Constraint 429 544 16.7728 20.9660 31.4489 20.2967 Constraint 429 535 12.4412 15.5515 23.3272 20.2967 Constraint 421 544 16.2039 20.2549 30.3824 20.2967 Constraint 96 519 11.4403 14.3003 21.4505 20.2739 Constraint 429 585 13.9206 17.4007 26.1011 20.1576 Constraint 449 519 11.2471 14.0589 21.0883 20.1430 Constraint 322 585 13.8564 17.3204 25.9807 20.0964 Constraint 350 629 17.6734 22.0917 33.1376 20.0713 Constraint 169 599 15.0585 18.8232 28.2347 20.0538 Constraint 314 577 14.1207 17.6508 26.4762 20.0241 Constraint 391 552 16.7738 20.9673 31.4510 19.9978 Constraint 80 585 17.0653 21.3317 31.9975 19.9965 Constraint 80 519 12.8123 16.0154 24.0231 19.9668 Constraint 128 552 15.9346 19.9182 29.8773 19.9623 Constraint 314 552 15.4214 19.2767 28.9151 19.9470 Constraint 242 599 12.2564 15.3205 22.9807 19.9298 Constraint 237 599 13.1489 16.4361 24.6542 19.9298 Constraint 104 577 15.0638 18.8297 28.2446 19.9070 Constraint 182 577 14.8834 18.6042 27.9063 19.8781 Constraint 122 585 15.4882 19.3603 29.0404 19.8133 Constraint 285 585 16.6443 20.8053 31.2080 19.7964 Constraint 412 519 13.3494 16.6868 25.0302 19.7765 Constraint 404 519 12.2446 15.3058 22.9587 19.7765 Constraint 242 629 13.0678 16.3348 24.5021 19.7637 Constraint 412 604 13.0903 16.3629 24.5443 19.7603 Constraint 355 519 12.8522 16.0652 24.0979 19.6928 Constraint 350 519 14.4877 18.1096 27.1644 19.6928 Constraint 449 552 15.5599 19.4499 29.1748 19.6633 Constraint 88 577 15.9052 19.8815 29.8222 19.6524 Constraint 341 651 17.9376 22.4220 33.6330 19.6326 Constraint 341 644 18.3122 22.8902 34.3353 19.6326 Constraint 429 629 11.8933 14.8666 22.2999 19.6144 Constraint 421 629 12.3559 15.4448 23.1673 19.6144 Constraint 391 599 13.4543 16.8179 25.2268 19.6069 Constraint 250 604 15.8034 19.7543 29.6314 19.5733 Constraint 292 622 14.3816 17.9770 26.9655 19.5612 Constraint 250 622 15.5576 19.4470 29.1704 19.5612 Constraint 250 613 17.3127 21.6409 32.4613 19.5612 Constraint 242 622 12.8766 16.0957 24.1435 19.5612 Constraint 237 622 12.9839 16.2299 24.3449 19.5612 Constraint 210 622 13.1254 16.4068 24.6101 19.5612 Constraint 210 613 13.7096 17.1370 25.7054 19.5612 Constraint 355 599 15.3813 19.2267 28.8400 19.5485 Constraint 350 599 15.2200 19.0250 28.5375 19.5485 Constraint 350 590 16.8555 21.0694 31.6041 19.5485 Constraint 442 604 13.3428 16.6785 25.0178 19.5354 Constraint 382 613 15.1551 18.9439 28.4158 19.5252 Constraint 314 535 13.6814 17.1017 25.6526 19.5131 Constraint 341 636 17.3976 21.7470 32.6205 19.4713 Constraint 330 636 17.5412 21.9265 32.8897 19.4713 Constraint 399 604 11.8491 14.8114 22.2171 19.3644 Constraint 322 629 13.7185 17.1482 25.7223 19.3531 Constraint 314 629 13.3805 16.7257 25.0885 19.3531 Constraint 429 590 12.8086 16.0108 24.0162 19.3055 Constraint 421 590 13.6521 17.0652 25.5978 19.3055 Constraint 314 519 12.8627 16.0784 24.1175 19.2720 Constraint 303 519 16.0841 20.1051 30.1576 19.2720 Constraint 144 519 13.8631 17.3289 25.9934 19.2575 Constraint 136 519 15.4165 19.2707 28.9060 19.2575 Constraint 128 519 13.8337 17.2922 25.9383 19.2575 Constraint 122 519 10.9989 13.7487 20.6230 19.2575 Constraint 113 519 12.0984 15.1230 22.6845 19.2575 Constraint 88 519 9.2066 11.5083 17.2624 19.2575 Constraint 585 657 11.9140 14.8925 22.3388 19.2044 Constraint 355 585 16.2087 20.2608 30.3913 19.1862 Constraint 399 527 10.2128 12.7660 19.1490 19.1813 Constraint 221 599 14.3920 17.9900 26.9850 19.1695 Constraint 341 585 14.0650 17.5813 26.3720 19.1552 Constraint 557 629 11.8700 14.8374 22.2562 19.1335 Constraint 169 613 16.4111 20.5139 30.7709 19.0341 Constraint 210 590 14.8285 18.5356 27.8034 19.0232 Constraint 399 613 12.7527 15.9409 23.9114 19.0188 Constraint 104 527 12.9271 16.1588 24.2383 18.9928 Constraint 96 527 10.8486 13.5608 20.3411 18.9928 Constraint 104 552 14.3548 17.9435 26.9152 18.9624 Constraint 169 519 15.8719 19.8398 29.7598 18.9575 Constraint 161 519 18.1346 22.6683 34.0024 18.9575 Constraint 153 519 14.5802 18.2252 27.3378 18.9575 Constraint 404 622 12.3670 15.4588 23.1882 18.9552 Constraint 122 552 15.0391 18.7989 28.1984 18.9460 Constraint 113 552 14.4661 18.0826 27.1240 18.9460 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 113 544 15.8651 19.8314 29.7470 18.9441 Constraint 322 577 13.7958 17.2448 25.8671 18.9309 Constraint 242 590 14.3447 17.9309 26.8963 18.9299 Constraint 237 590 15.5295 19.4118 29.1177 18.9299 Constraint 128 577 14.9853 18.7316 28.0974 18.9089 Constraint 201 604 14.0618 17.5773 26.3659 18.9068 Constraint 267 622 17.6780 22.0974 33.1462 18.8945 Constraint 259 622 14.6810 18.3512 27.5269 18.8945 Constraint 259 613 16.0242 20.0303 30.0454 18.8945 Constraint 113 577 15.8953 19.8691 29.8036 18.8906 Constraint 80 604 18.3156 22.8945 34.3418 18.8786 Constraint 480 604 11.7474 14.6843 22.0264 18.8660 Constraint 314 657 17.4266 21.7832 32.6748 18.8609 Constraint 303 657 17.8734 22.3417 33.5126 18.8609 Constraint 88 604 14.5177 18.1471 27.2207 18.8413 Constraint 279 585 16.8929 21.1161 31.6742 18.7964 Constraint 267 585 18.4110 23.0138 34.5207 18.7964 Constraint 292 629 13.7722 17.2153 25.8229 18.7801 Constraint 435 527 11.8181 14.7727 22.1590 18.7765 Constraint 429 527 9.5040 11.8800 17.8200 18.7765 Constraint 421 527 9.9010 12.3763 18.5644 18.7765 Constraint 360 552 15.5683 19.4603 29.1905 18.6997 Constraint 473 585 12.6940 15.8675 23.8012 18.6773 Constraint 461 552 15.1061 18.8827 28.3240 18.6652 Constraint 435 622 13.6211 17.0264 25.5396 18.6175 Constraint 604 676 11.7978 14.7473 22.1209 18.5958 Constraint 292 577 14.2936 17.8670 26.8005 18.5782 Constraint 391 629 13.9508 17.4385 26.1577 18.5678 Constraint 201 577 17.0183 21.2729 31.9094 18.5618 Constraint 176 577 16.3286 20.4107 30.6161 18.5618 Constraint 182 622 15.4907 19.3633 29.0450 18.5612 Constraint 375 613 13.5024 16.8780 25.3170 18.5575 Constraint 303 535 15.8456 19.8070 29.7106 18.5132 Constraint 242 577 15.8732 19.8415 29.7622 18.4849 Constraint 96 535 13.8808 17.3511 26.0266 18.4199 Constraint 391 535 12.8021 16.0027 24.0040 18.4180 Constraint 375 622 13.6211 17.0264 25.5396 18.3793 Constraint 113 535 14.8451 18.5564 27.8346 18.3508 Constraint 330 585 14.4238 18.0297 27.0446 18.3092 Constraint 412 622 13.0869 16.3586 24.5380 18.3022 Constraint 480 599 12.2840 15.3550 23.0324 18.2931 Constraint 480 590 13.1881 16.4852 24.7278 18.2931 Constraint 292 657 18.0580 22.5725 33.8588 18.2880 Constraint 285 657 18.1915 22.7393 34.1090 18.2880 Constraint 259 657 18.9355 23.6694 35.5041 18.2880 Constraint 297 519 16.6991 20.8739 31.3108 18.2739 Constraint 210 519 14.6083 18.2604 27.3906 18.2576 Constraint 421 577 15.1414 18.9268 28.3901 18.2471 Constraint 412 599 12.6799 15.8498 23.7748 18.2104 Constraint 585 668 13.5009 16.8762 25.3143 18.2044 Constraint 412 552 18.2174 22.7717 34.1576 18.2036 Constraint 399 552 16.4434 20.5543 30.8314 18.2036 Constraint 399 544 17.7036 22.1295 33.1942 18.2035 Constraint 404 599 11.7798 14.7247 22.0871 18.1969 Constraint 399 577 17.3969 21.7462 32.6193 18.1881 Constraint 552 629 12.7584 15.9480 23.9220 18.1354 Constraint 544 613 13.0857 16.3572 24.5357 18.1064 Constraint 314 557 17.6469 22.0586 33.0879 18.0910 Constraint 350 636 18.7860 23.4824 35.2237 18.0703 Constraint 161 599 16.9164 21.1454 31.7182 18.0692 Constraint 169 590 16.5800 20.7250 31.0875 18.0539 Constraint 391 604 12.4318 15.5397 23.3096 18.0156 Constraint 330 552 15.0842 18.8552 28.2828 17.9997 Constraint 322 527 11.6641 14.5801 21.8702 17.9929 Constraint 391 527 11.0348 13.7935 20.6902 17.9910 Constraint 391 519 12.9546 16.1932 24.2898 17.9910 Constraint 382 527 13.3002 16.6252 24.9378 17.9910 Constraint 382 519 14.5984 18.2480 27.3720 17.9910 Constraint 412 629 12.7081 15.8851 23.8277 17.9809 Constraint 404 629 11.6229 14.5286 21.7930 17.9674 Constraint 169 585 16.6920 20.8650 31.2975 17.9644 Constraint 314 544 17.0910 21.3637 32.0455 17.9605 Constraint 201 599 14.2089 17.7611 26.6416 17.9299 Constraint 169 577 16.2467 20.3083 30.4625 17.8926 Constraint 161 577 16.8775 21.0969 31.6454 17.8926 Constraint 136 577 15.3587 19.1984 28.7977 17.8926 Constraint 122 577 15.4203 19.2753 28.9130 17.8926 Constraint 480 585 11.7404 14.6755 22.0132 17.8883 Constraint 96 552 14.9053 18.6316 27.9474 17.8691 Constraint 88 552 13.8962 17.3702 26.0554 17.8691 Constraint 88 571 18.1091 22.6363 33.9545 17.8652 Constraint 322 552 15.1275 18.9094 28.3641 17.8538 Constraint 88 590 15.8999 19.8749 29.8124 17.8249 Constraint 221 585 17.5780 21.9725 32.9587 17.7964 Constraint 259 629 14.1357 17.6696 26.5044 17.7638 Constraint 250 629 14.8995 18.6244 27.9366 17.7638 Constraint 237 629 12.0644 15.0804 22.6207 17.7638 Constraint 210 629 11.8092 14.7615 22.1423 17.7638 Constraint 382 604 13.6636 17.0794 25.6192 17.7156 Constraint 375 604 12.5613 15.7016 23.5525 17.7156 Constraint 368 604 13.8097 17.2621 25.8931 17.7156 Constraint 360 604 12.3139 15.3924 23.0886 17.7156 Constraint 391 613 13.6045 17.0056 25.5083 17.7035 Constraint 368 613 14.6793 18.3492 27.5238 17.7035 Constraint 360 613 13.6272 17.0340 25.5510 17.7035 Constraint 355 613 15.7819 19.7273 29.5910 17.7035 Constraint 368 552 17.5293 21.9116 32.8675 17.6997 Constraint 355 552 16.4049 20.5061 30.7592 17.6997 Constraint 104 535 14.4552 18.0690 27.1035 17.6763 Constraint 461 544 16.3341 20.4176 30.6264 17.6652 Constraint 96 577 16.7827 20.9784 31.4676 17.6563 Constraint 435 629 13.0745 16.3431 24.5147 17.6297 Constraint 435 613 13.3638 16.7048 25.0572 17.6195 Constraint 303 552 15.0963 18.8704 28.3055 17.6136 Constraint 399 535 10.6781 13.3476 20.0214 17.6084 Constraint 80 577 17.9051 22.3813 33.5720 17.6017 Constraint 449 613 15.0659 18.8324 28.2487 17.5796 Constraint 190 577 16.7201 20.9002 31.3503 17.5782 Constraint 221 577 15.9164 19.8955 29.8432 17.5782 Constraint 176 604 14.1776 17.7220 26.5829 17.5734 Constraint 399 622 12.7279 15.9098 23.8648 17.5729 Constraint 382 629 14.3283 17.9103 26.8655 17.5697 Constraint 375 629 13.4940 16.8675 25.3013 17.5697 Constraint 360 629 14.1821 17.7277 26.5915 17.5697 Constraint 435 535 13.1060 16.3825 24.5738 17.4600 Constraint 442 527 11.4705 14.3381 21.5071 17.4430 Constraint 322 535 14.4352 18.0440 27.0661 17.4199 Constraint 382 535 13.8610 17.3262 25.9893 17.4180 Constraint 80 535 15.2197 19.0246 28.5370 17.4103 Constraint 128 604 15.4782 19.3477 29.0216 17.3977 Constraint 303 577 12.7548 15.9436 23.9153 17.3907 Constraint 128 590 16.9487 21.1858 31.7788 17.3814 Constraint 122 599 14.5014 18.1267 27.1901 17.3814 Constraint 122 590 16.1338 20.1672 30.2508 17.3814 Constraint 161 604 16.6479 20.8098 31.2147 17.3692 Constraint 391 622 13.2260 16.5325 24.7987 17.3672 Constraint 360 622 13.9442 17.4302 26.1453 17.3672 Constraint 341 552 14.9397 18.6747 28.0120 17.3643 Constraint 435 585 14.7041 18.3801 27.5702 17.3209 Constraint 96 599 15.7358 19.6698 29.5047 17.3082 Constraint 442 622 13.2763 16.5954 24.8931 17.2841 Constraint 88 535 12.7454 15.9318 23.8977 17.2739 Constraint 88 527 9.1622 11.4528 17.1792 17.2739 Constraint 292 519 14.6724 18.3405 27.5108 17.2576 Constraint 285 519 16.3910 20.4888 30.7332 17.2576 Constraint 182 519 16.6480 20.8100 31.2150 17.2576 Constraint 404 535 13.0234 16.2793 24.4190 17.2036 Constraint 404 590 12.5685 15.7107 23.5660 17.1970 Constraint 190 590 18.0909 22.6137 33.9205 17.1792 Constraint 449 527 9.4057 11.7571 17.6356 17.1430 Constraint 442 552 16.4235 20.5294 30.7941 17.1265 Constraint 375 535 11.7214 14.6518 21.9777 17.1199 Constraint 360 535 10.8528 13.5660 20.3490 17.1199 Constraint 292 552 16.0449 20.0561 30.0842 17.1102 Constraint 210 552 16.0746 20.0933 30.1399 17.1102 Constraint 182 552 15.8198 19.7747 29.6621 17.1102 Constraint 267 651 19.8860 24.8575 37.2862 17.1059 Constraint 113 604 14.6588 18.3235 27.4853 17.0814 Constraint 113 599 15.0984 18.8731 28.3096 17.0814 Constraint 113 590 16.4546 20.5682 30.8523 17.0814 Constraint 599 676 12.4718 