parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 23.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint (T0311)F27.CB (T0311)R40.CB 7.5355 12.5591 16.3268 90.5403 Constraint (T0311)F27.CB (T0311)S39.CB 5.9239 9.8732 12.8351 90.5403 Constraint (T0311)F27.CB (T0311)A38.CB 3.3384 5.5640 7.2332 90.5403 Constraint (T0311)F27.CB (T0311)T37.CB 6.0956 10.1594 13.2072 90.5403 Constraint (T0311)L24.CB (T0311)R40.CB 6.3346 10.5576 13.7249 90.5403 Constraint (T0311)L24.CB (T0311)S39.CB 3.5866 5.9776 7.7709 90.5403 Constraint (T0311)L24.CB (T0311)A38.CB 3.0971 5.1618 6.7103 90.5403 Constraint (T0311)L24.CB (T0311)T37.CB 5.8761 9.7935 12.7316 90.5403 Constraint (T0311)L24.CB (T0311)I33.CB 5.9166 9.8609 12.8192 90.5403 Constraint (T0311)S23.CB (T0311)R40.CB 9.4810 15.8017 20.5423 90.5403 Constraint (T0311)S23.CB (T0311)S39.CB 6.6729 11.1216 14.4580 90.5403 Constraint (T0311)S23.CB (T0311)A38.CB 5.8233 9.7056 12.6172 90.5403 Constraint (T0311)S23.CB (T0311)T37.CB 8.6325 14.3876 18.7038 90.5403 Constraint (T0311)S23.CB (T0311)I33.CB 7.9022 13.1704 17.1215 90.5403 Constraint (T0311)M31.CB (T0311)R40.CB 7.6742 12.7903 16.6274 89.5947 Constraint (T0311)A30.CB (T0311)R40.CB 10.0230 16.7051 21.7166 87.8820 Constraint (T0311)A30.CB (T0311)S39.CB 8.9214 14.8690 19.3297 87.8820 Constraint (T0311)E26.CB (T0311)R40.CB 9.9842 16.6403 21.6324 87.8820 Constraint (T0311)E26.CB (T0311)S39.CB 7.7464 12.9106 16.7838 87.8820 Constraint (T0311)E26.CB (T0311)A38.CB 5.7776 9.6293 12.5181 87.8820 Constraint (T0311)E26.CB (T0311)T37.CB 8.3180 13.8633 18.0223 87.8820 Constraint (T0311)R25.CB (T0311)R40.CB 8.5335 14.2226 18.4893 87.8820 Constraint (T0311)R25.CB (T0311)S39.CB 6.0167 10.0278 13.0362 87.8820 Constraint (T0311)R25.CB (T0311)A38.CB 4.9868 8.3113 10.8047 87.8820 Constraint (T0311)R25.CB (T0311)T37.CB 6.9831 11.6386 15.1301 87.8820 Constraint (T0311)F27.CB (T0311)S36.CB 7.3486 12.2477 15.9220 87.7474 Constraint (T0311)L24.CB (T0311)S36.CB 5.5102 9.1836 11.9387 87.7474 Constraint (T0311)L24.CB (T0311)P35.CB 3.2458 5.4097 7.0326 87.7474 Constraint (T0311)L24.CB (T0311)A34.CB 5.9589 9.9315 12.9110 87.7474 Constraint (T0311)S23.CB (T0311)S36.CB 8.2715 13.7858 17.9216 87.7474 Constraint (T0311)S23.CB (T0311)P35.CB 5.3546 8.9243 11.6016 87.7474 Constraint (T0311)S23.CB (T0311)A34.CB 8.1963 13.6605 17.7586 87.7474 Constraint (T0311)S23.CB (T0311)E32.CB 9.4813 15.8022 20.5429 87.7035 Constraint (T0311)F27.CB (T0311)L41.CB 5.7969 9.6615 12.5600 87.6284 Constraint (T0311)L24.CB (T0311)L41.CB 5.9621 9.9369 12.9179 87.6284 Constraint (T0311)S23.CB (T0311)L41.CB 8.7466 14.5776 18.9509 87.6284 Constraint (T0311)A28.CB (T0311)R40.CB 6.5970 10.9951 14.2936 87.5403 Constraint (T0311)A28.CB (T0311)S39.CB 5.1937 8.6561 11.2530 87.5403 Constraint (T0311)A28.CB (T0311)A38.CB 2.8086 4.6810 6.0853 87.5403 Constraint (T0311)A28.CB (T0311)T37.CB 4.2218 7.0364 9.1473 87.5403 Constraint (T0311)M31.CB (T0311)L41.CB 5.8517 9.7528 12.6786 86.6829 Constraint (T0311)V22.CB (T0311)R40.CB 10.1243 16.8738 21.9360 85.6452 Constraint (T0311)V22.CB (T0311)S39.CB 7.9233 13.2056 17.1672 85.6452 Constraint (T0311)V22.CB (T0311)A38.CB 6.2243 10.3739 13.4861 85.6452 Constraint (T0311)V22.CB (T0311)T37.CB 9.2412 15.4020 20.0226 85.6452 Constraint (T0311)V22.CB (T0311)I33.CB 8.0820 13.4700 17.5110 85.6452 Constraint (T0311)I33.CB (T0311)L42.CB 7.0313 11.7188 15.2344 85.5352 Constraint (T0311)F27.CB (T0311)L42.CB 5.4605 9.1008 11.8311 85.5352 Constraint (T0311)L24.CB (T0311)L42.CB 4.4686 7.4476 9.6819 85.5352 Constraint (T0311)S23.CB (T0311)L42.CB 7.0470 11.7450 15.2685 85.5352 Constraint (T0311)E26.CB (T0311)S36.CB 8.7632 14.6054 18.9870 85.0891 Constraint (T0311)E26.CB (T0311)P35.CB 5.7320 9.5533 12.4193 85.0891 Constraint (T0311)R25.CB (T0311)S36.CB 6.3863 10.6439 13.8370 85.0891 Constraint (T0311)R25.CB (T0311)P35.CB 3.2009 5.3348 6.9352 85.0891 Constraint (T0311)R25.CB (T0311)A34.CB 5.8094 9.6823 12.5870 85.0891 Constraint (T0311)A30.CB (T0311)L41.CB 8.2183 13.6972 17.8063 84.9702 Constraint (T0311)E26.CB (T0311)L41.CB 8.7856 14.6427 19.0355 84.9702 Constraint (T0311)R25.CB (T0311)L41.CB 8.3952 13.9920 18.1896 84.9702 Constraint (T0311)R29.CB (T0311)R40.CB 9.7364 16.2274 21.0956 84.8820 Constraint (T0311)R29.CB (T0311)S39.CB 8.2087 13.6811 17.7854 84.8820 Constraint (T0311)R29.CB (T0311)A38.CB 5.7993 9.6655 12.5651 84.8820 Constraint (T0311)E32.CB (T0311)L41.CB 8.1369 13.5616 17.6300 84.7917 Constraint (T0311)V22.CB (T0311)M31.CB 