15.5898 23.3847 17.0305 Constraint 590 676 14.5914 18.2393 27.3590 17.0305 Constraint 391 544 17.8286 22.2858 33.4287 17.0132 Constraint 330 527 13.0039 16.2549 24.3824 16.9929 Constraint 314 527 11.1805 13.9756 20.9634 16.9929 Constraint 303 527 14.3015 17.8768 26.8152 16.9929 Constraint 297 527 14.6792 18.3491 27.5236 16.9929 Constraint 442 599 13.6200 17.0250 25.5375 16.9855 Constraint 442 590 15.8906 19.8633 29.7949 16.9855 Constraint 442 585 15.2951 19.1189 28.6783 16.9855 Constraint 375 599 12.7868 15.9836 23.9753 16.9753 Constraint 360 599 12.3884 15.4855 23.2282 16.9753 Constraint 80 527 12.1314 15.1642 22.7463 16.9669 Constraint 544 622 12.7554 15.9442 23.9163 16.9604 Constraint 272 519 18.9634 23.7042 35.5563 16.9576 Constraint 259 519 16.0975 20.1219 30.1828 16.9576 Constraint 237 519 16.6611 20.8264 31.2396 16.9576 Constraint 226 519 18.6665 23.3331 34.9996 16.9576 Constraint 221 519 16.4324 20.5404 30.8107 16.9576 Constraint 201 519 17.5206 21.9007 32.8511 16.9576 Constraint 190 519 19.4490 24.3112 36.4668 16.9576 Constraint 176 519 18.4876 23.1095 34.6642 16.9576 Constraint 375 585 14.6955 18.3694 27.5540 16.9465 Constraint 122 557 17.9836 22.4795 33.7193 16.9441 Constraint 113 557 17.1622 21.4528 32.1792 16.9441 Constraint 104 557 16.5129 20.6412 30.9617 16.9441 Constraint 201 590 16.8034 21.0042 31.5063 16.9299 Constraint 577 644 12.4144 15.5180 23.2770 16.9280 Constraint 467 585 12.4474 15.5592 23.3388 16.8697 Constraint 461 585 13.3129 16.6411 24.9616 16.8697 Constraint 96 544 15.8375 19.7969 29.6953 16.8691 Constraint 399 599 11.4806 14.3507 21.5261 16.8146 Constraint 399 590 13.0527 16.3158 24.4738 16.8146 Constraint 242 552 17.6580 22.0725 33.1088 16.8102 Constraint 292 571 16.6601 20.8251 31.2376 16.7910 Constraint 242 636 15.6399 19.5498 29.3247 16.7792 Constraint 412 527 11.1519 13.9399 20.9099 16.7766 Constraint 404 527 11.0148 13.7684 20.6527 16.7766 Constraint 210 571 16.6768 20.8460 31.2690 16.7746 Constraint 341 544 16.5948 20.7435 31.1153 16.7132 Constraint 350 622 17.3739 21.7174 32.5761 16.7004 Constraint 297 636 17.0795 21.3494 32.0241 16.6951 Constraint 375 527 11.7721 14.7151 22.0726 16.6929 Constraint 375 519 12.7649 15.9561 23.9342 16.6929 Constraint 368 527 12.4069 15.5087 23.2630 16.6929 Constraint 368 519 14.1322 17.6652 26.4978 16.6929 Constraint 360 527 9.4450 11.8062 17.7093 16.6929 Constraint 360 519 11.7225 14.6531 21.9796 16.6929 Constraint 355 527 11.9050 14.8813 22.3219 16.6929 Constraint 350 527 12.6522 15.8153 23.7229 16.6929 Constraint 341 527 13.2961 16.6201 24.9302 16.6929 Constraint 360 577 16.2757 20.3446 30.5170 16.6843 Constraint 80 590 18.3622 22.9527 34.4290 16.6631 Constraint 429 636 13.5043 16.8803 25.3205 16.6154 Constraint 449 577 15.2159 19.0199 28.5298 16.6137 Constraint 449 604 13.1982 16.4978 24.7467 16.5918 Constraint 399 629 11.9344 14.9180 22.3769 16.5851 Constraint 201 622 13.7409 17.1762 25.7642 16.5650 Constraint 221 622 14.7107 18.3884 27.5826 16.5612 Constraint 221 613 15.7550 19.6937 29.5406 16.5612 Constraint 368 622 13.9621 17.4526 26.1789 16.5576 Constraint 355 622 15.9585 19.9481 29.9222 16.5576 Constraint 297 577 12.5275 15.6593 23.4890 16.5447 Constraint 242 585 15.2336 19.0420 28.5630 16.5404 Constraint 237 585 16.2855 20.3569 30.5353 16.5404 Constraint 128 535 13.8259 17.2824 25.9236 16.5304 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 144 599 15.1719 18.9648 28.4473 16.4857 Constraint 421 535 10.2130 12.7662 19.1493 16.4600 Constraint 449 622 14.5495 18.1868 27.2803 16.4337 Constraint 330 535 15.0235 18.7794 28.1690 16.4199 Constraint 473 604 10.6913 13.3642 20.0462 16.4136 Constraint 136 604 15.8431 19.8039 29.7059 16.3814 Constraint 136 599 16.2994 20.3743 30.5615 16.3814 Constraint 382 622 13.1548 16.4434 24.6652 16.3794 Constraint 350 552 15.8647 19.8309 29.7463 16.3663 Constraint 350 585 15.5829 19.4787 29.2180 16.3494 Constraint 382 590 14.1522 17.6902 26.5354 16.3210 Constraint 421 585 13.1838 16.4797 24.7196 16.3209 Constraint 613 687 13.6280 17.0350 25.5525 16.3198 Constraint 442 629 12.3553 15.4442 23.1663 16.2963 Constraint 80 552 13.7619 17.2024 25.8035 16.2643 Constraint 399 585 13.5515 16.9394 25.4091 16.2619 Constraint 169 527 13.4141 16.7677 25.1515 16.2576 Constraint 161 527 15.6416 19.5520 29.3280 16.2576 Constraint 144 527 11.8193 14.7741 22.1612 16.2576 Constraint 136 527 13.1901 16.4876 24.7314 16.2576 Constraint 128 527 11.4912 14.3640 21.5460 16.2576 Constraint 122 527 9.1313 11.4141 17.1211 16.2576 Constraint 113 527 10.4685 13.0856 19.6284 16.2576 Constraint 285 577 13.9960 17.4950 26.2425 16.2447 Constraint 279 577 13.7440 17.1800 25.7700 16.2447 Constraint 272 577 14.5264 18.1580 27.2370 16.2447 Constraint 435 599 12.8990 16.1237 24.1856 16.2258 Constraint 435 590 15.0114 18.7642 28.1463 16.2258 Constraint 412 590 13.6585 17.0731 25.6097 16.2123 Constraint 544 629 13.5073 16.8842 25.3263 16.1508 Constraint 169 629 14.9060 18.6325 27.9488 16.1434 Constraint 442 544 16.6844 20.8556 31.2833 16.1265 Constraint 442 535 13.2084 16.5105 24.7657 16.1265 Constraint 368 535 11.9074 14.8843 22.3264 16.1199 Constraint 355 535 10.9111 13.6389 20.4583 16.1199 Constraint 350 535 12.9663 16.2079 24.3118 16.1199 Constraint 279 651 18.5487 23.1859 34.7788 16.1153 Constraint 250 636 18.4812 23.1014 34.6522 16.1124 Constraint 297 552 14.7448 18.4310 27.6465 16.1103 Constraint 285 552 16.7582 20.9477 31.4215 16.1103 Constraint 169 552 16.3043 20.3804 30.5706 16.1093 Constraint 144 552 14.6740 18.3425 27.5137 16.1093 Constraint 136 552 14.8023 18.5028 27.7542 16.1093 Constraint 104 544 14.2126 17.7657 26.6486 16.1073 Constraint 161 571 18.4430 23.0537 34.5806 16.1054 Constraint 136 571 16.8036 21.0045 31.5068 16.1054 Constraint 128 571 16.6379 20.7974 31.1961 16.1054 Constraint 201 552 18.2761 22.8451 34.2676 16.0939 Constraint 176 552 17.4348 21.7935 32.6903 16.0939 Constraint 113 613 16.8872 21.1089 31.6634 16.0814 Constraint 350 657 17.9535 22.4419 33.6628 16.0757 Constraint 571 636 12.5948 15.7434 23.6152 16.0630 Constraint 449 599 12.5468 15.6835 23.5252 16.0188 Constraint 449 590 14.7033 18.3791 27.5687 16.0188 Constraint 449 585 13.9382 17.4227 26.1340 16.0188 Constraint 330 544 16.0714 20.0893 30.1339 16.0151 Constraint 242 519 14.0487 17.5609 26.3413 16.0120 Constraint 88 599 13.3261 16.6576 24.9864 16.0045 Constraint 322 557 17.4759 21.8449 32.7673 15.9978 Constraint 322 571 16.0585 20.0731 30.1096 15.9977 Constraint 382 599 12.8506 16.0633 24.0949 15.9753 Constraint 404 636 14.0356 17.5446 26.3168 15.9665 Constraint 161 585 16.6510 20.8137 31.2205 15.9644 Constraint 153 527 12.2527 15.3158 22.9738 15.9576 Constraint 169 622 15.2140 19.0175 28.5263 15.9447 Constraint 368 577 17.8862 22.3577 33.5366 15.8747 Constraint 88 557 17.3807 21.7259 32.5889 15.8672 Constraint 88 544 14.8869 18.6086 27.9129 15.8528 Constraint 473 599 10.6151 13.2688 19.9032 15.8406 Constraint 473 590 12.0845 15.1056 22.6584 15.8406 Constraint 449 544 14.8682 18.5853 27.8779 15.8265 Constraint 449 535 11.4295 14.2868 21.4303 15.8265 Constraint 80 599 17.4916 21.8645 32.7967 15.8263 Constraint 272 552 17.2371 21.5464 32.3196 15.8103 Constraint 153 552 15.9032 19.8790 29.8185 15.8093 Constraint 169 571 17.9769 22.4711 33.7067 15.8054 Constraint 113 571 17.0955 21.3694 32.0541 15.8054 Constraint 314 571 15.5458 19.4323 29.1484 15.7910 Constraint 272 571 17.1212 21.4015 32.1023 15.7910 Constraint 144 604 14.4928 18.1160 27.1740 15.7857 Constraint 322 636 14.6976 18.3720 27.5580 15.7792 Constraint 292 636 15.9656 19.9570 29.9354 15.7792 Constraint 237 636 15.4205 19.2756 28.9135 15.7792 Constraint 210 636 14.5770 18.2213 27.3319 15.7792 Constraint 201 571 18.2965 22.8706 34.3059 15.7747 Constraint 182 571 15.9438 19.9297 29.8946 15.7747 Constraint 176 571 17.7148 22.1435 33.2153 15.7747 Constraint 360 544 16.7964 20.9956 31.4933 15.7151 Constraint 355 544 17.7235 22.1543 33.2315 15.7151 Constraint 350 544 17.2007 21.5009 32.2513 15.7151 Constraint 314 651 15.4914 19.3643 29.0464 15.6786 Constraint 285 651 17.8880 22.3600 33.5400 15.6786 Constraint 201 585 17.3692 21.7115 32.5672 15.6337 Constraint 391 590 12.8471 16.0589 24.0883 15.6089 Constraint 242 644 17.2837 21.6047 32.4070 15.6042 Constraint 237 644 17.8151 22.2689 33.4033 15.6042 Constraint 210 644 16.5892 20.7365 31.1047 15.6042 Constraint 259 590 14.9022 18.6278 27.9417 15.5965 Constraint 250 599 13.4981 16.8726 25.3089 15.5965 Constraint 250 590 16.2127 20.2659 30.3988 15.5965 Constraint 267 613 18.0291 22.5364 33.8046 15.5872 Constraint 226 604 14.3303 17.9129 26.8693 15.5734 Constraint 382 636 16.8449 21.0562 31.5843 15.5687 Constraint 375 636 15.1053 18.8816 28.3224 15.5687 Constraint 360 636 16.0220 20.0275 30.0413 15.5687 Constraint 622 698 13.6616 17.0769 25.6154 15.5241 Constraint 613 698 14.6993 18.3742 27.5613 15.5241 Constraint 161 535 16.6404 20.8005 31.2008 15.5141 Constraint 144 535 13.7152 17.1440 25.7160 15.5141 Constraint 136 535 15.1400 18.9250 28.3875 15.5141 Constraint 122 535 12.1254 15.1568 22.7352 15.5141 Constraint 429 577 14.0635 17.5794 26.3691 15.5108 Constraint 144 590 16.3285 20.4106 30.6159 15.4857 Constraint 144 585 14.6570 18.3212 27.4818 15.3809 Constraint 355 577 16.5107 20.6384 30.9576 15.3508 Constraint 604 687 12.1060 15.1325 22.6988 15.3198 Constraint 80 571 19.1407 23.9259 35.8888 15.3103 Constraint 153 622 19.4473 24.3092 36.4637 15.2943 Constraint 153 604 15.9045 19.8807 29.8210 15.2942 Constraint 153 599 15.5477 19.4347 29.1520 15.2942 Constraint 153 590 17.1417 21.4271 32.1407 15.2942 Constraint 122 604 13.1509 16.4386 24.6579 15.2882 Constraint 421 636 14.3002 17.8753 26.8129 15.2819 Constraint 292 527 12.3654 15.4568 23.1851 15.2740 Constraint 473 622 12.0226 15.0283 22.5424 15.2677 Constraint 473 613 11.5708 14.4635 21.6952 15.2677 Constraint 210 527 11.7840 14.7300 22.0950 15.2576 Constraint 182 527 14.1496 17.6871 26.5306 15.2576 Constraint 80 544 15.2074 19.0092 28.5138 15.2480 Constraint 292 535 13.5159 16.8949 25.3424 15.2304 Constraint 182 535 15.4905 19.3631 29.0446 15.2304 Constraint 169 535 14.5603 18.2004 27.3006 15.2141 Constraint 153 535 13.8519 17.3149 25.9723 15.2141 Constraint 404 585 12.7708 15.9635 23.9452 15.2123 Constraint 250 585 18.3944 22.9929 34.4894 15.2070 Constraint 242 651 16.4431 20.5539 30.8309 15.1994 Constraint 237 651 17.3279 21.6599 32.4898 15.1994 Constraint 210 651 16.3449 20.4311 30.6467 15.1994 Constraint 368 629 13.7355 17.1694 25.7541 15.1649 Constraint 259 577 14.6587 18.3234 27.4850 15.1515 Constraint 391 577 15.6334 19.5418 29.3127 15.1456 Constraint 571 644 14.6229 18.2787 27.4180 15.1408 Constraint 429 651 15.4251 19.2814 28.9221 15.1278 Constraint 429 644 15.7101 19.6377 29.4565 15.1278 Constraint 259 636 17.1229 21.4037 32.1055 15.1124 Constraint 169 544 15.6688 19.5860 29.3790 15.1093 Constraint 161 552 16.7099 20.8874 31.3311 15.1093 Constraint 161 544 15.9030 19.8787 29.8181 15.1093 Constraint 144 544 14.3334 17.9167 26.8750 15.1093 Constraint 136 544 14.4469 18.0586 27.0879 15.1093 Constraint 128 544 14.1289 17.6611 26.4917 15.1093 Constraint 122 544 14.5283 18.1603 27.2405 15.1093 Constraint 104 571 15.7086 19.6358 29.4537 15.1054 Constraint 350 668 19.1225 23.9031 35.8546 15.0757 Constraint 122 622 17.0707 21.3384 32.0076 14.9882 Constraint 122 613 16.4001 20.5002 30.7502 14.9882 Constraint 88 613 15.4527 19.3159 28.9738 14.9882 Constraint 375 590 12.5845 15.7306 23.5959 14.9875 Constraint 412 636 15.7792 19.7240 29.5860 14.9819 Constraint 285 527 14.3850 17.9813 26.9719 14.9740 Constraint 237 527 14.6122 18.2653 27.3979 14.9576 Constraint 201 527 14.8473 18.5591 27.8386 14.9576 Constraint 176 527 15.7016 19.6270 29.4404 14.9576 Constraint 322 644 15.7157 19.6446 29.4669 14.9374 Constraint 292 644 17.0021 21.2526 31.8789 14.9374 Constraint 285 644 18.7759 23.4699 35.2049 14.9374 Constraint 259 644 18.3553 22.9442 34.4163 14.9374 Constraint 226 599 14.1324 17.6655 26.4983 14.9299 Constraint 226 590 17.1066 21.3832 32.0748 14.9299 Constraint 473 552 13.0999 16.3749 24.5624 14.8999 Constraint 153 585 15.8796 19.8495 29.7743 14.8894 Constraint 480 622 11.8594 14.8242 22.2363 14.8834 Constraint 480 613 10.9393 13.6741 20.5112 14.8834 Constraint 96 604 15.3732 19.2166 28.8248 14.8813 Constraint 96 557 18.2545 22.8182 34.2273 14.8691 Constraint 461 535 10.1930 12.7413 19.1119 14.8285 Constraint 221 552 17.3702 21.7127 32.5691 14.8103 Constraint 190 552 18.2922 22.8652 34.2979 14.8103 Constraint 153 544 15.2734 19.0918 28.6376 14.8093 Constraint 210 557 17.7633 22.2041 33.3061 14.7920 Constraint 341 535 13.2190 16.5237 24.7856 14.7865 Constraint 190 571 17.9215 22.4018 33.6027 14.7747 Constraint 221 571 17.5646 21.9557 32.9336 14.7747 Constraint 201 629 11.8403 14.8003 22.2005 14.7676 Constraint 190 629 14.4525 18.0656 27.0984 14.7676 Constraint 176 629 13.3516 16.6895 25.0343 14.7676 Constraint 226 629 13.9622 17.4527 26.1791 14.7638 Constraint 221 629 13.4983 16.8728 25.3092 14.7638 Constraint 355 557 17.7978 22.2472 33.3708 14.6997 Constraint 272 636 17.7296 22.1619 33.2429 14.6990 Constraint 267 636 18.9031 23.6289 35.4433 14.6990 Constraint 259 571 17.4993 21.8742 32.8113 14.6978 Constraint 473 577 13.2815 16.6019 24.9028 14.6870 Constraint 144 629 17.6934 22.1167 33.1751 14.6761 Constraint 330 557 15.6113 19.5141 29.2711 14.6644 Constraint 585 676 15.2079 19.0099 28.5148 14.6411 Constraint 467 604 10.3539 12.9424 19.4136 14.6059 Constraint 461 604 11.1388 13.9235 20.8852 14.6059 Constraint 399 636 13.8898 17.3622 26.0433 14.5841 Constraint 429 657 15.3310 19.1637 28.7455 14.5651 Constraint 226 622 13.9197 17.3996 26.0994 14.5650 Constraint 577 668 14.1741 17.7177 26.5765 14.5473 Constraint 577 657 11.5537 14.4421 21.6631 14.5473 Constraint 322 651 15.1880 18.9850 28.4775 14.5326 Constraint 297 651 17.1538 21.4423 32.1635 14.5326 Constraint 292 651 16.2822 20.3528 30.5292 14.5326 Constraint 259 651 17.2936 21.6170 32.4255 14.5326 Constraint 250 651 18.7152 23.3940 35.0910 14.5326 Constraint 297 535 14.6551 18.3189 27.4784 14.5305 Constraint 604 698 12.4866 15.6083 23.4124 14.5241 Constraint 341 577 11.9453 14.9316 22.3974 14.5084 Constraint 355 629 15.4023 19.2529 28.8794 14.4982 Constraint 259 552 17.6694 22.0867 33.1301 14.4768 Constraint 226 577 17.2405 21.5506 32.3260 14.4686 Constraint 330 651 16.9520 21.1900 31.7851 14.4644 Constraint 303 571 14.3416 17.9270 26.8905 14.4576 Constraint 297 571 14.7111 18.3889 27.5834 14.4576 Constraint 279 571 15.7871 19.7339 29.6008 14.4576 Constraint 391 585 13.8923 17.3653 26.0480 14.4098 Constraint 382 585 15.0071 18.7589 28.1383 14.4098 Constraint 80 557 17.6357 22.0446 33.0668 14.3939 Constraint 128 613 17.2772 21.5965 32.3947 14.3815 Constraint 412 535 11.9476 14.9345 22.4018 14.3668 Constraint 341 557 14.5717 18.2146 27.3219 14.3644 Constraint 355 571 17.6584 22.0730 33.1095 14.3509 Constraint 571 651 13.7982 17.2477 25.8716 14.3312 Constraint 435 636 15.8520 19.8150 29.7224 14.3307 Constraint 96 590 16.6657 20.8321 31.2482 14.3084 Constraint 297 657 16.7081 20.8851 31.3277 14.2976 Constraint 279 657 17.0463 21.3078 31.9618 14.2976 Constraint 267 657 18.3630 22.9538 34.4306 14.2976 Constraint 153 613 18.5666 23.2082 34.8123 14.2943 Constraint 279 636 17.4289 21.7861 32.6792 14.2942 Constraint 285 535 14.6512 18.3141 27.4711 14.2305 Constraint 279 535 17.2039 21.5049 32.2574 14.2305 Constraint 412 585 14.4983 18.1229 27.1844 14.2277 Constraint 242 535 12.8262 16.0327 24.0491 14.2141 Constraint 237 535 14.6965 18.3707 27.5560 14.2141 Constraint 210 535 13.0720 16.3400 24.5099 14.2141 Constraint 201 535 16.1440 20.1800 30.2700 14.2141 Constraint 176 535 16.8830 21.1037 31.6555 14.2141 Constraint 122 629 15.4188 19.2735 28.9103 14.1786 Constraint 497 604 13.9741 17.4676 26.2014 14.1744 Constraint 267 577 14.3993 17.9991 26.9986 14.1515 Constraint 557 644 14.7255 18.4068 27.6102 14.1427 Constraint 404 644 16.3988 20.4985 30.7478 14.1400 Constraint 250 577 17.2907 21.6134 32.4200 14.1352 Constraint 314 644 15.6173 19.5217 29.2825 14.1278 Constraint 421 644 15.5579 19.4474 29.1711 14.1260 Constraint 303 544 15.9522 19.9402 29.9103 14.1257 Constraint 297 544 15.2327 19.0409 28.5614 14.1257 Constraint 267 519 18.3740 22.9675 34.4512 14.1209 Constraint 250 519 17.1413 21.4266 32.1400 14.1209 Constraint 629 706 12.3339 15.4174 23.1261 14.1193 Constraint 622 706 14.4440 18.0551 27.0826 14.1193 Constraint 613 706 15.3496 19.1870 28.7806 14.1193 Constraint 210 544 15.8545 19.8182 29.7273 14.1093 Constraint 176 544 16.4551 20.5688 30.8533 14.1093 Constraint 128 557 16.3031 20.3789 30.5683 14.1073 Constraint 557 636 12.9698 16.2122 24.3183 14.0803 Constraint 480 629 10.9134 13.6418 20.4626 14.0738 Constraint 467 599 10.8669 13.5836 20.3754 14.0329 Constraint 467 590 12.0613 15.0766 22.6149 14.0329 Constraint 461 599 11.0380 13.7975 20.6962 14.0329 Constraint 461 590 12.6798 15.8497 23.7745 14.0329 Constraint 242 527 12.0950 15.1187 22.6781 14.0121 Constraint 113 622 17.2792 21.5990 32.3985 13.9882 Constraint 368 599 11.5698 14.4623 21.6934 13.9754 Constraint 360 590 11.8975 14.8719 22.3079 13.9754 Constraint 577 676 15.5490 19.4362 29.1543 13.9744 Constraint 272 527 15.8612 19.8265 29.7397 13.9577 Constraint 267 527 16.3343 20.4179 30.6269 13.9577 Constraint 259 527 13.4018 16.7523 25.1284 13.9577 Constraint 226 527 15.6261 19.5327 29.2990 13.9577 Constraint 221 527 13.2632 16.5790 24.8685 13.9577 Constraint 190 527 16.2238 20.2797 30.4195 13.9577 Constraint 303 557 15.7514 19.6893 29.5339 13.9208 Constraint 480 577 12.3402 15.4253 23.1379 13.8979 Constraint 480 571 13.3741 16.7177 25.0765 13.8979 Constraint 489 604 13.4818 16.8523 25.2785 13.8744 Constraint 330 577 12.5662 15.7077 23.5615 13.8103 Constraint 330 571 14.2021 17.7527 26.6290 13.8103 Constraint 242 544 18.0728 22.5910 33.8865 13.8093 Constraint 237 544 19.3559 24.1949 36.2923 13.8093 Constraint 201 544 17.5388 21.9235 32.8853 13.8093 Constraint 292 557 17.5898 21.9873 32.9809 13.8084 Constraint 169 557 17.9331 22.4163 33.6245 13.8073 Constraint 176 557 18.8149 23.5187 35.2780 13.7920 Constraint 190 585 17.4755 21.8444 32.7666 13.7897 Constraint 221 636 17.0446 21.3058 31.9587 13.7792 Constraint 599 687 11.9453 14.9316 22.3974 13.7545 Constraint 590 687 14.9011 18.6264 27.9396 13.7545 Constraint 399 651 15.6388 19.5485 29.3227 13.7455 Constraint 399 644 16.0855 20.1068 30.1602 13.7455 Constraint 557 651 14.8468 18.5585 27.8377 13.7379 Constraint 272 657 17.5957 21.9947 32.9920 13.7246 Constraint 182 657 16.9091 21.1364 31.7046 13.7246 Constraint 88 622 15.2766 19.0958 28.6437 13.6548 Constraint 279 527 16.3494 20.4367 30.6550 13.6405 Constraint 497 590 15.0621 18.8277 28.2415 13.6014 Constraint 221 590 15.0978 18.8723 28.3084 13.5965 Constraint 391 636 15.4664 19.3330 28.9996 13.5688 Constraint 341 571 13.1781 16.4727 24.7090 13.5103 Constraint 435 644 17.6496 22.0620 33.0930 13.4889 Constraint 330 644 17.1543 21.4429 32.1643 13.4866 Constraint 128 629 16.9708 21.2135 31.8202 13.4786 Constraint 467 629 11.4671 14.3339 21.5009 13.4600 Constraint 467 622 12.5232 15.6539 23.4809 13.4600 Constraint 467 613 11.4909 14.3636 21.5454 13.4600 Constraint 461 629 12.1870 15.2338 22.8507 13.4600 Constraint 461 622 13.2569 16.5711 24.8567 13.4600 Constraint 461 613 12.6853 15.8566 23.7849 13.4600 Constraint 382 552 16.2948 20.3685 30.5528 13.4248 Constraint 404 577 14.4187 18.0233 27.0350 13.4023 Constraint 412 544 17.7841 22.2302 33.3453 13.3668 Constraint 350 557 17.2154 21.5192 32.2788 13.3663 Constraint 449 629 12.6115 15.7643 23.6465 13.3526 Constraint 489 599 13.5319 16.9149 25.3723 13.3014 Constraint 489 590 14.9316 18.6645 27.9968 13.3014 Constraint 442 636 16.3667 20.4584 30.6877 13.2973 Constraint 322 657 15.7517 19.6896 29.5345 13.2879 Constraint 272 535 16.2356 20.2945 30.4417 13.2141 Constraint 267 535 16.5169 20.6462 30.9692 13.2141 Constraint 259 535 13.8163 17.2703 25.9055 13.2141 Constraint 250 535 15.6103 19.5129 29.2694 13.2141 Constraint 226 535 16.4432 20.5540 30.8310 13.2141 Constraint 221 535 14.3985 17.9981 26.9972 13.2141 Constraint 190 535 17.2740 21.5925 32.3887 13.2141 Constraint 497 585 13.7914 17.2393 25.8589 13.1966 Constraint 122 636 16.7425 20.9281 31.3921 13.1786 Constraint 113 636 16.9222 21.1528 31.7292 13.1786 Constraint 113 629 15.4236 19.2794 28.9192 13.1786 Constraint 355 590 13.2377 16.5471 24.8207 13.1658 Constraint 368 636 16.1458 20.1822 30.2734 13.1640 Constraint 552 644 15.9033 19.8792 29.8187 13.1447 Constraint 421 651 14.3281 17.9101 26.8652 13.1279 Constraint 412 651 15.7094 19.6367 29.4551 13.1279 Constraint 412 644 16.8809 21.1011 31.6516 13.1279 Constraint 375 552 15.1725 18.9656 28.4485 13.1267 Constraint 604 706 13.3902 16.7378 25.1067 13.1193 Constraint 292 544 15.9971 19.9964 29.9946 13.1093 Constraint 182 544 14.4455 18.0569 27.0854 13.1093 Constraint 161 557 18.2347 22.7933 34.1900 13.1073 Constraint 136 557 15.7955 19.7444 29.6165 13.1073 Constraint 355 657 17.5426 21.9283 32.8924 13.0977 Constraint 467 552 12.9304 16.1631 24.2446 13.0922 Constraint 182 557 16.7094 20.8867 31.3301 13.0920 Constraint 341 668 16.4819 20.6024 30.9037 13.0834 Constraint 341 657 15.3154 19.1442 28.7163 13.0834 Constraint 330 657 16.1945 20.2431 30.3646 13.0834 Constraint 552 636 13.8233 17.2791 25.9186 13.0822 Constraint 128 622 17.6313 22.0391 33.0587 13.0481 Constraint 96 571 18.1925 22.7406 34.1110 13.0323 Constraint 368 590 12.0935 15.1169 22.6753 12.9876 Constraint 599 698 12.8856 16.1070 24.1605 12.9588 Constraint 535 613 13.1296 16.4120 24.6180 12.9381 Constraint 535 604 12.1569 15.1962 22.7943 12.9381 Constraint 473 571 15.3832 19.2290 28.8435 12.8998 Constraint 489 585 13.7745 17.2181 25.8272 12.8966 Constraint 435 552 14.5502 18.1878 27.2817 12.8870 Constraint 467 577 12.7172 15.8964 23.8447 12.8793 Constraint 88 636 15.5103 19.3879 29.0818 12.8451 Constraint 88 629 13.4033 16.7542 25.1313 12.8451 Constraint 285 544 17.4164 21.7705 32.6557 12.8093 Constraint 279 544 16.9320 21.1650 31.7475 12.8093 Constraint 272 544 16.6104 20.7630 31.1445 12.8093 Constraint 267 544 18.5077 23.1346 34.7020 12.8093 Constraint 259 544 18.6158 23.2698 34.9047 12.8093 Constraint 221 544 17.1734 21.4667 32.2001 12.8093 Constraint 242 657 15.9491 19.9364 29.9046 12.8087 Constraint 237 657 16.2981 20.3726 30.5589 12.8087 Constraint 210 657 15.5679 19.4598 29.1897 12.8087 Constraint 190 557 19.5316 24.4145 36.6217 12.7920 Constraint 368 585 14.0384 17.5481 26.3221 12.7763 Constraint 297 557 15.6244 19.5305 29.2958 12.7749 Constraint 571 668 16.3215 20.4019 30.6029 12.7602 Constraint 571 657 13.7257 17.1572 25.7358 12.7602 Constraint 557 668 16.8730 21.0913 31.6369 12.7602 Constraint 557 657 14.4557 18.0696 27.1044 12.7602 Constraint 104 622 16.6840 20.8549 31.2824 12.7481 Constraint 104 613 15.8280 19.7850 29.6775 12.7481 Constraint 552 651 16.0311 20.0389 30.0583 12.7399 Constraint 391 644 16.1246 20.1557 30.2336 12.7302 Constraint 360 644 15.1381 18.9227 28.3840 12.7302 Constraint 429 557 16.2130 20.2663 30.3994 12.7237 Constraint 435 577 13.6400 17.0501 25.5751 12.6741 Constraint 88 644 17.5156 21.8945 32.8417 12.6548 Constraint 404 552 15.8177 19.7722 29.6583 12.6305 Constraint 435 657 15.9883 19.9854 29.9781 12.5805 Constraint 201 613 12.6531 15.8164 23.7246 12.5747 Constraint 190 622 13.9988 17.4986 26.2478 12.5747 Constraint 176 622 12.9776 16.2221 24.3331 12.5747 Constraint 176 613 13.7056 17.1319 25.6979 12.5747 Constraint 429 668 16.6139 20.7673 31.1510 12.5671 Constraint 421 657 14.7032 18.3789 27.5684 12.5652 Constraint 412 657 15.9738 19.9673 29.9509 12.5652 Constraint 221 651 17.5764 21.9705 32.9557 12.5326 Constraint 303 668 17.3428 21.6785 32.5177 12.5104 