6.7886 11.3143 14.7086 84.6996 Constraint (T0311)V22.CB (T0311)L41.CB 8.3464 13.9107 18.0839 84.6746 Constraint (T0311)A28.CB (T0311)L41.CB 6.0445 10.0741 13.0964 84.6284 Constraint (T0311)M31.CB (T0311)L42.CB 7.3737 12.2895 15.9763 84.5896 Constraint (T0311)I33.CB (T0311)K45.CB 8.4405 14.0675 18.2877 83.0212 Constraint (T0311)F27.CB (T0311)K45.CB 9.4053 15.6756 20.3782 83.0212 Constraint (T0311)L24.CB (T0311)K45.CB 8.3459 13.9099 18.0829 83.0212 Constraint (T0311)A30.CB (T0311)L42.CB 8.8115 14.6858 19.0915 82.8770 Constraint (T0311)E26.CB (T0311)L42.CB 7.9930 13.3216 17.3181 82.8770 Constraint (T0311)R25.CB (T0311)L42.CB 7.5760 12.6267 16.4147 82.8770 Constraint (T0311)V22.CB (T0311)S36.CB 9.8838 16.4731 21.4150 82.8523 Constraint (T0311)V22.CB (T0311)P35.CB 7.2732 12.1221 15.7587 82.8523 Constraint (T0311)V22.CB (T0311)A34.CB 9.4605 15.7674 20.4977 82.8523 Constraint (T0311)V22.CB (T0311)E32.CB 9.2263 15.3772 19.9904 82.8085 Constraint (T0311)I33.CB (T0311)T43.CB 8.5833 14.3054 18.5971 82.7317 Constraint (T0311)F27.CB (T0311)T43.CB 8.2262 13.7104 17.8235 82.7317 Constraint (T0311)L24.CB (T0311)T43.CB 6.4172 10.6954 13.9040 82.7317 Constraint (T0311)S23.CB (T0311)T43.CB 9.2818 15.4696 20.1105 82.7317 Constraint (T0311)E32.CB (T0311)L42.CB 9.9770 16.6284 21.6169 82.6985 Constraint (T0311)V22.CB (T0311)L42.CB 6.9438 11.5729 15.0448 82.5814 Constraint (T0311)A28.CB (T0311)L42.CB 6.4575 10.7626 13.9913 82.5352 Constraint (T0311)R40.CB (T0311)S57.CB 9.6703 16.1171 20.9522 82.3719 Constraint (T0311)R40.CB (T0311)L56.CB 7.2764 12.1274 15.7656 82.3719 Constraint (T0311)S39.CB (T0311)S57.CB 9.9919 16.6532 21.6492 82.3719 Constraint (T0311)S39.CB (T0311)L56.CB 7.4571 12.4285 16.1570 82.3719 Constraint (T0311)A38.CB (T0311)S57.CB 7.8664 13.1107 17.0439 82.3719 Constraint (T0311)A38.CB (T0311)L56.CB 5.1130 8.5217 11.0782 82.3719 Constraint (T0311)T37.CB (T0311)S57.CB 9.0968 15.1613 19.7096 82.3719 Constraint (T0311)T37.CB (T0311)L56.CB 6.3435 10.5724 13.7442 82.3719 Constraint (T0311)I33.CB (T0311)L56.CB 5.5962 9.3269 12.1250 82.3719 Constraint (T0311)F27.CB (T0311)S57.CB 7.0912 11.8187 15.3643 82.3719 Constraint (T0311)L24.CB (T0311)S57.CB 9.5482 15.9136 20.6877 82.3719 Constraint (T0311)L24.CB (T0311)L56.CB 7.1180 11.8633 15.4223 82.3719 Constraint (T0311)M31.CB (T0311)K45.CB 9.6946 16.1577 21.0050 82.0756 Constraint (T0311)I33.CB (T0311)S57.CB 8.2588 13.7647 17.8941 82.0719 Constraint (T0311)R29.CB (T0311)L41.CB 8.8783 14.7971 19.2362 81.9702 Constraint (T0311)M31.CB (T0311)T43.CB 9.6575 16.0959 20.9246 81.7861 Constraint (T0311)S23.CB (T0311)S57.CB 10.6894 17.8156 23.1603 81.3738 Constraint (T0311)F27.CB (T0311)L56.CB 4.7765 7.9608 10.3491 81.3555 Constraint (T0311)R40.CB (T0311)I54.CB 9.8069 16.3449 21.2483 81.2632 Constraint (T0311)S39.CB (T0311)I54.CB 10.8531 18.0885 23.5151 81.2632 Constraint (T0311)A38.CB (T0311)I54.CB 8.5635 14.2726 18.5543 81.2632 Constraint (T0311)T37.CB (T0311)I54.CB 8.6905 14.4842 18.8295 81.2632 Constraint (T0311)I33.CB (T0311)I54.CB 7.7777 12.9628 16.8517 81.2632 Constraint (T0311)F27.CB (T0311)I54.CB 8.4362 14.0603 18.2784 81.2632 Constraint (T0311)L24.CB (T0311)I54.CB 10.8635 18.1058 23.5375 81.2632 Constraint (T0311)M31.CB (T0311)S57.CB 6.4629 10.7716 14.0030 81.1263 Constraint (T0311)A38.CB (T0311)A47.CB 8.4203 14.0339 18.2441 80.7947 Constraint (T0311)T37.CB (T0311)A47.CB 7.3190 12.1983 15.8578 80.7947 Constraint (T0311)I33.CB (T0311)A47.CB 9.0635 15.1058 19.6375 80.7947 Constraint (T0311)R40.CB (T0311)V58.CB 11.0739 18.4565 23.9934 80.3872 Constraint (T0311)S39.CB (T0311)V58.CB 11.1568 18.5947 24.1732 80.3872 Constraint (T0311)A38.CB (T0311)V58.CB 8.6350 14.3917 18.7093 80.3872 Constraint (T0311)T37.CB (T0311)V58.CB 9.6892 16.1487 20.9933 80.3872 Constraint (T0311)M31.CB (T0311)I54.CB 6.3471 10.5785 13.7520 80.3177 Constraint (T0311)R40.CB (T0311)K55.CB 8.7657 14.6094 18.9923 80.2786 Constraint (T0311)S39.CB (T0311)K55.CB 9.3330 15.5550 20.2215 80.2786 Constraint (T0311)A38.CB (T0311)K55.CB 6.7266 11.2109 14.5742 80.2786 Constraint (T0311)T37.CB (T0311)K55.CB 6.9205 11.5342 14.9945 80.2786 Constraint (T0311)I33.CB (T0311)K55.CB 5.4265 9.0441 11.7573 80.2786 Constraint (T0311)L24.CB (T0311)K55.CB 8.9327 14.8878 19.3542 80.2786 Constraint (T0311)S36.CB (T0311)K45.CB 6.6768 11.1280 14.4664 80.2283 Constraint (T0311)A34.CB (T0311)K45.CB 8.3915 13.9858 18.1816 80.2283 Constraint (T0311)A30.CB (T0311)T43.CB 11.4743 19.1239 24.8611 80.0735 