Constraint 285 668 18.2482 22.8103 34.2154 12.5104 Constraint 355 636 17.2449 21.5561 32.3342 12.4973 Constraint 449 644 17.7213 22.1517 33.2275 12.4822 Constraint 285 557 17.7012 22.1265 33.1898 12.4749 Constraint 279 557 17.0852 21.3565 32.0347 12.4749 Constraint 272 557 18.0956 22.6195 33.9293 12.4749 Constraint 259 557 19.5101 24.3877 36.5815 12.4749 Constraint 511 604 14.8582 18.5728 27.8591 12.4178 Constraint 153 629 18.2332 22.7915 34.1873 12.3914 Constraint 473 629 8.4392 10.5490 15.8235 12.3648 Constraint 285 571 15.0605 18.8256 28.2385 12.3643 Constraint 267 571 16.4721 20.5901 30.8851 12.3643 Constraint 391 651 15.3396 19.1745 28.7618 12.3253 Constraint 122 651 18.0920 22.6151 33.9226 12.2500 Constraint 88 651 16.7020 20.8775 31.3163 12.2500 Constraint 169 651 16.7607 20.9509 31.4264 12.2186 Constraint 497 577 13.2009 16.5011 24.7517 12.1998 Constraint 571 676 17.1651 21.4564 32.1847 12.1872 Constraint 557 676 18.1778 22.7223 34.0834 12.1872 Constraint 399 657 15.3381 19.1726 28.7589 12.1847 Constraint 391 657 16.1210 20.1512 30.2269 12.1675 Constraint 250 644 19.1679 23.9599 35.9398 12.1625 Constraint 544 644 17.9111 22.3888 33.5833 12.1601 Constraint 250 657 18.2387 22.7984 34.1976 12.1420 Constraint 442 651 16.0708 20.0885 30.1327 12.1414 Constraint 442 644 17.1592 21.4490 32.1735 12.1414 Constraint 404 651 14.4209 18.0261 27.0391 12.1356 Constraint 303 687 19.1703 23.9629 35.9444 12.1216 Constraint 375 577 15.7737 19.7172 29.5757 12.1112 Constraint 467 544 13.3283 16.6604 24.9905 12.0922 Constraint 355 644 15.6829 19.6036 29.4055 12.0634 Constraint 350 644 17.1613 21.4516 32.1774 12.0634 Constraint 322 544 14.8496 18.5620 27.8430 12.0324 Constraint 96 613 16.6719 20.8399 31.2598 11.9586 Constraint 480 557 13.8189 17.2736 25.9104 11.8999 Constraint 473 557 14.8535 18.5669 27.8504 11.8999 Constraint 489 577 12.6077 15.7597 23.6395 11.8998 Constraint 489 571 13.9726 17.4658 26.1987 11.8998 Constraint 237 577 14.3218 17.9023 26.8534 11.8955 Constraint 435 544 15.0884 18.8605 28.2907 11.8870 Constraint 96 629 15.4283 19.2853 28.9280 11.8653 Constraint 104 629 15.5392 19.4240 29.1360 11.8451 Constraint 511 599 14.7303 18.4129 27.6193 11.8449 Constraint 511 590 15.6537 19.5671 29.3507 11.8449 Constraint 169 657 16.5883 20.7353 31.1030 11.8241 Constraint 169 636 14.4027 18.0033 27.0050 11.8138 Constraint 242 668 17.4601 21.8251 32.7377 11.8087 Constraint 535 622 12.5399 15.6749 23.5124 11.7922 Constraint 221 557 18.7988 23.4985 35.2478 11.7920 Constraint 279 552 14.5185 18.1481 27.2221 11.7768 Constraint 552 668 17.5807 21.9758 32.9637 11.7621 Constraint 552 657 15.0736 18.8420 28.2630 11.7621 Constraint 544 651 17.2537 21.5671 32.3507 11.7553 Constraint 279 644 18.1193 22.6491 33.9736 11.7368 Constraint 144 577 12.2754 15.3442 23.0164 11.7238 Constraint 314 668 16.6420 20.8025 31.2038 11.7149 Constraint 368 644 15.7386 19.6733 29.5099 11.6586 Constraint 360 651 14.2452 17.8065 26.7098 11.6586 Constraint 355 651 14.8522 18.5653 27.8480 11.6586 Constraint 350 651 16.1178 20.1472 30.2208 11.6586 Constraint 96 622 16.2563 20.3204 30.4806 11.6586 Constraint 404 544 16.7886 20.9857 31.4786 11.6305 Constraint 399 571 16.2935 20.3669 30.5504 11.6151 Constraint 404 657 14.4365 18.0456 27.0684 11.5824 Constraint 226 613 14.1436 17.6795 26.5193 11.5747 Constraint 190 613 14.5965 18.2456 27.3684 11.5747 Constraint 421 668 16.1233 20.1541 30.2312 11.5652 Constraint 412 668 17.7802 22.2252 33.3379 11.5652 Constraint 599 706 13.7904 17.2380 25.8569 11.5540 Constraint 590 706 16.7265 20.9082 31.3622 11.5540 Constraint 285 687 19.6172 24.5215 36.7822 11.5486 Constraint 341 687 18.4888 23.1110 34.6664 11.5258 Constraint 350 577 13.7989 17.2487 25.8730 11.5141 Constraint 350 571 15.7388 19.6735 29.5102 11.5141 Constraint 279 668 17.0301 21.2876 31.9314 11.5104 Constraint 267 668 18.7620 23.4524 35.1787 11.5104 Constraint 144 622 17.0471 21.3089 31.9634 11.4954 Constraint 144 613 15.7456 19.6820 29.5229 11.4954 Constraint 267 552 16.7295 20.9119 31.3679 11.4768 Constraint 382 544 17.8097 22.2622 33.3933 11.4402 Constraint 511 585 14.9260 18.6575 27.9863 11.4401 Constraint 88 657 16.1028 20.1285 30.1928 11.4200 Constraint 527 613 14.9700 18.7125 28.0687 11.4179 Constraint 527 604 13.4821 16.8526 25.2790 11.4179 Constraint 519 613 15.6032 19.5039 29.2559 11.4179 Constraint 519 604 14.1009 17.6261 26.4392 11.4179 Constraint 511 613 16.4527 20.5659 30.8489 11.4179 Constraint 153 636 19.7638 24.7048 37.0572 11.3914 Constraint 585 687 14.9472 18.6840 28.0260 11.3651 Constraint 442 577 13.3954 16.7442 25.1163 11.3406 Constraint 449 636 15.0585 18.8231 28.2347 11.3382 Constraint 497 613 13.2123 16.5153 24.7730 11.3377 Constraint 449 651 16.4788 20.5986 30.8978 11.3363 Constraint 651 729 12.7486 15.9357 23.9036 11.2921 Constraint 644 729 13.8925 17.3657 26.0485 11.2921 Constraint 644 720 12.4763 15.5954 23.3931 11.2921 Constraint 629 720 13.6747 17.0934 25.6402 11.2921 Constraint 604 720 15.3294 19.1618 28.7427 11.2921 Constraint 599 720 15.3828 19.2285 28.8428 11.2921 Constraint 226 585 17.5213 21.9016 32.8524 11.2070 Constraint 226 651 18.4654 23.0817 34.6226 11.2032 Constraint 552 676 18.9115 23.6394 35.4591 11.1891 Constraint 375 644 14.5474 18.1843 27.2764 11.1694 Constraint 435 651 15.8198 19.7748 29.6622 11.1433 Constraint 250 527 14.4851 18.1063 27.1595 11.1209 Constraint 279 519 17.5733 21.9666 32.9499 11.1209 Constraint 375 571 15.7892 19.7365 29.6047 11.1113 Constraint 544 636 15.7181 19.6476 29.4715 11.0976 Constraint 161 590 15.8319 19.7898 29.6847 11.0789 Constraint 489 613 13.2243 16.5304 24.7956 11.0377 Constraint 535 629 13.8237 17.2796 25.9194 10.9826 Constraint 590 698 14.9253 18.6566 27.9849 10.9742 Constraint 303 698 17.3682 21.7103 32.5655 10.9529 Constraint 285 698 17.6653 22.0817 33.1225 10.9529 Constraint 267 687 19.8204 24.7755 37.1632 10.9529 Constraint 279 676 18.5299 23.1624 34.7436 10.9375 Constraint 449 657 16.3036 20.3795 30.5692 10.9215 Constraint 629 713 12.3235 15.4043 23.1065 10.8873 Constraint 622 713 14.4399 18.0499 27.0748 10.8873 Constraint 613 713 15.9657 19.9571 29.9356 10.8873 Constraint 604 713 14.1320 17.6650 26.4974 10.8873 Constraint 599 713 14.3969 17.9961 26.9941 10.8873 Constraint 590 713 17.3023 21.6279 32.4418 10.8873 Constraint 435 571 15.8289 19.7861 29.6792 10.8869 Constraint 429 571 15.0949 18.8686 28.3030 10.8869 Constraint 421 571 14.9442 18.6803 28.0204 10.8869 Constraint 651 735 13.4652 16.8315 25.2473 10.8670 Constraint 69 497 6.1934 7.7418 11.6126 10.8517 Constraint 69 489 9.7699 12.2124 18.3186 10.8517 Constraint 69 480 10.8660 13.5825 20.3738 10.8517 Constraint 69 473 9.5712 11.9640 17.9461 10.8517 Constraint 69 467 11.7894 14.7367 22.1050 10.8517 Constraint 69 461 10.5397 13.1746 19.7619 10.8517 Constraint 69 449 9.7738 12.2173 18.3259 10.8517 Constraint 69 442 12.0721 15.0901 22.6352 10.8517 Constraint 69 435 12.5818 15.7272 23.5908 10.8517 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 279 13.6813 17.1016 25.6524 10.8517 Constraint 69 272 14.2551 17.8189 26.7283 10.8517 Constraint 69 267 14.0334 17.5418 26.3127 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 237 14.6819 18.3523 27.5285 10.8517 Constraint 69 226 16.0908 20.1136 30.1703 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 201 15.2752 19.0940 28.6410 10.8517 Constraint 69 190 15.7492 19.6865 29.5297 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 69 176 15.4693 19.3367 29.0050 10.8517 Constraint 69 169 13.2793 16.5991 24.8987 10.8517 Constraint 69 161 16.4907 20.6134 30.9201 10.8517 Constraint 69 144 12.7629 15.9536 23.9305 10.8517 Constraint 69 136 12.2217 15.2771 22.9157 10.8517 Constraint 122 657 17.1146 21.3932 32.0899 10.8471 Constraint 527 599 12.6489 15.8111 23.7167 10.8449 Constraint 519 599 13.1226 16.4033 24.6049 10.8449 Constraint 519 590 14.1568 17.6960 26.5440 10.8449 Constraint 226 657 18.2782 22.8478 34.2717 10.8087 Constraint 226 552 19.0002 23.7502 35.6254 10.7939 Constraint 201 557 18.9654 23.7068 35.5602 10.7922 Constraint 544 668 19.1170 23.8962 35.8443 10.7775 Constraint 544 657 16.5736 20.7170 31.0755 10.7775 Constraint 497 599 11.8179 14.7724 22.1586 10.7647 Constraint 382 644 15.9645 19.9556 29.9335 10.7500 Constraint 577 687 13.8556 17.3195 25.9792 10.6983 Constraint 375 651 13.0487 16.3109 24.4663 10.6663 Constraint 368 651 13.9851 17.4814 26.2221 10.6663 Constraint 399 557 16.8788 21.0986 31.6478 10.6305 Constraint 442 657 15.1056 18.8820 28.3229 10.5806 Constraint 585 698 15.2753 19.0942 28.6413 10.5694 Constraint 404 668 16.6668 20.8335 31.2502 10.5671 Constraint 144 571 13.5399 16.9249 25.3873 10.5323 Constraint 122 571 14.8331 18.5414 27.8120 10.5323 Constraint 350 698 18.7328 23.4161 35.1241 10.5278 Constraint 341 698 16.5925 20.7406 31.1109 10.5258 Constraint 375 657 13.5817 16.9771 25.4657 10.5179 Constraint 360 657 14.7696 18.4621 27.6931 10.5026 Constraint 391 668 17.0015 21.2518 31.8777 10.5007 Constraint 96 657 18.2472 22.8090 34.2135 10.4220 Constraint 80 629 16.6825 20.8531 31.2797 10.4214 Constraint 136 613 15.4864 19.3580 29.0370 10.3912 Constraint 136 590 14.6734 18.3418 27.5127 10.3911 Constraint 267 557 18.6194 23.2742 34.9113 10.3817 Constraint 473 636 9.9436 12.4295 18.6442 10.3504 Constraint 467 636 11.0078 13.7597 20.6396 10.3504 Constraint 461 636 13.1957 16.4946 24.7420 10.3504 Constraint 473 657 11.6282 14.5352 21.8028 10.3485 Constraint 473 651 12.4151 15.5189 23.2784 10.3485 Constraint 473 644 12.1368 15.1710 22.7565 10.3485 Constraint 636 720 14.8628 18.5786 27.8678 10.2940 Constraint 519 622 14.6297 18.2872 27.4308 10.2719 Constraint 153 577 13.5861 16.9827 25.4740 10.2323 Constraint 153 571 14.2845 17.8557 26.7835 10.2323 Constraint 237 552 17.2410 21.5513 32.3269 10.2209 Constraint 544 676 20.0896 25.1120 37.6680 10.2045 Constraint 237 571 15.4490 19.3113 28.9669 10.2016 Constraint 657 735 11.5405 14.4257 21.6385 10.2003 Constraint 644 735 13.6008 17.0010 25.5015 10.2003 Constraint 497 622 13.0018 16.2522 24.3783 10.1917 Constraint 161 629 17.1738 21.4672 32.2009 10.1703 Constraint 375 544 15.9457 19.9322 29.8983 10.1421 Constraint 368 544 16.9492 21.1865 31.7797 10.1421 Constraint 221 657 17.0098 21.2622 31.8933 10.1420 Constraint 375 557 15.8058 19.7573 29.6359 10.1267 Constraint 360 571 14.6149 18.2686 27.4029 10.1113 Constraint 571 687 15.1098 18.8872 28.3308 10.1026 Constraint 557 687 17.0121 21.2652 31.8977 10.1026 Constraint 467 557 15.3828 19.2285 28.8428 10.0922 Constraint 461 577 10.4489 13.0611 19.5916 10.0426 Constraint 480 636 9.4307 11.7884 17.6826 9.9661 Constraint 480 651 13.0577 16.3221 24.4831 9.9642 Constraint 480 644 12.4266 15.5332 23.2998 9.9642 Constraint 330 698 17.6305 22.0381 33.0572 9.9529 Constraint 297 698 17.4228 21.7785 32.6677 9.9529 Constraint 279 698 15.9272 19.9090 29.8636 9.9529 Constraint 279 687 17.8751 22.3439 33.5159 9.9529 Constraint 272 698 17.9331 22.4164 33.6245 9.9529 Constraint 267 698 17.5291 21.9113 32.8670 9.9529 Constraint 221 644 16.4609 20.5761 30.8641 9.9471 Constraint 461 657 15.0683 18.8354 28.2531 9.9234 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 577 698 13.9825 17.4781 26.2171 9.9026 Constraint 571 698 16.0300 20.0375 30.0563 9.9026 Constraint 489 622 12.3559 15.4449 23.1673 9.8917 Constraint 636 713 13.4884 16.8605 25.2908 9.8892 Constraint 435 557 14.8410 18.5513 27.8269 9.8870 Constraint 421 557 14.1717 17.7146 26.5719 9.8870 Constraint 96 636 16.8148 21.0185 31.5278 9.8490 Constraint 113 657 17.1536 21.4421 32.1631 9.8471 Constraint 88 668 18.2933 22.8666 34.2999 9.8471 Constraint 104 636 16.4150 20.5187 30.7780 9.8452 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 226 544 18.4790 23.0988 34.6482 9.8093 Constraint 190 544 15.6047 19.5058 29.2587 9.8093 Constraint 201 636 12.2425 15.3031 22.9547 9.7927 Constraint 190 636 14.7003 18.3753 27.5630 9.7927 Constraint 182 636 12.9250 16.1562 24.2343 9.7927 Constraint 176 636 12.4524 15.5656 23.3483 9.7927 Constraint 122 644 17.2771 21.5964 32.3946 9.6644 Constraint 412 577 13.0160 16.2700 24.4050 9.5809 Constraint 442 668 17.5571 21.9464 32.9196 9.5806 Constraint 435 668 17.6282 22.0352 33.0528 9.5806 Constraint 391 571 13.0129 16.2662 24.3992 9.5726 Constraint 382 577 14.4586 18.0733 27.1099 9.5726 Constraint 585 706 16.5481 20.6852 31.0278 9.5694 Constraint 442 571 15.3499 19.1873 28.7810 9.5535 Constraint 279 706 17.7505 22.1881 33.2821 9.5481 Constraint 382 668 17.2100 21.5126 32.2688 9.5026 Constraint 375 668 15.7325 19.6656 29.4984 9.5026 Constraint 368 668 16.6603 20.8253 31.2380 9.5026 Constraint 360 668 15.5860 19.4825 29.2237 9.5026 Constraint 355 668 16.7810 20.9763 31.4645 9.5026 Constraint 136 629 16.0413 20.0516 30.0774 9.4883 Constraint 519 629 14.8610 18.5763 27.8644 9.4623 Constraint 80 636 17.9457 22.4322 33.6483 9.4214 Constraint 497 629 12.0345 15.0431 22.5646 9.3821 Constraint 467 657 13.0858 16.3573 24.5360 9.3504 Constraint 467 651 13.9250 17.4063 26.1094 9.3504 Constraint 467 644 13.5894 16.9867 25.4801 9.3504 Constraint 461 651 14.9992 18.7491 28.1236 9.3504 Constraint 461 644 15.3203 19.1503 28.7255 9.3504 Constraint 473 668 13.8691 17.3364 26.0046 9.3485 Constraint 382 651 13.4450 16.8063 25.2094 9.3484 Constraint 80 657 19.1166 23.8958 35.8437 9.3277 Constraint 629 729 13.6778 17.0973 25.6459 9.3075 Constraint 622 729 16.0640 20.0800 30.1200 9.3075 Constraint 622 720 14.5647 18.2059 27.3089 9.3075 Constraint 613 720 16.5829 20.7286 31.0929 9.3075 Constraint 604 729 15.3326 19.1658 28.7487 9.3075 Constraint 599 729 15.5144 19.3930 29.0895 9.3075 Constraint 590 720 17.7149 22.1436 33.2154 9.3075 Constraint 449 571 14.0638 17.5797 26.3696 9.2535 Constraint 242 557 16.6051 20.7564 31.1346 9.2189 Constraint 237 557 17.3358 21.6698 32.5047 9.2189 Constraint 201 651 15.2583 19.0729 28.6094 9.2129 Constraint 399 668 15.4567 19.3209 28.9814 9.1848 Constraint 368 557 15.7296 19.6620 29.4931 9.1267 Constraint 360 557 14.4866 18.1082 27.1623 9.1267 Constraint 552 687 17.6778 22.0973 33.1459 9.1045 Constraint 544 687 18.3332 22.9165 34.3747 9.1045 Constraint 136 622 16.3357 20.4196 30.6294 9.0912 Constraint 489 629 11.5012 14.3765 21.5648 9.0821 Constraint 161 622 15.5029 19.3786 29.0679 9.0706 Constraint 161 613 14.9484 18.6854 28.0282 9.0706 Constraint 480 657 11.0162 13.7703 20.6554 8.9661 Constraint 303 729 19.5552 24.4441 36.6661 8.9606 Constraint 285 729 19.8907 24.8634 37.2950 8.9606 Constraint 285 720 19.5317 24.4146 36.6219 8.9606 Constraint 279 729 18.7094 23.3868 35.0802 8.9606 Constraint 279 720 17.9918 22.4898 33.7346 8.9606 Constraint 267 729 20.0448 25.0559 37.5839 8.9606 Constraint 267 720 19.4585 24.3231 36.4846 8.9606 Constraint 297 644 14.3700 17.9626 26.9438 8.9509 Constraint 182 644 13.0487 16.3109 24.4663 8.9509 Constraint 552 698 17.8711 22.3389 33.5083 8.9045 Constraint 544 698 18.7612 23.4515 35.1772 8.9045 Constraint 613 729 17.3292 21.6615 32.4923 8.9027 Constraint 585 720 18.1970 22.7462 34.1193 8.9027 Constraint 585 713 17.6160 22.0200 33.0300 8.9027 Constraint 577 706 15.5573 19.4467 29.1700 8.9027 Constraint 571 706 17.0821 21.3526 32.0289 8.9027 Constraint 557 706 18.6144 23.2680 34.9020 8.9027 Constraint 557 698 17.1192 21.3990 32.0984 8.9027 Constraint 69 511 7.4924 9.3655 14.0483 8.8530 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 242 676 17.8246 22.2807 33.4210 8.8183 Constraint 237 676 18.3024 22.8780 34.3171 8.8183 Constraint 237 668 16.2504 20.3130 30.4695 8.8183 Constraint 210 668 14.4396 18.0495 27.0743 8.8183 Constraint 201 657 14.8937 18.6171 27.9256 8.8183 Constraint 176 657 14.3836 17.9795 26.9693 8.8183 Constraint 226 636 14.7107 18.3884 27.5825 8.7927 Constraint 322 668 13.7855 17.2318 25.8478 8.7246 Constraint 292 668 15.0003 18.7504 28.1256 8.7246 Constraint 259 668 17.0663 21.3328 31.9992 8.7246 Constraint 96 644 17.8067 22.2583 33.3875 8.6587 Constraint 590 729 18.3229 22.9036 34.3555 8.6407 Constraint 169 644 13.4077 16.7597 25.1395 8.6331 Constraint 201 644 13.5267 16.9083 25.3625 8.6177 Constraint 176 644 12.3345 15.4181 23.1272 8.6177 Constraint 144 636 16.4641 20.5802 30.8703 8.5925 Constraint 382 571 13.7353 17.1691 25.7536 8.5726 Constraint 341 729 19.2339 24.0424 36.0635 8.5557 Constraint 303 720 18.9264 23.6580 35.4870 8.5557 Constraint 442 557 14.3526 17.9408 26.9112 8.5535 Constraint 272 651 15.7968 19.7460 29.6189 8.5461 Constraint 182 651 13.3364 16.6705 25.0058 8.5461 Constraint 144 557 12.8022 16.0028 24.0042 8.5343 Constraint 382 657 13.4164 16.7705 25.1557 8.5180 Constraint 368 657 13.8104 17.2630 25.8945 8.5180 Constraint 629 735 14.7913 18.4891 27.7336 8.4775 Constraint 622 735 17.7428 22.1785 33.2678 8.4775 Constraint 613 735 18.7180 23.3974 35.0962 8.4775 Constraint 604 735 16.3915 20.4894 30.7340 8.4775 Constraint 467 668 15.5951 19.4939 29.2408 8.3504 Constraint 461 668 17.3913 21.7391 32.6087 8.3504 Constraint 636 729 14.2208 17.7761 26.6641 8.3094 Constraint 599 735 17.8808 22.3511 33.5266 8.3094 Constraint 113 651 16.2974 20.3718 30.5577 8.2596 Constraint 467 571 12.9123 16.1404 24.2106 8.2554 Constraint 461 571 12.9598 16.1998 24.2997 8.2554 Constraint 96 651 16.9547 21.1934 31.7901 8.2539 Constraint 449 557 13.5343 16.9179 25.3768 8.2535 Constraint 80 622 16.4365 20.5456 30.8184 8.2533 Constraint 80 613 15.9536 19.9420 29.9130 8.2533 Constraint 585 729 18.3241 22.9051 34.3577 8.2359 Constraint 577 729 17.2863 21.6078 32.4118 8.2359 Constraint 577 720 16.6915 20.8643 31.2965 8.2359 Constraint 577 713 16.5105 20.6381 30.9572 8.2359 Constraint 571 729 18.7469 23.4336 35.1504 8.2359 Constraint 571 720 17.9840 22.4800 33.7199 8.2359 Constraint 571 713 17.4991 21.8739 32.8108 8.2359 Constraint 153 557 13.6027 17.0034 25.5050 8.2343 Constraint 176 651 13.2728 16.5909 24.8864 8.2129 Constraint 322 676 13.8056 17.2570 25.8856 8.1516 Constraint 314 676 15.2712 19.0890 28.6334 8.1516 Constraint 292 676 15.7220 19.6525 29.4788 8.1516 Constraint 210 676 15.6647 19.5808 29.3713 8.1516 Constraint 190 657 15.4868 19.3584 29.0377 8.1516 Constraint 250 571 15.4031 19.2539 28.8808 8.1084 Constraint 242 571 12.0632 15.0790 22.6185 8.1084 Constraint 69 250 14.5595 18.1993 27.2990 8.0149 Constraint 144 651 18.1648 22.7060 34.0590 7.9973 Constraint 169 687 18.0720 22.5900 33.8850 7.9757 Constraint 480 668 12.7371 15.9213 23.8820 7.9661 Constraint 272 644 14.8362 18.5453 27.8179 7.9509 Constraint 226 644 16.2367 20.2958 30.4438 7.9509 Constraint 190 644 13.9930 17.4913 26.2369 7.9509 Constraint 449 668 17.8024 22.2530 33.3794 7.9215 Constraint 552 706 19.7653 24.7066 37.0599 7.9046 Constraint 169 668 14.6645 18.3307 27.4960 7.8337 Constraint 201 668 14.7229 18.4036 27.6054 7.8183 Constraint 153 651 19.9765 24.9706 37.4559 7.8002 Constraint 404 557 16.0855 20.1068 30.1603 7.7937 Constraint 404 571 13.9020 17.3775 26.0662 7.7784 Constraint 297 668 14.2792 17.8489 26.7734 7.7246 Constraint 391 557 12.9017 16.1272 24.1908 7.5880 Constraint 382 557 14.2813 17.8516 26.7775 7.5880 Constraint 527 644 15.9370 19.9212 29.8818 7.5648 Constraint 519 644 17.5533 21.9416 32.9124 7.5648 Constraint 350 729 20.0038 25.0048 37.5072 7.5577 Constraint 190 651 14.7302 18.4127 27.6191 7.5461 Constraint 136 636 15.3780 19.2225 28.8337 7.4883 Constraint 527 622 10.9543 13.6929 20.5394 7.4352 Constraint 511 622 14.2981 17.8726 26.8089 7.4352 Constraint 497 651 15.7819 19.7274 29.5911 7.4185 Constraint 497 644 15.5077 19.3847 29.0770 7.4185 Constraint 169 698 17.4588 21.8236 32.7353 7.3800 Constraint 80 651 18.5115 23.1394 34.7092 7.3277 Constraint 368 571 12.8417 16.0521 24.0781 7.2746 Constraint 461 557 12.5643 15.7054 23.5581 7.2554 Constraint 590 735 20.5631 25.7039 38.5558 7.2378 Constraint 585 735 20.2005 25.2506 37.8760 7.2378 Constraint 577 735 19.7232 24.6541 36.9811 7.2378 Constraint 552 720 21.1152 26.3940 39.5910 7.2378 Constraint 636 735 14.9700 18.7125 28.0688 7.2175 Constraint 527 651 15.3481 19.1851 28.7777 7.1600 Constraint 128 636 15.3015 19.1269 28.6903 7.1549 Constraint 297 676 14.3921 17.9902 26.9853 7.1516 Constraint 226 668 16.4736 20.5920 30.8881 7.1516 Constraint 221 668 15.0727 18.8408 28.2613 7.1516 Constraint 182 676 14.2324 17.7906 26.6858 7.1516 Constraint 182 668 12.4926 15.6157 23.4236 7.1516 Constraint 226 571 16.3073 20.3841 30.5761 7.1084 Constraint 153 657 19.0923 23.8653 35.7980 7.0600 Constraint 429 676 16.2212 20.2765 30.4147 7.0038 Constraint 421 676 15.5048 19.3810 29.0716 7.0038 Constraint 412 676 18.4686 23.0858 34.6287 7.0038 Constraint 341 676 14.8232 18.5290 27.7935 6.9374 Constraint 330 668 13.0313 16.2891 24.4336 6.9374 Constraint 412 706 19.8241 24.7801 37.1701 6.8815 Constraint 58 511 10.8517 13.5647 20.3470 6.8531 Constraint 58 497 9.7792 12.2240 18.3360 6.8531 Constraint 58 473 13.7561 17.1952 25.7928 6.8531 Constraint 58 449 12.8759 16.0948 24.1422 6.8531 Constraint 58 442 15.5132 19.3915 29.0872 6.8531 Constraint 58 435 16.3333 20.4166 30.6249 6.8531 Constraint 58 429 12.6492 15.8114 23.7172 6.8531 Constraint 58 421 11.7793 14.7242 22.0863 6.8531 Constraint 58 412 15.1547 18.9434 28.4151 6.8531 Constraint 58 404 14.2257 17.7821 26.6732 6.8531 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 382 15.3881 19.2352 28.8527 6.8531 Constraint 58 375 12.8779 16.0974 24.1461 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 297 12.4181 15.5226 23.2839 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 58 285 13.3458 16.6823 25.0234 6.8531 Constraint 58 279 15.5587 19.4483 29.1725 6.8531 Constraint 58 272 16.4236 20.5295 30.7942 6.8531 Constraint 58 267 16.7879 20.9848 31.4772 6.8531 Constraint 58 259 14.3583 17.9478 26.9217 6.8531 Constraint 58 237 17.7259 22.1573 33.2360 6.8531 Constraint 58 226 18.6432 23.3040 34.9560 6.8531 Constraint 58 221 15.0813 18.8516 28.2775 6.8531 Constraint 58 210 13.4081 16.7601 25.1401 6.8531 Constraint 58 201 17.3128 21.6410 32.4615 6.8531 Constraint 58 190 17.8007 22.2508 33.3763 6.8531 Constraint 58 182 14.0495 17.5618 26.3427 6.8531 Constraint 58 176 17.0924 21.3655 32.0482 6.8531 Constraint 58 169 14.9643 18.7054 28.0581 6.8531 Constraint 58 161 17.3467 21.6833 32.5250 6.8531 Constraint 58 144 13.1979 16.4974 24.7461 6.8531 Constraint 58 136 12.4233 15.5292 23.2938 6.8531 Constraint 58 128 11.5778 14.4722 21.7083 6.8531 Constraint 80 644 18.5342 23.1678 34.7517 6.8485 Constraint 497 668 15.6258 19.5323 29.2984 6.8455 Constraint 497 657 13.6859 17.1073 25.6610 6.8455 Constraint 421 687 17.5697 21.9621 32.9432 6.8104 Constraint 412 571 13.9091 17.3864 26.0796 6.7938 Constraint 412 557 14.0522 17.5652 26.3478 6.7938 Constraint 489 644 14.9273 18.6591 27.9886 6.7822 Constraint 128 644 15.7104 19.6379 29.4569 6.6645 Constraint 113 644 14.7626 18.4532 27.6798 6.6645 Constraint 104 644 15.0308 18.7885 28.1828 6.6645 Constraint 527 629 11.1066 13.8833 20.8249 6.6256 Constraint 511 629 12.9069 16.1336 24.2004 6.6256 Constraint 489 657 13.0488 16.3111 24.4666 6.5455 Constraint 519 636 17.6571 22.0714 33.1071 6.5023 Constraint 144 644 16.3073 20.3841 30.5762 6.4022 Constraint 489 651 14.3841 17.9801 26.9702 6.3774 Constraint 330 676 12.5279 15.6599 23.4898 6.3644 Constraint 303 676 15.2927 19.1158 28.6738 6.3644 Constraint 285 676 16.3503 20.4378 30.6567 6.3644 Constraint 259 676 16.7222 20.9028 31.3542 6.3644 Constraint 250 668 17.4409 21.8012 32.7017 6.3644 Constraint 473 676 16.4230 20.5288 30.7932 6.3581 Constraint 242 706 18.0151 22.5189 33.7784 6.3085 Constraint 144 657 16.6295 20.7869 31.1804 6.2610 Constraint 128 651 15.6548 19.5685 29.3528 6.2597 Constraint 104 651 14.2145 17.7681 26.6521 6.2597 Constraint 226 557 18.4749 23.0937 34.6405 6.2190 Constraint 421 698 17.4891 21.8614 32.7921 6.2147 Constraint 535 651 15.2704 19.0880 28.6319 6.1822 Constraint 535 