Constraint (T0311)E26.CB (T0311)T43.CB 10.5661 17.6101 22.8932 80.0735 Constraint (T0311)R25.CB (T0311)T43.CB 9.3987 15.6646 20.3640 80.0735 Constraint (T0311)T37.CB (T0311)A46.CB 5.5796 9.2994 12.0892 80.0270 Constraint (T0311)I33.CB (T0311)A46.CB 7.6580 12.7633 16.5922 80.0270 Constraint (T0311)A34.CB (T0311)T43.CB 8.3729 13.9549 18.1413 79.9388 Constraint (T0311)E32.CB (T0311)T43.CB 11.8080 19.6800 25.5840 79.8950 Constraint (T0311)R40.CB (T0311)A53.CB 7.6145 12.6909 16.4981 79.8809 Constraint (T0311)S39.CB (T0311)A53.CB 9.0190 15.0317 19.5412 79.8809 Constraint (T0311)A38.CB (T0311)A53.CB 7.1469 11.9115 15.4850 79.8809 Constraint (T0311)T37.CB (T0311)A53.CB 7.2373 12.0622 15.6809 79.8809 Constraint (T0311)I33.CB (T0311)A53.CB 7.1526 11.9210 15.4973 79.8809 Constraint (T0311)F27.CB (T0311)A53.CB 7.8142 13.0236 16.9307 79.8809 Constraint (T0311)L24.CB (T0311)A53.CB 9.6278 16.0464 20.8603 79.8809 Constraint (T0311)R29.CB (T0311)L42.CB 9.2010 15.3350 19.9355 79.8770 Constraint (T0311)V22.CB (T0311)T43.CB 9.8071 16.3452 21.2488 79.7779 Constraint (T0311)A28.CB (T0311)T43.CB 8.3536 13.9227 18.0995 79.7317 Constraint (T0311)S36.CB (T0311)L56.CB 8.8467 14.7445 19.1679 79.5790 Constraint (T0311)P35.CB (T0311)S57.CB 10.8745 18.1241 23.5613 79.5790 Constraint (T0311)P35.CB (T0311)L56.CB 8.1304 13.5506 17.6158 79.5790 Constraint (T0311)A34.CB (T0311)L56.CB 8.1451 13.5751 17.6476 79.5790 Constraint (T0311)L41.CB (T0311)S57.CB 6.8240 11.3733 14.7853 79.4600 Constraint (T0311)L41.CB (T0311)L56.CB 4.6873 7.8121 10.1557 79.4600 Constraint (T0311)V22.CB (T0311)S57.CB 8.4776 14.1293 18.3680 79.4460 Constraint (T0311)L24.CB (T0311)V58.CB 10.1179 16.8632 21.9221 79.3892 Constraint (T0311)A34.CB (T0311)S57.CB 10.9095 18.1825 23.6373 79.2790 Constraint (T0311)M31.CB (T0311)A46.CB 8.8161 14.6934 19.1014 79.0814 Constraint (T0311)A28.CB (T0311)S57.CB 8.9267 14.8778 19.3411 79.0719 Constraint (T0311)R40.CB (T0311)V59.CB 9.7567 16.2611 21.1394 79.0538 Constraint (T0311)M31.CB (T0311)A53.CB 6.3764 10.6273 13.8155 78.9353 Constraint (T0311)N21.CB (T0311)L41.CB 11.2761 18.7935 24.4315 78.9048 Constraint (T0311)N21.CB (T0311)R40.CB 12.9362 21.5604 28.0285 78.9048 Constraint (T0311)N21.CB (T0311)S39.CB 10.4790 17.4651 22.7046 78.9048 Constraint (T0311)N21.CB (T0311)A38.CB 9.2852 15.4753 20.1179 78.9048 Constraint (T0311)N21.CB (T0311)T37.CB 12.3411 20.5685 26.7391 78.9048 Constraint (T0311)N21.CB (T0311)S36.CB 12.6515 21.0858 27.4115 78.9048 Constraint (T0311)N21.CB (T0311)P35.CB 9.9204 16.5340 21.4943 78.9048 Constraint (T0311)N21.CB (T0311)A34.CB 12.4129 20.6882 26.8947 78.9048 Constraint (T0311)N21.CB (T0311)I33.CB 11.2276 18.7127 24.3265 78.9048 Constraint (T0311)T37.CB (T0311)V59.CB 8.2716 13.7860 17.9218 78.7538 Constraint (T0311)S23.CB (T0311)K45.CB 11.1961 18.6602 24.2582 78.7314 Constraint (T0311)M31.CB (T0311)L56.CB 3.8724 6.4540 8.3902 78.6910 Constraint (T0311)F27.CB (T0311)V58.CB 7.1033 11.8388 15.3904 78.6683 Constraint (T0311)A30.CB (T0311)K45.CB 11.9907 19.9845 25.9798 78.6441 Constraint (T0311)R25.CB (T0311)K45.CB 10.8667 18.1111 23.5445 78.6441 Constraint (T0311)S23.CB (T0311)L56.CB 8.4205 14.0341 18.2443 78.6385 Constraint (T0311)F27.CB (T0311)K55.CB 6.2396 10.3993 13.5190 78.5597 Constraint (T0311)P35.CB (T0311)K45.CB 8.4411 14.0685 18.2890 78.5094 Constraint (T0311)S36.CB (T0311)I54.CB 11.5768 19.2947 25.0831 78.4704 Constraint (T0311)P35.CB (T0311)I54.CB 11.3370 18.8950 24.5635 78.4704 Constraint (T0311)A34.CB (T0311)I54.CB 10.4541 17.4234 22.6505 78.4704 Constraint (T0311)E32.CB (T0311)K45.CB 11.3722 18.9537 24.6398 78.4656 Constraint (T0311)S23.CB (T0311)A53.CB 11.6374 19.3956 25.2143 78.4597 Constraint (T0311)R25.CB (T0311)S57.CB 11.0643 18.4406 23.9728 78.4156 Constraint (T0311)I33.CB (T0311)V58.CB 8.0151 13.3585 17.3660 78.3683 Constraint (T0311)L42.CB (T0311)I54.CB 9.4699 15.7832 20.5182 78.3514 Constraint (T0311)L41.CB (T0311)I54.CB 7.4405 12.4009 16.1212 78.3514 Constraint (T0311)F27.CB (T0311)A46.CB 9.1328 15.2213 19.7876 78.3081 Constraint (T0311)L24.CB (T0311)A46.CB 8.7592 14.5987 18.9783 78.3081 Constraint (T0311)A28.CB (T0311)K45.CB 9.0167 15.0278 19.5361 78.3023 Constraint (T0311)S23.CB (T0311)I54.CB 12.3460 20.5766 26.7496 78.2633 Constraint (T0311)A28.CB (T0311)I54.CB 9.3107 15.5179 20.1732 78.2633 Constraint (T0311)F27.CB (T0311)A47.CB 10.6045 17.6742 22.9765 78.0595 Constraint (T0311)L24.CB (T0311)A47.CB 10.6574 17.7623 23.0910 78.0595 Constraint (T0311)S39.CB (T0311)V59.CB 9.1364 15.2273 19.7955 78.0557 Constraint (T0311)S36.CB (T0311)A47.CB 9.1040 15.1734 19.7254 78.0018 Constraint (T0311)N21.CB (T0311)M31.CB 9.8565 16.4276 21.3558 77.9592 Constraint (T0311)S36.CB (T0311)S57.CB 11.5578 19.2630 25.0419 77.5788 Constraint (T0311)S36.CB (T0311)K55.CB 9.6636 16.1060 20.9378 77.4858 Constraint (T0311)L41.CB (T0311)V58.CB 8.5810 14.3017 18.5921 77.4754 Constraint (T0311)S23.CB (T0311)V58.CB 10.6829 17.8049 23.1464 77.3703 Constraint (T0311)L42.CB (T0311)S57.CB 7.9714 13.2857 17.2715 77.3668 Constraint (T0311)L42.CB (T0311)L56.CB 6.0537 10.0895 13.1163 77.3668 Constraint (T0311)L42.CB (T0311)K55.CB 8.6131 14.3552 18.6618 77.3668 Constraint (T0311)L41.CB (T0311)K55.CB 6.7199 11.1999 14.5598 77.3668 Constraint (T0311)V22.CB (T0311)I54.CB 10.5741 17.6235 22.9106 77.3528 Constraint (T0311)A38.CB (T0311)V59.CB 6.4891 10.8152 14.0598 77.3349 Constraint (T0311)S36.CB (T0311)A46.CB 7.0337 11.7228 15.2396 77.2341 Constraint (T0311)A34.CB (T0311)A46.CB 8.0345 13.3908 17.4080 77.2341 Constraint (T0311)R25.CB (T0311)A53.CB 11.4659 19.1099 24.8429 77.2226 Constraint (T0311)E32.CB (T0311)A46.CB 10.4424 17.4040 22.6252 77.1902 Constraint (T0311)M31.CB (T0311)A47.CB 9.7276 16.2126 21.0764 77.1139 Constraint (T0311)S36.CB (T0311)A53.CB 10.1055 16.8426 21.8954 77.0880 Constraint (T0311)P35.CB (T0311)A53.CB 10.2914 17.1524 22.2981 77.0880 Constraint (T0311)A34.CB (T0311)A53.CB 9.5471 15.9119 20.6854 77.0880 Constraint (T0311)R29.CB (T0311)T43.CB 11.4096 19.0160 24.7208 77.0735 Constraint (T0311)E32.CB (T0311)A53.CB 8.3824 13.9706 18.1618 77.0441 Constraint (T0311)A30.CB (T0311)L56.CB 5.7170 9.5284 12.3869 76.9784 Constraint (T0311)T43.CB (T0311)A53.CB 8.8707 14.7845 19.2198 76.9691 Constraint (T0311)L42.CB (T0311)A53.CB 7.3615 12.2692 15.9500 76.9691 Constraint (T0311)L41.CB (T0311)A53.CB 5.1028 8.5047 11.0561 76.9691 Constraint (T0311)E26.CB (T0311)I54.CB 10.8963 18.1604 23.6086 76.8861 Constraint (T0311)A28.CB (T0311)A53.CB 8.6645 14.4409 18.7732 76.8809 Constraint (T0311)K45.CB (T0311)I54.CB 10.8879 18.1465 23.5905 76.8538 Constraint (T0311)N21.CB (T0311)L42.CB 9.4302 15.7170 20.4321 76.8116 Constraint (T0311)A30.CB (T0311)S57.CB 7.3892 12.3154 16.0100 76.6784 Constraint (T0311)A28.CB (T0311)L56.CB 5.9954 9.9923 12.9900 76.6366 Constraint (T0311)M31.CB (T0311)K55.CB 3.4109 5.6848 7.3902 76.5978 Constraint (T0311)A30.CB (T0311)I54.CB 8.0206 13.3677 17.3781 76.5861 Constraint (T0311)T43.CB (T0311)I54.CB 11.5043 19.1738 24.9259 76.5642 Constraint (T0311)S23.CB (T0311)K55.CB 10.0824 16.8039 21.8451 76.5453 Constraint (T0311)L17.CB (T0311)R40.CB 8.6996 14.4993 18.8491 76.5309 Constraint (T0311)L17.CB (T0311)S39.CB 6.9029 11.5049 14.9564 76.5309 Constraint (T0311)L17.CB (T0311)A38.CB 5.5036 9.1726 11.9244 76.5309 Constraint (T0311)L17.CB (T0311)T37.CB 8.5299 14.2164 18.4813 76.5309 Constraint (T0311)L17.CB (T0311)S36.CB 9.4509 15.7515 20.4769 76.5309 Constraint (T0311)L17.CB (T0311)P35.CB 7.5480 12.5799 16.3539 76.5309 Constraint (T0311)L17.CB (T0311)A34.CB 9.5065 15.8442 20.5975 76.5309 Constraint (T0311)L17.CB (T0311)I33.CB 7.9943 13.3239 17.3210 76.5309 Constraint (T0311)L17.CB (T0311)F27.CB 3.6828 6.1379 7.9793 76.5309 Constraint (T0311)Q14.CB (T0311)R40.CB 7.8217 13.0361 16.9469 76.5309 Constraint (T0311)Q14.CB (T0311)S39.CB 6.5774 10.9623 14.2510 76.5309 Constraint (T0311)Q14.CB (T0311)A38.CB 6.2870 10.4783 13.6218 76.5309 Constraint (T0311)Q14.CB (T0311)T37.CB 8.8204 14.7007 19.1109 76.5309 Constraint (T0311)Q14.CB (T0311)S36.CB 9.6175 16.0292 20.8379 76.5309 Constraint (T0311)Q14.CB (T0311)P35.CB 8.6703 14.4505 18.7857 76.5309 Constraint (T0311)Q14.CB (T0311)A34.CB 10.4013 17.3354 22.5361 76.5309 Constraint (T0311)Q14.CB (T0311)I33.CB 9.2028 15.3380 19.9393 76.5309 Constraint (T0311)Q14.CB (T0311)F27.CB 6.1082 10.1803 13.2344 76.5309 Constraint (T0311)Q14.CB (T0311)L24.CB 5.9604 9.9341 12.9143 76.5309 Constraint (T0311)Q14.CB (T0311)S23.CB 7.1633 11.9389 15.5205 76.5309 Constraint (T0311)E32.CB (T0311)S57.CB 8.7039 14.5065 18.8584 76.4999 Constraint (T0311)E32.CB (T0311)L56.CB 6.6316 11.0526 14.3684 76.4999 Constraint (T0311)P35.CB (T0311)K55.CB 8.9757 14.9595 19.4473 76.4877 Constraint (T0311)A34.CB (T0311)K55.CB 8.0997 13.4995 17.5493 76.4877 Constraint (T0311)E32.CB (T0311)I54.CB 7.6453 12.7422 16.5649 76.4076 Constraint (T0311)M31.CB (T0311)V58.CB 5.5863 9.3104 12.1036 76.4064 Constraint (T0311)L24.CB (T0311)V59.CB 7.4501 12.4168 