644 15.3704 19.2129 28.8194 6.1822 Constraint 161 636 15.3104 19.1379 28.7069 6.1800 Constraint 267 644 16.1546 20.1932 30.2898 6.1638 Constraint 201 676 15.4525 19.3156 28.9735 6.1535 Constraint 176 676 13.6516 17.0645 25.5967 6.1535 Constraint 176 668 11.1787 13.9733 20.9600 6.1535 Constraint 442 676 17.3991 21.7489 32.6233 6.0173 Constraint 404 676 18.1592 22.6990 34.0484 6.0115 Constraint 429 706 18.3145 22.8931 34.3397 5.9771 Constraint 322 687 14.9911 18.7389 28.1084 5.9756 Constraint 314 687 15.8253 19.7816 29.6724 5.9756 Constraint 297 687 15.7999 19.7499 29.6248 5.9756 Constraint 292 687 16.1473 20.1841 30.2762 5.9756 Constraint 259 687 17.9134 22.3918 33.5877 5.9756 Constraint 242 687 17.8371 22.2963 33.4445 5.9756 Constraint 237 687 18.4568 23.0710 34.6065 5.9756 Constraint 210 687 16.5232 20.6540 30.9810 5.9756 Constraint 489 668 14.2132 17.7665 26.6497 5.9726 Constraint 391 698 18.7572 23.4464 35.1697 5.9528 Constraint 330 687 14.8773 18.5966 27.8949 5.9528 Constraint 535 636 16.7096 20.8870 31.3304 5.9294 Constraint 58 242 14.3988 17.9985 26.9977 5.9075 Constraint 421 706 17.1045 21.3807 32.0710 5.8834 Constraint 69 604 20.0158 25.0198 37.5297 5.8530 Constraint 69 599 19.9766 24.9707 37.4561 5.8530 Constraint 69 590 20.5883 25.7354 38.6031 5.8530 Constraint 69 577 17.0810 21.3513 32.0269 5.8530 Constraint 69 571 18.7167 23.3959 35.0939 5.8530 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 480 12.6846 15.8557 23.7836 5.8367 Constraint 58 467 14.1825 17.7281 26.5921 5.8367 Constraint 58 461 12.3920 15.4900 23.2350 5.8367 Constraint 58 153 14.3962 17.9953 26.9929 5.8367 Constraint 169 676 14.3872 17.9840 26.9760 5.8357 Constraint 412 687 19.1726 23.9658 35.9486 5.8181 Constraint 429 687 17.8510 22.3138 33.4707 5.8124 Constraint 629 742 15.1794 18.9742 28.4614 5.7621 Constraint 622 742 17.9236 22.4045 33.6067 5.7621 Constraint 604 742 15.9457 19.9321 29.8982 5.7621 Constraint 519 651 15.4043 19.2554 28.8831 5.7141 Constraint 201 698 16.6388 20.7985 31.1978 5.7133 Constraint 136 644 14.5154 18.1442 27.2163 5.6645 Constraint 535 668 17.2954 21.6193 32.4289 5.6092 Constraint 535 657 15.7839 19.7298 29.5947 5.6092 Constraint 511 644 16.8912 21.1140 31.6710 5.6092 Constraint 391 676 17.7071 22.1339 33.2009 5.5345 Constraint 360 676 16.0455 20.0569 30.0853 5.5345 Constraint 355 676 16.6865 20.8581 31.2872 5.5345 Constraint 350 676 16.2374 20.2967 30.4451 5.5345 Constraint 668 742 9.9540 12.4425 18.6637 5.5002 Constraint 657 742 12.0529 15.0661 22.5991 5.5002 Constraint 651 742 13.6567 17.0709 25.6063 5.5002 Constraint 644 742 12.9911 16.2388 24.3582 5.5002 Constraint 104 657 13.7144 17.1430 25.7146 5.4298 Constraint 322 698 14.4650 18.0813 27.1220 5.3798 Constraint 314 698 15.1930 18.9912 28.4868 5.3798 Constraint 292 698 14.6192 18.2740 27.4110 5.3798 Constraint 259 698 16.1507 20.1884 30.2825 5.3798 Constraint 250 698 18.4390 23.0488 34.5732 5.3798 Constraint 242 698 16.6761 20.8451 31.2677 5.3798 Constraint 237 698 17.2269 21.5336 32.3004 5.3798 Constraint 210 698 15.3963 19.2454 28.8680 5.3798 Constraint 250 676 18.5277 23.1596 34.7394 5.3721 Constraint 272 676 14.0642 17.5803 26.3704 5.3644 Constraint 272 668 12.1879 15.2349 22.8523 5.3644 Constraint 267 676 16.3563 20.4454 30.6682 5.3644 Constraint 226 676 17.1569 21.4462 32.1693 5.3644 Constraint 221 676 14.9300 18.6625 27.9938 5.3644 Constraint 190 668 12.1404 15.1755 22.7632 5.3644 Constraint 467 676 17.5781 21.9727 32.9590 5.3601 Constraint 461 676 17.9053 22.3817 33.5725 5.3601 Constraint 511 651 17.0545 21.3182 31.9773 5.3092 Constraint 237 706 18.1269 22.6587 33.9880 5.3085 Constraint 226 706 18.2222 22.7777 34.1665 5.3085 Constraint 210 706 16.0841 20.1051 30.1576 5.3085 Constraint 201 706 16.6893 20.8616 31.2923 5.3085 Constraint 190 706 16.1228 20.1535 30.2302 5.3085 Constraint 169 706 15.9498 19.9373 29.9060 5.3085 Constraint 497 636 13.0698 16.3373 24.5059 5.2745 Constraint 136 651 14.6464 18.3080 27.4620 5.2597 Constraint 557 720 18.8894 23.6117 35.4175 5.2361 Constraint 429 698 18.2824 22.8530 34.2795 5.2166 Constraint 599 742 17.4377 21.7971 32.6957 5.1892 Constraint 435 687 18.8843 23.6054 35.4081 5.1670 Constraint 250 552 17.1831 21.4789 32.2183 5.1440 Constraint 250 544 19.2088 24.0110 36.0166 5.1431 Constraint 250 557 17.2425 21.5531 32.3296 5.1258 Constraint 613 742 17.6230 22.0287 33.0431 5.0954 Constraint 535 676 17.6682 22.0852 33.1279 5.0363 Constraint 435 676 18.2625 22.8282 34.2423 5.0192 Constraint 122 687 18.7407 23.4258 35.1388 4.9988 Constraint 489 676 16.0782 20.0977 30.1466 4.9758 Constraint 480 676 15.6664 19.5830 29.3745 4.9758 Constraint 221 687 17.1084 21.3855 32.0782 4.9756 Constraint 201 687 17.1590 21.4487 32.1730 4.9756 Constraint 182 687 14.7002 18.3753 27.5629 4.9756 Constraint 314 706 14.5088 18.1360 27.2040 4.9750 Constraint 250 706 19.4222 24.2777 36.4166 4.9750 Constraint 489 636 11.4076 14.2595 21.3892 4.9745 Constraint 399 698 17.8328 22.2910 33.4365 4.9547 Constraint 399 687 17.7423 22.1779 33.2669 4.9547 Constraint 399 676 16.4639 20.5798 30.8697 4.9547 Constraint 360 698 17.0567 21.3209 31.9813 4.9547 Constraint 161 657 16.4664 20.5831 30.8746 4.8568 Constraint 128 668 15.5360 19.4200 29.1301 4.8568 Constraint 128 657 13.5938 16.9922 25.4883 4.8568 Constraint 122 676 16.8021 21.0027 31.5040 4.8568 Constraint 122 668 14.7754 18.4693 27.7039 4.8568 Constraint 113 668 14.2998 17.8747 26.8121 4.8568 Constraint 104 668 14.8536 18.5670 27.8506 4.8568 Constraint 88 676 16.2001 20.2501 30.3751 4.8568 Constraint 69 585 17.4710 21.8387 32.7581 4.8530 Constraint 69 557 17.1328 21.4160 32.1240 4.8530 Constraint 69 544 17.6682 22.0852 33.1278 4.8530 Constraint 69 535 16.1602 20.2003 30.3004 4.8530 Constraint 69 527 12.0490 15.0613 22.5919 4.8530 Constraint 527 657 12.8434 16.0542 24.0814 4.8488 Constraint 442 687 17.0773 21.3466 32.0200 4.8258 Constraint 161 644 13.8812 17.3514 26.0272 4.6561 Constraint 527 636 15.2172 19.0215 28.5322 4.6112 Constraint 511 636 15.6738 19.5922 29.3884 4.6112 Constraint 144 676 17.7561 22.1951 33.2926 4.5945 Constraint 399 706 17.1401 21.4251 32.1377 4.5499 Constraint 391 706 17.8184 22.2731 33.4096 4.5499 Constraint 391 687 18.2624 22.8280 34.2420 4.5499 Constraint 382 706 19.9688 24.9609 37.4414 4.5499 Constraint 368 706 18.1498 22.6873 34.0310 4.5499 Constraint 360 706 15.9324 19.9155 29.8732 4.5499 Constraint 360 687 16.8107 21.0134 31.5201 4.5499 Constraint 355 706 15.6792 19.5990 29.3986 4.5499 Constraint 355 698 16.7955 20.9944 31.4915 4.5499 Constraint 355 687 16.8085 21.0106 31.5158 4.5499 Constraint 350 706 16.1348 20.1685 30.2527 4.5499 Constraint 350 687 16.9241 21.1551 31.7326 4.5499 Constraint 527 668 14.7750 18.4687 27.7031 4.5488 Constraint 519 657 13.9246 17.4057 26.1086 4.5488 Constraint 511 657 13.7205 17.1506 25.7259 4.5488 Constraint 341 706 12.1232 15.1540 22.7310 4.5480 Constraint 375 676 17.5152 21.8940 32.8410 4.5422 Constraint 368 676 17.6464 22.0580 33.0870 4.5422 Constraint 590 742 19.4691 24.3364 36.5046 4.5224 Constraint 585 742 18.7614 23.4518 35.1777 4.5224 Constraint 577 742 19.6405 24.5506 36.8259 4.5224 Constraint 96 668 16.5010 20.6263 30.9394 4.4317 Constraint 153 698 18.7956 23.4945 35.2417 4.4031 Constraint 122 698 18.9003 23.6254 35.4381 4.4031 Constraint 272 687 15.3909 19.2386 28.8579 4.3798 Constraint 226 698 16.2843 20.3554 30.5331 4.3798 Constraint 226 687 18.4789 23.0986 34.6479 4.3798 Constraint 221 698 14.3185 17.8982 26.8473 4.3798 Constraint 190 698 13.6902 17.1128 25.6692 4.3798 Constraint 190 687 16.0149 20.0186 30.0279 4.3798 Constraint 182 698 12.0858 15.1073 22.6609 4.3798 Constraint 176 698 13.3038 16.6297 24.9446 4.3798 Constraint 190 676 12.7959 15.9949 23.9923 4.3664 Constraint 176 706 13.5953 16.9942 25.4913 4.3104 Constraint 527 698 16.2814 20.3517 30.5276 4.3093 Constraint 527 687 14.8556 18.5695 27.8543 4.3093 Constraint 519 698 15.9545 19.9431 29.9147 4.3093 Constraint 519 687 15.0512 18.8140 28.2210 4.3093 Constraint 511 698 16.4504 20.5631 30.8446 4.3093 Constraint 511 687 16.8934 21.1168 31.6751 4.3093 Constraint 161 651 14.6223 18.2779 27.4169 4.2513 Constraint 442 706 19.3637 24.2046 36.3069 4.2301 Constraint 442 698 16.8455 21.0569 31.5853 4.2301 Constraint 435 698 18.3136 22.8920 34.3380 4.2301 Constraint 153 644 16.8416 21.0520 31.5781 4.2146 Constraint 161 676 17.5239 21.9049 32.8573 4.1922 Constraint 473 687 15.1600 18.9500 28.4249 4.1667 Constraint 636 742 14.4324 18.0405 27.0608 4.0973 Constraint 322 729 18.3204 22.9005 34.3507 4.0542 Constraint 322 720 16.2637 20.3296 30.4944 4.0542 Constraint 292 729 19.0120 23.7650 35.6475 4.0542 Constraint 292 720 16.9783 21.2229 31.8344 4.0542 Constraint 259 729 20.7727 25.9658 38.9487 4.0542 Constraint 242 720 19.4329 24.2911 36.4366 4.0542 Constraint 221 720 18.3099 22.8874 34.3310 4.0542 Constraint 210 720 18.1273 22.6592 33.9888 4.0542 Constraint 182 720 16.6009 20.7511 31.1267 4.0542 Constraint 58 250 16.7463 20.9329 31.3993 4.0163 Constraint 51 449 13.7924 17.2405 25.8608 4.0163 Constraint 51 442 16.7066 20.8833 31.3249 4.0163 Constraint 51 435 16.6274 20.7843 31.1764 4.0163 Constraint 51 429 13.0177 16.2722 24.4082 4.0163 Constraint 51 421 13.3718 16.7148 25.0722 4.0163 Constraint 51 412 16.4181 20.5227 30.7840 4.0163 Constraint 51 404 14.7570 18.4462 27.6694 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 391 15.0745 18.8432 28.2648 4.0163 Constraint 51 382 16.4733 20.5916 30.8874 4.0163 Constraint 51 375 13.9085 17.3857 26.0785 4.0163 Constraint 51 368 14.4564 18.0705 27.1057 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 355 11.8633 14.8291 22.2437 4.0163 Constraint 51 350 14.6555 18.3194 27.4791 4.0163 Constraint 51 341 13.7194 17.1492 25.7238 4.0163 Constraint 51 330 12.6862 15.8578 23.7866 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 303 13.5882 16.9853 25.4779 4.0163 Constraint 51 297 14.8148 18.5186 27.7778 4.0163 Constraint 51 292 13.4736 16.8420 25.2630 4.0163 Constraint 51 285 14.5831 18.2289 27.3433 4.0163 Constraint 51 279 17.2907 21.6133 32.4200 4.0163 Constraint 51 272 17.6102 22.0128 33.0192 4.0163 Constraint 51 267 18.0117 22.5146 33.7720 4.0163 Constraint 51 259 14.9575 18.6969 28.0454 4.0163 Constraint 51 250 16.9915 21.2393 31.8590 4.0163 Constraint 51 242 13.8008 17.2510 25.8766 4.0163 Constraint 51 237 15.9982 19.9978 29.9967 4.0163 Constraint 51 226 18.8052 23.5065 35.2598 4.0163 Constraint 51 221 16.2843 20.3554 30.5331 4.0163 Constraint 51 210 13.9320 17.4150 26.1226 4.0163 Constraint 51 201 17.9132 22.3915 33.5873 4.0163 Constraint 51 190 18.6861 23.3577 35.0365 4.0163 Constraint 51 182 15.2071 19.0089 28.5133 4.0163 Constraint 51 176 17.8354 22.2942 33.4413 4.0163 Constraint 51 169 14.9992 18.7489 28.1234 4.0163 Constraint 51 161 16.8575 21.0719 31.6079 4.0163 Constraint 51 144 12.2532 15.3165 22.9747 4.0163 Constraint 51 136 12.6908 15.8635 23.7952 4.0163 Constraint 51 128 12.1092 15.1365 22.7047 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 41 429 15.9727 19.9659 29.9489 4.0163 Constraint 41 421 16.4560 20.5700 30.8551 4.0163 Constraint 41 412 19.1872 23.9840 35.9760 4.0163 Constraint 41 404 17.0151 21.2689 31.9034 4.0163 Constraint 41 399 14.2035 17.7544 26.6316 4.0163 Constraint 41 391 17.2725 21.5906 32.3859 4.0163 Constraint 41 382 18.2352 22.7941 34.1911 4.0163 Constraint 41 375 15.1260 18.9075 28.3612 4.0163 Constraint 41 368 15.6107 19.5134 29.2701 4.0163 Constraint 41 360 14.0288 17.5361 26.3041 4.0163 Constraint 41 355 13.2258 16.5323 24.7984 4.0163 Constraint 41 350 16.4647 20.5809 30.8713 4.0163 Constraint 41 341 15.2699 19.0874 28.6310 4.0163 Constraint 41 330 15.4145 19.2682 28.9022 4.0163 Constraint 41 322 14.4620 18.0775 27.1162 4.0163 Constraint 41 314 13.6431 17.0538 25.5807 4.0163 Constraint 41 303 16.2894 20.3618 30.5426 4.0163 Constraint 41 297 18.2441 22.8052 34.2078 