16.1419 76.3368 Constraint (T0311)P35.CB (T0311)V58.CB 10.9652 18.2753 23.7580 76.2963 Constraint (T0311)A34.CB (T0311)V58.CB 10.8157 18.0262 23.4340 76.2963 Constraint (T0311)A34.CB (T0311)A47.CB 9.7171 16.1951 21.0537 76.2829 Constraint (T0311)N21.CB (T0311)A30.CB 8.0744 13.4574 17.4946 76.2466 Constraint (T0311)L41.CB (T0311)V59.CB 7.4913 12.4854 16.2311 76.1419 Constraint (T0311)E26.CB (T0311)K45.CB 11.9091 19.8484 25.8030 76.0731 Constraint (T0311)E26.CB (T0311)L56.CB 7.3492 12.2487 15.9234 75.9803 Constraint (T0311)R25.CB (T0311)L56.CB 8.3908 13.9846 18.1800 75.9803 Constraint (T0311)V22.CB (T0311)A53.CB 10.1415 16.9026 21.9733 75.9705 Constraint (T0311)K45.CB (T0311)S57.CB 10.7441 17.9068 23.2789 75.8691 Constraint (T0311)K45.CB (T0311)L56.CB 8.6173 14.3622 18.6709 75.8691 Constraint (T0311)K45.CB (T0311)K55.CB 10.3537 17.2561 22.4330 75.8691 Constraint (T0311)V22.CB (T0311)L56.CB 6.7409 11.2348 14.6052 75.7127 Constraint (T0311)E26.CB (T0311)S57.CB 9.3697 15.6162 20.3011 75.6803 Constraint (T0311)R25.CB (T0311)A46.CB 11.1529 18.5882 24.1647 75.6498 Constraint (T0311)R29.CB (T0311)K45.CB 12.1103 20.1838 26.2390 75.6441 Constraint (T0311)R25.CB (T0311)I54.CB 12.0163 20.0272 26.0354 75.6050 Constraint (T0311)L17.CB (T0311)M31.CB 6.8767 11.4612 14.8996 75.5853 Constraint (T0311)Q14.CB (T0311)M31.CB 8.6236 14.3726 18.6844 75.5853 Constraint (T0311)T43.CB (T0311)S57.CB 10.4470 17.4117 22.6353 75.5796 Constraint (T0311)T43.CB (T0311)L56.CB 8.4076 14.0127 18.2165 75.5796 Constraint (T0311)T43.CB (T0311)K55.CB 10.7269 17.8781 23.2416 75.5796 Constraint (T0311)D18.CB (T0311)R40.CB 10.8359 18.0599 23.4778 75.5603 Constraint (T0311)D18.CB (T0311)S39.CB 8.8294 14.7157 19.1305 75.5603 Constraint (T0311)D18.CB (T0311)A38.CB 8.1424 13.5706 17.6418 75.5603 Constraint (T0311)D18.CB (T0311)T37.CB 11.1586 18.5977 24.1770 75.5603 Constraint (T0311)D18.CB (T0311)P35.CB 9.7694 16.2824 21.1671 75.5603 Constraint (T0311)D18.CB (T0311)A34.CB 12.0678 20.1130 26.1468 75.5603 Constraint (T0311)D18.CB (T0311)I33.CB 10.8134 18.0223 23.4290 75.5603 Constraint (T0311)D18.CB (T0311)F27.CB 6.4583 10.7639 13.9931 75.5603 Constraint (T0311)A28.CB (T0311)K55.CB 6.6832 11.1387 14.4803 75.5597 Constraint (T0311)P35.CB (T0311)A46.CB 8.6625 14.4375 18.7687 75.5152 Constraint (T0311)L42.CB (T0311)V58.CB 9.8605 16.4341 21.3644 75.3822 Constraint (T0311)F27.CB (T0311)V59.CB 4.1516 6.9194 8.9952 75.3205 Constraint (T0311)A28.CB (T0311)A46.CB 8.8263 14.7104 19.1236 75.3081 Constraint (T0311)P35.CB (T0311)A47.CB 10.6822 17.8036 23.1447 75.2666 Constraint (T0311)M31.CB (T0311)V59.CB 3.9539 6.5899 8.5669 75.0730 Constraint (T0311)A28.CB (T0311)A47.CB 10.4394 17.3990 22.6187 75.0595 Constraint (T0311)I33.CB (T0311)V59.CB 6.2045 10.3409 13.4431 75.0205 Constraint (T0311)S23.CB (T0311)V59.CB 7.6984 12.8307 16.6799 75.0205 Constraint (T0311)A46.CB (T0311)S57.CB 9.4979 15.8298 20.5787 74.8711 Constraint (T0311)A46.CB (T0311)L56.CB 7.5258 12.5429 16.3058 74.8711 Constraint (T0311)A46.CB (T0311)K55.CB 8.9326 14.8876 19.3539 74.8711 Constraint (T0311)R25.CB (T0311)V58.CB 10.7019 17.8365 23.1875 74.7120 Constraint (T0311)A47.CB (T0311)S57.CB 9.4222 15.7036 20.4147 74.6225 Constraint (T0311)A47.CB (T0311)L56.CB 7.9036 13.1727 17.1245 74.6225 Constraint (T0311)D18.CB (T0311)M31.CB 9.7109 16.1848 21.0402 74.6147 Constraint (T0311)R25.CB (T0311)K55.CB 9.4103 15.6839 20.3891 74.6034 Constraint (T0311)S36.CB (T0311)V58.CB 12.0548 20.0913 26.1187 74.5961 Constraint (T0311)A30.CB (T0311)A53.CB 8.5145 14.1909 18.4481 74.4874 Constraint (T0311)E26.CB (T0311)A53.CB 10.6614 17.7691 23.0998 74.4874 Constraint (T0311)A28.CB (T0311)V58.CB 8.5569 14.2615 18.5400 74.3703 Constraint (T0311)L42.CB (T0311)V59.CB 8.1542 13.5903 17.6674 74.0487 Constraint (T0311)A30.CB (T0311)K55.CB 5.2389 8.7314 11.3509 73.8871 Constraint (T0311)E26.CB (T0311)K55.CB 8.3146 13.8577 18.0151 73.8871 Constraint (T0311)L17.CB (T0311)A30.CB 6.6513 11.0854 14.4111 73.8727 Constraint (T0311)L17.CB (T0311)E26.CB 5.2971 8.8286 11.4772 73.8727 Constraint (T0311)S16.CB (T0311)R40.CB 10.2075 17.0124 22.1162 73.8727 Constraint (T0311)S16.CB (T0311)S39.CB 9.0805 15.1341 19.6744 73.8727 Constraint (T0311)S16.CB (T0311)A38.CB 7.3453 12.2422 15.9149 73.8727 Constraint (T0311)S16.CB (T0311)T37.CB 9.9939 16.6566 21.6535 73.8727 Constraint (T0311)S16.CB (T0311)S36.CB 11.5234 19.2057 24.9675 73.8727 Constraint (T0311)S16.CB (T0311)P35.CB 9.8777 16.4628 21.4016 73.8727 Constraint (T0311)S16.CB (T0311)I33.CB 9.2462 15.4103 20.0334 73.8727 Constraint (T0311)S16.CB (T0311)A30.CB 7.3239 12.2065 15.8684 73.8727 Constraint (T0311)S16.CB (T0311)F27.CB 5.4156 9.0260 11.7338 73.8727 Constraint (T0311)S16.CB (T0311)E26.CB 7.1979 11.9965 15.5955 73.8727 Constraint (T0311)S16.CB (T0311)R25.CB 9.1494 15.2490 19.8237 73.8727 Constraint (T0311)E15.CB (T0311)R40.CB 10.5306 17.5510 22.8163 73.8727 Constraint (T0311)E15.CB (T0311)S39.CB 9.4238 15.7064 20.4183 73.8727 Constraint (T0311)E15.CB (T0311)A38.CB 8.5627 14.2712 18.5526 73.8727 Constraint (T0311)E15.CB (T0311)T37.CB 11.1593 18.5989 24.1785 73.8727 Constraint (T0311)E15.CB (T0311)S36.CB 12.3161 20.5269 26.6850 73.8727 Constraint (T0311)E15.CB (T0311)P35.CB 11.0416 18.4027 23.9234 73.8727 Constraint (T0311)E15.CB (T0311)I33.CB 11.0201 18.3668 23.8768 73.8727 Constraint (T0311)E15.CB (T0311)A30.CB 9.8178 16.3630 21.2719 73.8727 Constraint (T0311)E15.CB (T0311)F27.CB 7.3814 12.3023 15.9930 73.8727 Constraint (T0311)E15.CB (T0311)E26.CB 9.1161 15.1936 19.7516 73.8727 Constraint (T0311)E15.CB (T0311)R25.CB 10.5700 17.6166 22.9016 73.8727 Constraint (T0311)E15.CB (T0311)L24.CB 8.2393 13.7322 17.8519 73.8727 Constraint (T0311)Q14.CB (T0311)A30.CB 9.2349 15.3916 20.0090 73.8727 Constraint (T0311)Q14.CB (T0311)E26.CB 8.1616 13.6027 17.6836 73.8727 Constraint (T0311)Q14.CB (T0311)R25.CB 8.7614 14.6023 18.9830 73.8727 Constraint (T0311)V22.CB (T0311)K45.CB 11.4543 19.0906 24.8177 73.8363 Constraint (T0311)A30.CB (T0311)V58.CB 5.8863 9.8105 12.7536 73.6957 Constraint (T0311)E26.CB (T0311)V58.CB 8.7281 14.5468 18.9108 73.6957 Constraint (T0311)L17.CB (T0311)E32.CB 9.7581 16.2634 21.1425 73.6941 Constraint (T0311)V22.CB (T0311)K55.CB 8.5421 14.2368 18.5079 73.6195 Constraint (T0311)D18.CB (T0311)L41.CB 8.9704 14.9507 19.4360 73.6191 Constraint (T0311)L17.CB (T0311)L41.CB 6.6050 11.0083 14.3107 73.6191 Constraint (T0311)Q14.CB (T0311)L41.CB 5.9017 9.8361 12.7870 73.6191 Constraint (T0311)R29.CB (T0311)I54.CB 10.2168 17.0280 22.1364 73.5861 Constraint (T0311)L17.CB (T0311)A28.CB 6.4594 10.7656 13.9953 73.5309 Constraint (T0311)Q14.CB (T0311)A28.CB 8.2070 13.6784 17.7819 73.5309 Constraint (T0311)D18.CB (T0311)S36.CB 11.6173 19.3621 25.1707 73.4671 Constraint (T0311)V22.CB (T0311)V58.CB 8.2477 13.7462 17.8701 73.4281 Constraint (T0311)E32.CB (T0311)K55.CB 4.6666 7.7777 10.1110 73.4086 Constraint (T0311)S36.CB (T0311)V59.CB 10.1835 16.9725 22.0643 73.2439 Constraint (T0311)P35.CB (T0311)V59.CB 8.5016 14.1693 18.4201 73.2439 Constraint (T0311)A34.CB (T0311)V59.CB 8.9439 14.9065 19.3784 73.2439 Constraint (T0311)S16.CB (T0311)M31.CB 7.5262 12.5437 16.3068 72.9271 Constraint (T0311)E15.CB (T0311)M31.CB 9.7336 16.2226 21.0894 72.9271 Constraint (T0311)D18.CB (T0311)A30.CB 9.0937 15.1562 19.7031 72.9020 Constraint (T0311)A46.CB (T0311)V58.CB 11.3194 18.8657 24.5255 72.8864 Constraint (T0311)R29.CB (T0311)S57.CB 9.7466 16.2443 21.1176 72.6803 Constraint (T0311)R29.CB (T0311)L56.CB 7.4096 12.3493 16.0541 72.6803 Constraint (T0311)A30.CB (T0311)A46.CB 11.2255 18.7091 24.3219 72.6499 Constraint (T0311)A47.CB (T0311)V58.CB 11.4862 19.1436 24.8867 72.6378 Constraint (T0311)D18.CB (T0311)A28.CB 9.0922 15.1536 19.6997 72.5603 Constraint (T0311)V22.CB (T0311)V59.CB 5.5143 9.1905 11.9477 72.3946 Constraint (T0311)A30.CB (T0311)V59.CB 3.5590 5.9316 7.7111 72.3622 Constraint (T0311)E26.CB (T0311)V59.CB 5.8159 9.6931 12.6010 72.3622 Constraint (T0311)R25.CB (T0311)V59.CB 7.8264 13.0441 16.9573 72.3622 Constraint (T0311)Q14.CB (T0311)K45.CB 8.0747 13.4578 17.4951 72.3505 Constraint (T0311)T43.CB (T0311)V59.CB 10.8040 18.0066 23.4086 72.2616 Constraint (T0311)E32.CB (T0311)A47.CB 11.1003 18.5005 24.0507 72.2341 Constraint (T0311)E32.CB (T0311)V59.CB 6.1913 10.3188 13.4144 72.1837 Constraint (T0311)A28.CB (T0311)V59.CB 6.0329 10.0548 13.0712 72.0205 Constraint (T0311)K45.CB (T0311)V59.CB 11.4591 19.0986 24.8282 71.8843 Constraint (T0311)E32.CB (T0311)V58.CB 7.0758 11.7930 15.3309 71.7300 Constraint (T0311)T43.CB (T0311)V58.CB 12.4032 20.6719 26.8735 71.5948 Constraint (T0311)A46.CB (T0311)V59.CB 10.5081 17.5136 22.7676 71.5530 Constraint (T0311)D18.CB (T0311)L42.CB 6.6855 11.1425 14.4852 71.5258 Constraint (T0311)L17.CB (T0311)L42.CB 4.9221 8.2035 10.6645 71.5258 Constraint (T0311)Q14.CB (T0311)L42.CB 3.7389 6.2314 8.1009 71.5258 Constraint (T0311)R29.CB (T0311)A53.CB 10.3403 17.2339 22.4041 71.4874 Constraint (T0311)I13.CB (T0311)R40.CB 