4.0163 Constraint 41 292 17.0486 21.3107 31.9661 4.0163 Constraint 41 285 17.3849 21.7311 32.5967 4.0163 Constraint 41 279 20.2989 25.3737 38.0605 4.0163 Constraint 41 272 21.0993 26.3741 39.5611 4.0163 Constraint 41 259 17.8219 22.2774 33.4161 4.0163 Constraint 41 250 19.4013 24.2516 36.3774 4.0163 Constraint 41 242 16.7648 20.9560 31.4340 4.0163 Constraint 41 237 19.2850 24.1063 36.1594 4.0163 Constraint 41 221 19.6872 24.6090 36.9135 4.0163 Constraint 41 210 17.7420 22.1775 33.2662 4.0163 Constraint 41 182 19.1914 23.9892 35.9838 4.0163 Constraint 41 169 19.0733 23.8416 35.7624 4.0163 Constraint 41 161 21.1226 26.4032 39.6048 4.0163 Constraint 41 144 16.3834 20.4793 30.7189 4.0163 Constraint 41 136 17.0559 21.3199 31.9799 4.0163 Constraint 41 128 16.3916 20.4895 30.7342 4.0163 Constraint 41 122 13.6300 17.0375 25.5562 4.0163 Constraint 41 113 12.3966 15.4958 23.2437 4.0163 Constraint 144 687 17.2027 21.5034 32.2550 3.9988 Constraint 136 687 17.9619 22.4524 33.6785 3.9988 Constraint 113 687 17.7601 22.2002 33.3002 3.9988 Constraint 88 687 16.8660 21.0825 31.6238 3.9986 Constraint 435 706 18.8932 23.6165 35.4248 3.9925 Constraint 250 687 18.6552 23.3190 34.9786 3.9909 Constraint 176 687 13.7477 17.1846 25.7769 3.9775 Constraint 404 706 18.4959 23.1199 34.6799 3.9769 Constraint 375 706 18.0410 22.5512 33.8268 3.9769 Constraint 497 698 14.4464 18.0580 27.0870 3.9758 Constraint 497 687 14.9530 18.6912 28.0368 3.9758 Constraint 489 698 13.7269 17.1586 25.7379 3.9758 Constraint 489 687 14.6079 18.2599 27.3898 3.9758 Constraint 480 698 13.6928 17.1160 25.6740 3.9758 Constraint 480 687 14.9330 18.6662 27.9994 3.9758 Constraint 527 676 14.5328 18.1661 27.2491 3.9758 Constraint 519 676 15.8039 19.7548 29.6323 3.9758 Constraint 519 668 15.3023 19.1279 28.6919 3.9758 Constraint 511 676 17.7708 22.2135 33.3203 3.9758 Constraint 511 668 14.6647 18.3308 27.4963 3.9758 Constraint 330 706 9.2476 11.5595 17.3392 3.9750 Constraint 322 706 11.3874 14.2342 21.3514 3.9750 Constraint 303 706 11.9031 14.8788 22.3183 3.9750 Constraint 297 706 9.9401 12.4251 18.6376 3.9750 Constraint 292 706 12.3381 15.4227 23.1340 3.9750 Constraint 285 706 13.4088 16.7610 25.1415 3.9750 Constraint 272 706 12.1725 15.2156 22.8234 3.9750 Constraint 267 706 13.9092 17.3865 26.0798 3.9750 Constraint 259 706 14.8927 18.6159 27.9238 3.9750 Constraint 221 706 14.2220 17.7775 26.6663 3.9750 Constraint 182 706 11.5831 14.4789 21.7184 3.9750 Constraint 535 687 15.6776 19.5970 29.3956 3.9363 Constraint 136 676 15.3614 19.2018 28.8027 3.8568 Constraint 136 668 13.2060 16.5075 24.7613 3.8568 Constraint 136 657 11.4022 14.2527 21.3791 3.8568 Constraint 128 676 15.3976 19.2470 28.8705 3.8568 Constraint 113 676 14.7616 18.4520 27.6779 3.8568 Constraint 69 552 13.5063 16.8829 25.3244 3.8531 Constraint 69 519 11.8878 14.8597 22.2896 3.8531 Constraint 58 604 20.0149 25.0186 37.5280 3.8531 Constraint 58 599 20.6875 25.8594 38.7891 3.8531 Constraint 58 585 16.5961 20.7451 31.1176 3.8531 Constraint 58 577 16.9802 21.2253 31.8379 3.8531 Constraint 58 571 18.2230 22.7788 34.1682 3.8531 Constraint 58 557 15.7177 19.6472 29.4708 3.8531 Constraint 58 552 13.5060 16.8825 25.3238 3.8531 Constraint 58 544 17.0510 21.3137 31.9705 3.8531 Constraint 58 535 15.6693 19.5866 29.3799 3.8531 Constraint 58 527 10.4556 13.0696 19.6043 3.8531 Constraint 421 729 21.0665 26.3331 39.4996 3.6494 Constraint 421 713 17.7588 22.1984 33.2977 3.6494 Constraint 412 713 20.3390 25.4238 38.1357 3.6494 Constraint 242 713 18.0137 22.5172 33.7757 3.6494 Constraint 237 713 18.9615 23.7018 35.5527 3.6494 Constraint 226 713 19.2918 24.1147 36.1721 3.6494 Constraint 221 713 17.1495 21.4368 32.1552 3.6494 Constraint 210 713 16.5562 20.6953 31.0429 3.6494 Constraint 201 713 17.8301 22.2876 33.4314 3.6494 Constraint 190 713 17.2506 21.5633 32.3449 3.6494 Constraint 182 713 14.9039 18.6299 27.9449 3.6494 Constraint 169 713 16.8565 21.0706 31.6060 3.6494 Constraint 473 698 13.6906 17.1133 25.6699 3.5710 Constraint 412 698 17.2298 21.5373 32.3059 3.5634 Constraint 382 676 18.0433 22.5541 33.8311 3.5576 Constraint 80 668 17.3092 21.6365 32.4547 3.4311 Constraint 153 687 18.3517 22.9397 34.4095 3.4050 Constraint 144 698 17.4921 21.8651 32.7977 3.4031 Constraint 136 698 18.5185 23.1482 34.7223 3.4031 Constraint 330 729 15.3641 19.2051 28.8077 3.3875 Constraint 314 729 18.7844 23.4804 35.2207 3.3875 Constraint 297 729 16.4207 20.5259 30.7888 3.3875 Constraint 297 720 13.7901 17.2376 25.8564 3.3875 Constraint 272 720 16.1435 20.1794 30.2691 3.3875 Constraint 259 720 17.9581 22.4476 33.6714 3.3875 Constraint 449 676 14.8171 18.5214 27.7820 3.3601 Constraint 33 435 20.0964 25.1206 37.6808 3.3388 Constraint 33 429 16.3114 20.3893 30.5839 3.3388 Constraint 33 421 15.8180 19.7725 29.6588 3.3388 Constraint 33 412 19.3694 24.2118 36.3177 3.3388 Constraint 33 404 18.2329 22.7911 34.1867 3.3388 Constraint 33 399 14.7826 18.4783 27.7174 3.3388 Constraint 33 391 17.3302 21.6628 32.4942 3.3388 Constraint 33 382 19.4938 24.3673 36.5509 3.3388 Constraint 33 375 16.9973 21.2467 31.8700 3.3388 Constraint 33 368 16.1762 20.2202 30.3303 3.3388 Constraint 33 360 14.1610 17.7012 26.5518 3.3388 Constraint 33 355 11.9953 14.9941 22.4912 3.3388 Constraint 33 350 14.7060 18.3824 27.5737 3.3388 Constraint 33 341 13.1862 16.4828 24.7242 3.3388 Constraint 33 330 12.7842 15.9803 23.9704 3.3388 Constraint 33 322 12.3424 15.4280 23.1419 3.3388 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 33 303 14.7631 18.4538 27.6807 3.3388 Constraint 33 297 16.2600 20.3250 30.4875 3.3388 Constraint 33 292 16.2492 20.3114 30.4672 3.3388 Constraint 33 285 17.1466 21.4333 32.1499 3.3388 Constraint 33 279 19.0331 23.7914 35.6871 3.3388 Constraint 33 272 20.1232 25.1540 37.7310 3.3388 Constraint 33 267 20.6618 25.8273 38.7409 3.3388 Constraint 33 259 18.3782 22.9727 34.4590 3.3388 Constraint 33 242 18.1339 22.6674 34.0010 3.3388 Constraint 33 237 20.5182 25.6478 38.4717 3.3388 Constraint 33 221 19.6563 24.5704 36.8556 3.3388 Constraint 33 210 17.8073 22.2591 33.3887 3.3388 Constraint 33 201 21.7703 27.2128 40.8193 3.3388 Constraint 33 190 21.7011 27.1264 40.6895 3.3388 Constraint 33 182 17.8905 22.3632 33.5448 3.3388 Constraint 33 176 21.0509 26.3136 39.4704 3.3388 Constraint 33 169 18.9625 23.7032 35.5547 3.3388 Constraint 33 161 20.4474 25.5593 38.3389 3.3388 Constraint 33 144 15.9423 19.9279 29.8918 3.3388 Constraint 33 136 15.7635 19.7044 29.5565 3.3388 Constraint 33 128 15.4417 19.3022 28.9533 3.3388 Constraint 33 122 13.6116 17.0144 25.5217 3.3388 Constraint 33 113 11.4267 14.2834 21.4251 3.3388 Constraint 33 104 11.6713 14.5891 21.8837 3.3388 Constraint 88 706 18.9810 23.7262 35.5893 3.3315 Constraint 144 668 13.7118 17.1397 25.7096 3.2611 Constraint 96 676 15.6333 19.5416 29.3124 3.1920 Constraint 104 676 12.3897 15.4871 23.2307 3.1901 Constraint 467 687 17.2845 21.6056 32.4083 3.1687 Constraint 461 687 17.8763 22.3454 33.5180 3.1687 Constraint 449 687 17.4312 21.7890 32.6836 3.1668 Constraint 153 668 17.8231 22.2789 33.4184 3.0696 Constraint 297 735 17.8419 22.3024 33.4536 3.0562 Constraint 292 735 20.0402 25.0503 37.5755 3.0562 Constraint 272 735 19.1412 23.9265 35.8897 3.0562 Constraint 272 729 17.3611 21.7014 32.5520 3.0562 Constraint 267 735 21.7289 27.1611 40.7416 3.0562 Constraint 237 720 19.3817 24.2271 36.3406 3.0562 Constraint 226 720 19.1052 23.8815 35.8223 3.0562 Constraint 221 729 19.1004 23.8755 35.8133 3.0562 Constraint 210 729 18.7829 23.4786 35.2179 3.0562 Constraint 201 729 18.1050 22.6312 33.9468 3.0562 Constraint 201 720 16.9627 21.2034 31.8051 3.0562 Constraint 190 735 19.1568 23.9460 35.9189 3.0562 Constraint 190 729 17.3045 21.6306 32.4460 3.0562 Constraint 190 720 16.3710 20.4638 30.6957 3.0562 Constraint 182 735 17.8624 22.3280 33.4921 3.0562 Constraint 182 729 16.3604 20.4504 30.6757 3.0562 Constraint 176 735 17.7753 22.2191 33.3287 3.0562 Constraint 176 729 16.2703 20.3379 30.5069 3.0562 Constraint 176 720 15.1955 18.9944 28.4915 3.0562 Constraint 169 729 17.8933 22.3666 33.5500 3.0562 Constraint 169 720 16.4199 20.5249 30.7873 3.0562 Constraint 161 687 17.2153 21.5191 32.2787 3.0007 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 467 12.1656 15.2071 22.8106 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 153 13.6447 17.0559 25.5838 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 473 12.5906 15.7383 23.6075 3.0000 Constraint 41 467 14.1381 17.6726 26.5089 3.0000 Constraint 41 461 13.9501 17.4376 26.1565 3.0000 Constraint 41 449 15.2094 19.0117 28.5176 3.0000 Constraint 41 442 18.5271 23.1589 34.7384 3.0000 Constraint 41 435 18.5845 23.2307 34.8460 3.0000 Constraint 41 153 18.0692 22.5865 33.8798 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 489 13.0759 16.3449 24.5173 3.0000 Constraint 33 480 14.5110 18.1388 27.2081 3.0000 Constraint 33 473 15.0623 18.8278 28.2417 3.0000 Constraint 33 467 16.7675 20.9594 31.4390 3.0000 Constraint 33 461 15.5970 19.4962 29.2444 3.0000 Constraint 33 449 15.7955 19.7444 29.6166 3.0000 Constraint 33 442 19.0322 23.7902 35.6854 3.0000 Constraint 33 153 18.0451 22.5563 33.8345 3.0000 Constraint 144 706 17.3165 21.6456 32.4684 2.9983 Constraint 136 706 18.4274 23.0342 34.5513 2.9983 Constraint 122 706 18.4228 23.0284 34.5427 2.9983 Constraint 113 706 18.6555 23.3194 34.9790 2.9983 Constraint 391 713 19.4947 24.3683 36.5525 2.9827 Constraint 341 720 12.4049 15.5062 23.2593 2.9827 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 720 11.4433 14.3042 21.4563 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 322 713 11.3366 14.1708 21.2561 2.9827 Constraint 314 720 14.9429 18.6787 28.0180 2.9827 Constraint 314 713 12.6796 15.8496 23.7743 2.9827 Constraint 303 713 12.0239 15.0298 22.5447 2.9827 Constraint 297 713 10.9330 13.6663 20.4994 2.9827 Constraint 292 713 13.4471 16.8089 25.2134 2.9827 Constraint 285 713 14.5005 18.1257 27.1885 2.9827 Constraint 279 713 13.3615 16.7019 25.0529 2.9827 Constraint 272 713 14.3637 17.9546 26.9319 2.9827 Constraint 267 713 15.7684 19.7105 29.5658 2.9827 Constraint 259 713 16.2343 20.2928 30.4392 2.9827 Constraint 250 713 20.2745 25.3432 38.0148 2.9827 Constraint 497 676 13.0446 16.3057 24.4585 2.9759 Constraint 382 698 17.2321 21.5401 32.3102 2.9701 Constraint 375 698 16.4472 20.5590 30.8384 2.9701 Constraint 527 706 14.4638 18.0798 27.1197 2.9045 Constraint 519 706 15.4608 19.3260 28.9890 2.9045 Constraint 511 706 15.3138 19.1422 28.7133 2.9045 Constraint 161 668 14.0387 17.5484 26.3226 2.8587 Constraint 58 613 19.9344 24.9180 37.3770 2.8367 Constraint 58 590 18.4187 23.0234 34.5350 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 535 698 14.3767 17.9709 26.9563 2.7363 Constraint 557 729 15.3287 19.1608 28.7412 2.6629 Constraint 557 713 12.0803 15.1004 22.6505 2.6629 Constraint 429 720 20.2225 25.2781 37.9171 2.6514 Constraint 429 713 18.8610 23.5762 35.3643 2.6514 Constraint 421 720 18.0325 22.5407 33.8110 2.6514 Constraint 412 720 21.3233 26.6541 39.9811 2.6514 Constraint 322 735 18.4502 23.0627 34.5941 2.6514 Constraint 176 713 14.1365 17.6706 26.5059 2.6514 Constraint 467 698 16.7322 20.9152 31.3729 2.5729 Constraint 461 698 18.9952 23.7439 35.6159 2.5729 Constraint 497 706 14.3475 17.9343 26.9015 2.5710 Constraint 489 706 14.6281 18.2851 27.4276 2.5710 Constraint 449 698 18.0515 22.5644 33.8466 2.5710 Constraint 404 698 15.9691 19.9613 29.9420 2.5653 Constraint 368 698 15.9786 19.9732 29.9598 2.5653 Constraint 360 735 19.7485 24.6857 37.0285 2.5576 Constraint 355 735 17.1121 21.3902 32.0853 2.5576 Constraint 350 735 16.3599 20.4499 30.6748 2.5576 Constraint 341 735 15.7339 19.6673 29.5010 2.5576 Constraint 330 735 16.1108 20.1386 30.2078 2.5576 Constraint 303 735 19.3443 24.1803 36.2705 2.5576 Constraint 161 698 16.1708 20.2135 30.3202 2.4050 Constraint 153 676 18.1971 22.7463 34.1195 2.4050 Constraint 88 698 14.7352 