6.9082 11.5137 14.9677 71.4434 Constraint (T0311)I13.CB (T0311)S39.CB 6.4505 10.7509 13.9762 71.4434 Constraint (T0311)I13.CB (T0311)A38.CB 5.1166 8.5276 11.0859 71.4434 Constraint (T0311)I13.CB (T0311)T37.CB 7.2863 12.1438 15.7870 71.4434 Constraint (T0311)I13.CB (T0311)S36.CB 8.9282 14.8803 19.3444 71.4434 Constraint (T0311)I13.CB (T0311)P35.CB 8.1655 13.6091 17.6919 71.4434 Constraint (T0311)I13.CB (T0311)A34.CB 9.1551 15.2585 19.8360 71.4434 Constraint (T0311)I13.CB (T0311)I33.CB 7.3868 12.3114 16.0048 71.4434 Constraint (T0311)I13.CB (T0311)F27.CB 4.9889 8.3149 10.8094 71.4434 Constraint (T0311)I13.CB (T0311)L24.CB 5.9693 9.9488 12.9334 71.4434 Constraint (T0311)I13.CB (T0311)S23.CB 7.6028 12.6713 16.4727 71.4434 Constraint (T0311)I12.CB (T0311)R40.CB 9.2014 15.3357 19.9364 71.4377 Constraint (T0311)I12.CB (T0311)S39.CB 9.0721 15.1201 19.6562 71.4377 Constraint (T0311)I12.CB (T0311)A38.CB 7.8937 13.1562 17.1031 71.4377 Constraint (T0311)I12.CB (T0311)T37.CB 9.7874 16.3123 21.2059 71.4377 Constraint (T0311)I12.CB (T0311)S36.CB 11.5722 19.2870 25.0731 71.4377 Constraint (T0311)I12.CB (T0311)P35.CB 10.9211 18.2019 23.6624 71.4377 Constraint (T0311)I12.CB (T0311)I33.CB 9.7889 16.3148 21.2093 71.4377 Constraint (T0311)I12.CB (T0311)F27.CB 7.4619 12.4364 16.1674 71.4377 Constraint (T0311)I12.CB (T0311)L24.CB 8.6793 14.4655 18.8052 71.4377 Constraint (T0311)I12.CB (T0311)S23.CB 9.9375 16.5626 21.5313 71.4377 Constraint (T0311)N21.CB (T0311)T43.CB 12.0907 20.1512 26.1965 71.4371 Constraint (T0311)L17.CB (T0311)K45.CB 9.7389 16.2316 21.1010 71.3342 Constraint (T0311)A47.CB (T0311)V59.CB 11.1767 18.6279 24.2163 71.3044 Constraint (T0311)S16.CB (T0311)A34.CB 11.2277 18.7129 24.3268 71.3017 Constraint (T0311)S23.CB (T0311)A46.CB 11.4605 19.1008 24.8311 71.3009 Constraint (T0311)Q14.CB (T0311)E32.CB 11.4266 19.0443 24.7576 71.1209 Constraint (T0311)R40.CB (T0311)M52.CB 6.5391 10.8986 14.1681 71.1209 Constraint (T0311)R40.CB (T0311)E51.CB 9.1470 15.2450 19.8185 71.1209 Constraint (T0311)S39.CB (T0311)M52.CB 8.0075 13.3458 17.3496 71.1209 Constraint (T0311)S39.CB (T0311)E51.CB 10.7931 17.9885 23.3850 71.1209 Constraint (T0311)A38.CB (T0311)M52.CB 5.9613 9.9355 12.9161 71.1209 Constraint (T0311)A38.CB (T0311)E51.CB 8.6553 14.4255 18.7532 71.1209 Constraint (T0311)T37.CB (T0311)M52.CB 5.2033 8.6722 11.2738 71.1209 Constraint (T0311)T37.CB (T0311)E51.CB 7.6754 12.7924 16.6301 71.1209 Constraint (T0311)I33.CB (T0311)M52.CB 4.9765 8.2941 10.7824 71.1209 Constraint (T0311)I33.CB (T0311)E51.CB 7.0523 11.7538 15.2800 71.1209 Constraint (T0311)F27.CB (T0311)E51.CB 9.4698 15.7830 20.5179 71.1209 Constraint (T0311)L24.CB (T0311)M52.CB 8.8156 14.6926 19.1004 71.1209 Constraint (T0311)L24.CB (T0311)E51.CB 11.4557 19.0928 24.8206 71.1209 Constraint (T0311)S16.CB (T0311)L41.CB 7.5053 12.5088 16.2614 70.9608 Constraint (T0311)E15.CB (T0311)L41.CB 8.1387 13.5645 17.6338 70.9608 Constraint (T0311)L17.CB (T0311)R29.CB 7.6838 12.8064 16.6483 70.8727 Constraint (T0311)S16.CB (T0311)R29.CB 9.1915 15.3191 19.9148 70.8727 Constraint (T0311)S16.CB (T0311)A28.CB 8.3232 13.8720 18.0336 70.8727 Constraint (T0311)E15.CB (T0311)R29.CB 11.3534 18.9223 24.5989 70.8727 Constraint (T0311)E15.CB (T0311)A28.CB 10.0744 16.7907 21.8279 70.8727 Constraint (T0311)Q14.CB (T0311)R29.CB 10.1512 16.9187 21.9943 70.8727 Constraint (T0311)R40.CB (T0311)I60.CB 9.8321 16.3868 21.3028 70.7960 Constraint (T0311)S39.CB (T0311)I60.CB 9.1732 15.2886 19.8752 70.7960 Constraint (T0311)R29.CB (T0311)K55.CB 7.1648 11.9414 15.5238 70.5871 Constraint (T0311)I13.CB (T0311)M31.CB 6.5896 10.9826 14.2774 70.4979 Constraint (T0311)N21.CB (T0311)E32.CB 11.9942 19.9903 25.9874 70.4950 Constraint (T0311)I12.CB (T0311)M31.CB 8.6100 14.3501 18.6551 70.4921 Constraint (T0311)E19.CB (T0311)L41.CB 10.3540 17.2566 22.4336 70.3651 Constraint (T0311)E19.CB (T0311)S39.CB 10.9526 18.2543 23.7306 70.3651 Constraint (T0311)E19.CB (T0311)A38.CB 9.6551 16.0918 20.9193 70.3651 Constraint (T0311)E19.CB (T0311)P35.CB 11.5446 19.2410 25.0133 70.3651 Constraint (T0311)E19.CB (T0311)A30.CB 9.1084 15.1806 19.7348 70.3651 Constraint (T0311)L17.CB (T0311)V58.CB 8.4971 14.1619 18.4104 70.3317 Constraint (T0311)L17.CB (T0311)S57.CB 7.4553 12.4255 16.1532 70.3317 Constraint (T0311)L17.CB (T0311)L56.CB 5.9984 9.9974 12.9966 70.3317 Constraint (T0311)Q14.CB (T0311)V58.CB 10.3533 17.2555 22.4322 70.3317 Constraint (T0311)Q14.CB (T0311)S57.CB 8.5535 14.2559 18.5326 70.3317 Constraint (T0311)Q14.CB (T0311)L56.CB 7.0863 11.8104 15.3536 70.3317 Constraint (T0311)M31.CB (T0311)E51.CB 6.5817 10.9695 14.2604 70.1753 Constraint (T0311)D18.CB (T0311)R29.CB 10.0298 16.7164 21.7313 69.9020 Constraint (T0311)R40.CB (T0311)P50.CB 9.2860 15.4766 20.1196 69.8228 Constraint (T0311)S39.CB (T0311)P50.CB 11.3075 18.8458 24.4996 69.8228 Constraint (T0311)A38.CB (T0311)P50.CB 9.5381 15.8968 20.6658 69.8228 Constraint (T0311)T37.CB (T0311)P50.CB 8.7597 14.5995 18.9793 69.8228 Constraint (T0311)I33.CB (T0311)P50.CB 8.7479 14.5798 18.9537 69.8228 Constraint (T0311)A30.CB (T0311)P50.CB 10.8039 18.0065 23.4085 69.8228 Constraint (T0311)F27.CB (T0311)P50.CB 10.5222 17.5370 22.7981 69.8228 Constraint (T0311)D18.CB (T0311)T43.CB 9.2820 15.4701 20.1111 69.7387 Constraint (T0311)L17.CB (T0311)T43.CB 7.9591 13.2651 17.2447 69.7387 Constraint (T0311)Q14.CB (T0311)T43.CB 6.0772 10.1287 13.1673 69.7387 Constraint (T0311)I13.CB (T0311)V22.CB 6.0573 10.0956 13.1242 69.5022 Constraint (T0311)I12.CB (T0311)V22.CB 8.0391 13.3985 17.4181 69.4964 Constraint (T0311)E19.CB (T0311)M31.CB 10.0788 16.7979 21.8373 69.4195 Constraint (T0311)A30.CB (T0311)E51.CB 8.8683 14.7805 19.2146 69.4020 Constraint (T0311)F27.CB (T0311)M52.CB 7.0784 11.7974 15.3366 69.4020 Constraint (T0311)D18.CB (T0311)S57.CB 9.7995 16.3325 21.2323 69.3611 Constraint (T0311)I13.CB (T0311)A46.CB 7.1787 11.9645 15.5538 69.3563 Constraint (T0311)I13.CB (T0311)K45.CB 7.6342 12.7236 16.5407 69.3563 Constraint (T0311)I12.CB (T0311)K45.CB 9.2418 15.4031 20.0240 69.3505 Constraint (T0311)A38.CB (T0311)I60.CB 6.8927 11.4878 14.9341 69.0771 Constraint (T0311)T37.CB (T0311)I60.CB 9.0714 15.1190 19.6548 69.0771 Constraint (T0311)K45.CB (T0311)V58.CB 12.5775 20.9625 27.2513 69.0476 Constraint (T0311)N21.CB (T0311)S57.CB 10.5761 17.6268 22.9148 68.9723 Constraint (T0311)N21.CB (T0311)L56.CB 9.6125 16.0208 20.8270 68.9723 Constraint (T0311)R29.CB (T0311)V58.CB 8.3645 13.9408 18.1230 68.9085 Constraint (T0311)M31.CB (T0311)P50.CB 8.2889 13.8148 17.9593 68.8772 Constraint (T0311)S16.CB (T0311)L42.CB 6.5087 10.8478 14.1021 68.8676 Constraint (T0311)E15.CB (T0311)L42.CB 6.4909 10.8181 14.0635 68.8676 Constraint (T0311)I12.CB (T0311)A34.CB 11.6801 19.4668 25.3068 68.8667 Constraint (T0311)I13.CB (T0311)A30.CB 7.7830 12.9717 16.8631 68.7852 Constraint (T0311)I13.CB (T0311)E26.CB 7.7487 12.9146 16.7889 68.7852 Constraint (T0311)I13.CB (T0311)R25.CB 8.5585 14.2641 18.5434 68.7852 Constraint (T0311)I12.CB (T0311)A30.CB 9.6570 16.0951 20.9236 68.7794 Constraint (T0311)I12.CB (T0311)E26.CB 9.9778 16.6297 21.6186 68.7794 Constraint (T0311)I12.CB (T0311)R25.CB 11.1415 18.5692 24.1400 68.7794 Constraint (T0311)N21.CB (T0311)V58.CB 10.5849 17.6415 22.9340 68.6723 Constraint (T0311)L24.CB (T0311)P50.CB 12.3059 20.5098 26.6627 68.6084 Constraint (T0311)I13.CB (T0311)E32.CB 9.5189 15.8648 20.6243 68.6067 Constraint (T0311)I13.CB (T0311)L42.CB 3.6463 6.0771 7.9003 68.5316 Constraint (T0311)I13.CB (T0311)L41.CB 4.1430 6.9050 8.9765 68.5316 Constraint (T0311)I12.CB (T0311)L42.CB 6.0404 10.0673 13.0875 68.5258 Constraint (T0311)I12.CB (T0311)L41.CB 6.4319 10.7198 13.9357 68.5258 Constraint (T0311)I12.CB (T0311)N21.CB 9.8369 16.3948 21.3132 68.5258 Constraint (T0311)S16.CB (T0311)E32.CB 10.2979 17.1631 22.3121 68.4650 Constraint (T0311)M31.CB (T0311)M52.CB 4.6984 7.8307 10.1799 68.4564 Constraint (T0311)I13.CB (T0311)A28.CB 7.0869 11.8116 15.3551 68.4434 Constraint (T0311)I12.CB (T0311)A28.CB 9.7118 16.1863 21.0422 68.4377 Constraint (T0311)A30.CB (T0311)M52.CB 7.4056 12.3426 16.0454 68.3856 Constraint (T0311)D18.CB (T0311)V58.CB 10.8995 18.1658 23.6155 68.3448 Constraint (T0311)D18.CB (T0311)L56.CB 8.6751 14.4585 18.7961 68.3448 Constraint (T0311)Q14.CB (T0311)A46.CB 8.5782 14.2971 18.5862 68.3399 Constraint (T0311)S36.CB (T0311)M52.CB 8.1775 13.6291 17.7179 68.3280 Constraint (T0311)S36.CB (T0311)E51.CB 10.6320 17.7201 23.0361 68.3280 Constraint (T0311)P35.CB (T0311)M52.CB 8.5684 14.2807 18.5650 68.3280 Constraint (T0311)P35.CB (T0311)E51.CB 11.0288 18.3813 23.8957 68.3280 Constraint (T0311)A34.CB (T0311)M52.CB 7.2329 12.0548 15.6713 68.3280 Constraint (T0311)A34.CB (T0311)E51.CB 9.3338 15.5563 20.2231 68.3280 Constraint (T0311)E19.CB (T0311)L42.CB 8.5887 14.3145 18.6088 68.2719 Constraint (T0311)L17.CB (T0311)K55.CB 8.4997 14.1662 18.4161 68.2385 Constraint (T0311)L17.CB (T0311)I54.CB 9.7659 16.2766 21.1595 68.2385 Constraint (T0311)