18.4190 27.6285 2.4029 Constraint 285 735 21.9247 27.4059 41.1089 2.3894 Constraint 279 735 18.7561 23.4451 35.1676 2.3894 Constraint 544 706 13.4756 16.8445 25.2668 2.3315 Constraint 535 706 13.1382 16.4227 24.6341 2.3315 Constraint 435 713 20.8882 26.1103 39.1654 2.3315 Constraint 153 713 19.4387 24.2984 36.4475 2.3315 Constraint 144 713 18.7445 23.4307 35.1460 2.3315 Constraint 128 706 17.8933 22.3667 33.5500 2.3315 Constraint 104 706 18.0710 22.5888 33.8832 2.3315 Constraint 527 742 17.2899 21.6124 32.4185 2.2378 Constraint 527 735 15.0899 18.8623 28.2935 2.2378 Constraint 519 735 16.0967 20.1209 30.1813 2.2378 Constraint 511 735 14.3858 17.9823 26.9734 2.2378 Constraint 435 735 20.7238 25.9047 38.8571 2.2378 Constraint 421 742 19.3874 24.2343 36.3514 2.2378 Constraint 421 735 18.4984 23.1230 34.6845 2.2378 Constraint 412 735 19.4307 24.2884 36.4326 2.2378 Constraint 391 735 19.4896 24.3620 36.5430 2.2378 Constraint 80 676 15.7473 19.6841 29.5261 2.1914 Constraint 404 687 14.1103 17.6379 26.4569 2.1687 Constraint 527 729 16.1291 20.1613 30.2420 2.0696 Constraint 527 720 16.3682 20.4603 30.6904 2.0696 Constraint 519 729 16.2229 20.2786 30.4179 2.0696 Constraint 519 720 16.8095 21.0119 31.5178 2.0696 Constraint 242 729 19.0213 23.7766 35.6649 2.0696 Constraint 136 729 18.4813 23.1016 34.6524 2.0696 Constraint 136 720 17.8996 22.3745 33.5617 2.0696 Constraint 128 729 18.2344 22.7930 34.1894 2.0696 Constraint 128 720 17.7905 22.2382 33.3573 2.0696 Constraint 128 698 16.7497 20.9371 31.4057 2.0696 Constraint 122 720 18.4088 23.0110 34.5166 2.0696 Constraint 113 729 19.5106 24.3883 36.5824 2.0696 Constraint 113 720 18.5742 23.2177 34.8265 2.0696 Constraint 113 698 16.5138 20.6423 30.9634 2.0696 Constraint 104 729 18.3137 22.8921 34.3381 2.0696 Constraint 104 720 17.7646 22.2057 33.3086 2.0696 Constraint 88 729 20.0988 25.1235 37.6853 2.0696 Constraint 88 720 18.8160 23.5200 35.2801 2.0696 Constraint 69 629 18.8546 23.5683 35.3524 2.0163 Constraint 69 622 21.4832 26.8540 40.2810 2.0163 Constraint 69 613 20.7385 25.9231 38.8847 2.0163 Constraint 96 687 17.1420 21.4276 32.1413 2.0005 Constraint 161 706 15.5914 19.4892 29.2338 2.0002 Constraint 153 706 15.9324 19.9155 29.8733 2.0002 Constraint 128 687 15.0480 18.8100 28.2149 1.9986 Constraint 104 687 12.5599 15.6999 23.5498 1.9986 Constraint 480 706 12.2829 15.3536 23.0304 1.9981 Constraint 473 706 11.2505 14.0631 21.0947 1.9981 Constraint 404 720 22.1587 27.6984 41.5476 1.9846 Constraint 404 713 20.6923 25.8654 38.7981 1.9846 Constraint 399 720 18.5836 23.2295 34.8443 1.9846 Constraint 399 713 17.6119 22.0148 33.0223 1.9846 Constraint 391 720 19.4671 24.3338 36.5007 1.9846 Constraint 382 713 22.1702 27.7128 41.5691 1.9846 Constraint 375 720 20.7962 25.9952 38.9928 1.9846 Constraint 375 713 20.4598 25.5747 38.3621 1.9846 Constraint 368 720 19.4604 24.3255 36.4882 1.9846 Constraint 368 713 19.5790 24.4738 36.7107 1.9846 Constraint 360 729 20.4612 25.5766 38.3648 1.9846 Constraint 360 720 16.0899 20.1124 30.1686 1.9846 Constraint 360 713 16.2367 20.2959 30.4438 1.9846 Constraint 355 729 18.1495 22.6868 34.0303 1.9846 Constraint 355 720 13.9462 17.4327 26.1491 1.9846 Constraint 355 713 15.3147 19.1433 28.7150 1.9846 Constraint 350 720 12.5830 15.7287 23.5931 1.9846 Constraint 350 713 13.7189 17.1486 25.7229 1.9846 Constraint 314 735 20.6460 25.8075 38.7113 1.9846 Constraint 382 687 13.7243 17.1553 25.7330 1.9778 Constraint 161 742 14.8063 18.5079 27.7618 1.7383 Constraint 161 720 14.8924 18.6155 27.9232 1.7383 Constraint 153 742 17.0220 21.2776 31.9163 1.7383 Constraint 153 720 15.8423 19.8029 29.7044 1.7383 Constraint 144 742 18.6028 23.2535 34.8802 1.7383 Constraint 144 720 16.7758 20.9698 31.4547 1.7383 Constraint 571 742 15.4740 19.3425 29.0137 1.6648 Constraint 571 735 14.1857 17.7321 26.5982 1.6648 Constraint 557 742 16.8118 21.0148 31.5222 1.6648 Constraint 557 735 15.0714 18.8392 28.2588 1.6648 Constraint 552 742 18.2209 22.7761 34.1642 1.6648 Constraint 552 735 15.8943 19.8679 29.8018 1.6648 Constraint 552 729 17.2759 21.5948 32.3923 1.6648 Constraint 552 713 14.5985 18.2482 27.3723 1.6648 Constraint 544 742 15.4875 19.3594 29.0391 1.6648 Constraint 544 735 13.6270 17.0337 25.5506 1.6648 Constraint 544 729 15.0709 18.8386 28.2579 1.6648 Constraint 544 720 15.6405 19.5506 29.3258 1.6648 Constraint 544 713 13.2374 16.5468 24.8201 1.6648 Constraint 535 742 13.6170 17.0213 25.5319 1.6648 Constraint 535 735 12.1361 15.1701 22.7552 1.6648 Constraint 535 729 13.5030 16.8787 25.3181 1.6648 Constraint 535 720 14.3249 17.9061 26.8591 1.6648 Constraint 535 713 11.7108 14.6385 21.9577 1.6648 Constraint 527 713 12.7228 15.9035 23.8552 1.6648 Constraint 519 742 16.5002 20.6253 30.9379 1.6648 Constraint 519 713 13.4070 16.7588 25.1381 1.6648 Constraint 511 742 13.3306 16.6633 24.9950 1.6648 Constraint 511 729 12.9557 16.1946 24.2919 1.6648 Constraint 511 720 14.4537 18.0671 27.1007 1.6648 Constraint 511 713 11.9799 14.9749 22.4623 1.6648 Constraint 442 720 22.1328 27.6660 41.4991 1.6648 Constraint 442 713 18.8936 23.6170 35.4256 1.6648 Constraint 136 713 16.8177 21.0221 31.5332 1.6648 Constraint 128 713 17.0703 21.3379 32.0068 1.6648 Constraint 122 713 17.4956 21.8695 32.8043 1.6648 Constraint 113 713 16.9854 21.2317 31.8475 1.6648 Constraint 104 713 15.9860 19.9826 29.9738 1.6648 Constraint 80 687 16.8516 21.0645 31.5967 1.5957 Constraint 449 706 20.5023 25.6278 38.4418 1.5730 Constraint 375 687 10.1228 12.6535 18.9802 1.5730 Constraint 368 687 11.2921 14.1152 21.1727 1.5730 Constraint 80 698 21.6205 27.0257 40.5385 1.5730 Constraint 497 742 13.8696 17.3370 26.0055 1.5710 Constraint 497 735 10.8687 13.5858 20.3788 1.5710 Constraint 449 735 19.7178 24.6473 36.9709 1.5710 Constraint 442 742 19.5627 24.4534 36.6801 1.5710 Constraint 442 735 17.6100 22.0125 33.0187 1.5710 Constraint 96 698 18.2634 22.8292 34.2439 1.4048 Constraint 489 729 13.5449 16.9311 25.3966 1.4029 Constraint 489 720 14.5778 18.2222 27.3334 1.4029 Constraint 250 720 19.8562 24.8202 37.2303 1.4029 Constraint 104 698 12.6273 15.7841 23.6762 1.4029 Constraint 435 742 19.8064 24.7580 37.1370 1.2397 Constraint 429 742 20.6440 25.8050 38.7075 1.2397 Constraint 429 735 20.9999 26.2499 39.3749 1.2397 Constraint 412 742 17.7955 22.2444 33.3666 1.2397 Constraint 391 742 17.0003 21.2503 31.8755 1.2397 Constraint 314 742 21.3406 26.6757 40.0136 1.2397 Constraint 285 742 21.8279 27.2849 40.9274 1.2397 Constraint 297 742 20.4281 25.5351 38.3026 1.0715 Constraint 292 742 19.2663 24.0828 36.1242 1.0715 Constraint 279 742 21.7500 27.1875 40.7812 1.0715 Constraint 272 742 17.6029 22.0037 33.0055 1.0715 Constraint 267 742 20.4431 25.5539 38.3308 1.0715 Constraint 259 742 18.9793 23.7241 35.5862 1.0715 Constraint 259 735 20.0485 25.0607 37.5910 1.0715 Constraint 250 735 21.5759 26.9699 40.4548 1.0715 Constraint 250 729 20.0882 25.1103 37.6654 1.0715 Constraint 242 735 18.5189 23.1487 34.7230 1.0715 Constraint 237 742 14.4319 18.0399 27.0598 1.0715 Constraint 237 735 14.9357 18.6696 28.0044 1.0715 Constraint 237 729 12.8077 16.0096 24.0145 1.0715 Constraint 226 742 14.5545 18.1931 27.2897 1.0715 Constraint 226 735 15.3750 19.2187 28.8281 1.0715 Constraint 226 729 14.0097 17.5122 26.2682 1.0715 Constraint 221 742 17.2588 21.5735 32.3603 1.0715 Constraint 221 735 17.9924 22.4905 33.7357 1.0715 Constraint 210 742 15.9084 19.8855 29.8282 1.0715 Constraint 210 735 16.2407 20.3009 30.4513 1.0715 Constraint 201 742 11.9025 14.8781 22.3172 1.0715 Constraint 201 735 12.3761 15.4701 23.2051 1.0715 Constraint 190 742 13.7931 17.2414 25.8620 1.0715 Constraint 182 742 16.2008 20.2510 30.3766 1.0715 Constraint 176 742 11.9922 14.9902 22.4853 1.0715 Constraint 169 742 12.8056 16.0070 24.0105 1.0715 Constraint 169 735 13.0624 16.3280 24.4920 1.0715 Constraint 161 735 10.8157 13.5196 20.2794 1.0715 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 153 735 13.7215 17.1519 25.7278 1.0715 Constraint 153 729 11.8672 14.8340 22.2509 1.0715 Constraint 144 735 16.2503 20.3129 30.4693 1.0715 Constraint 144 729 14.6919 18.3649 27.5474 1.0715 Constraint 136 742 16.2963 20.3703 30.5555 1.0715 Constraint 136 735 15.8933 19.8667 29.8000 1.0715 Constraint 128 742 16.0096 20.0120 30.0180 1.0715 Constraint 128 735 15.9612 19.9515 29.9272 1.0715 Constraint 122 742 18.5484 23.1855 34.7782 1.0715 Constraint 122 735 18.3138 22.8922 34.3383 1.0715 Constraint 122 729 16.5569 20.6962 31.0442 1.0715 Constraint 104 742 20.0582 25.0728 37.6091 1.0715 Constraint 104 735 19.8374 24.7968 37.1951 1.0715 Constraint 96 729 19.4581 24.3227 36.4840 1.0715 Constraint 96 720 19.9939 24.9924 37.4886 1.0715 Constraint 51 577 20.0852 25.1065 37.6597 1.0163 Constraint 51 552 18.5010 23.1262 34.6894 1.0163 Constraint 51 535 21.6961 27.1202 40.6802 1.0163 Constraint 41 552 20.9694 26.2118 39.3176 1.0163 Constraint 41 267 15.5634 19.4542 29.1813 1.0163 Constraint 41 226 16.2514 20.3142 30.4713 1.0163 Constraint 41 201 18.0636 22.5794 33.8692 1.0163 Constraint 41 190 19.3603 24.2004 36.3006 1.0163 Constraint 41 176 20.2664 25.3330 37.9995 1.0163 Constraint 467 706 14.4293 18.0366 27.0550 1.0000 Constraint 461 706 17.8479 22.3099 33.4649 1.0000 Constraint 69 657 19.1182 23.8978 35.8467 1.0000 Constraint 69 651 21.3240 26.6550 39.9825 1.0000 Constraint 69 636 18.8883 23.6103 35.4155 1.0000 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 489 742 12.8183 16.0229 24.0343 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 480 742 12.9188 16.1485 24.2228 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 720 13.4710 16.8388 25.2581 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 449 742 20.3897 25.4871 38.2307 0.9981 Constraint 449 729 21.0943 26.3679 39.5518 0.9981 Constraint 449 713 19.3117 24.1396 36.2094 0.9981 Constraint 442 729 19.9787 24.9734 37.4601 0.9981 Constraint 88 713 12.7865 15.9832 23.9747 0.9981 Constraint 435 729 17.8718 22.3398 33.5097 0.6667 Constraint 435 720 19.2100 24.0125 36.0187 0.6667 Constraint 429 729 20.0972 25.1215 37.6822 0.6667 Constraint 412 729 18.4421 23.0527 34.5790 0.6667 Constraint 404 729 22.1358 27.6697 41.5046 0.6667 Constraint 391 729 21.0558 26.3197 39.4796 0.6667 Constraint 322 742 20.1990 25.2487 37.8731 0.6667 Constraint 250 742 19.5610 24.4512 36.6769 0.6667 Constraint 242 742 15.5200 19.4000 29.1000 0.6667 Constraint 161 713 12.5922 15.7403 23.6104 0.6667 Constraint 113 742 18.9346 23.6682 35.5023 0.6667 Constraint 113 735 17.9304 22.4130 33.6195 0.6667 Constraint 96 742 19.8478 24.8098 37.2146 0.6667 Constraint 96 735 19.8988 24.8735 37.3102 0.6667 Constraint 88 742 21.9282 27.4103 41.1154 0.6667 Constraint 88 735 21.3998 26.7498 40.1246 0.6667 Constraint 80 735 22.2717 27.8396 41.7594 0.6667 Constraint 80 720 22.2526 27.8158 41.7236 0.6667 Constraint 404 742 17.8745 22.3432 33.5147 0.5730 Constraint 404 735 18.7406 23.4257 35.1386 0.5730 Constraint 399 742 15.8754 19.8442 29.7664 0.5730 Constraint 399 735 16.9120 21.1400 31.7101 0.5730 Constraint 382 742 14.9153 18.6442 27.9663 0.5730 Constraint 382 735 16.1946 20.2433 30.3650 0.5730 Constraint 375 742 15.5064 19.3830 29.0745 0.5730 Constraint 375 735 17.3667 21.7084 32.5626 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 735 13.3124 16.6405 24.9608 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 341 742 12.2541 15.3177 22.9765 0.5730 Constraint 330 742 20.9318 26.1647 39.2471 0.5730 Constraint 303 742 19.7860 24.7325 37.0988 0.5730 Constraint 80 742 22.1981 27.7476 41.6214 0.5730 Constraint 33 585 22.0426 27.5532 41.3298 0.3388 Constraint 33 577 20.2907 25.3633 38.0450 0.3388 Constraint 33 571 22.3174 27.8967 41.8451 0.3388 Constraint 33 557 21.2512 26.5640 39.8460 0.3388 Constraint 33 552 17.5171 21.8964 32.8446 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 226 14.5041 18.1302 27.1952 0.3388 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: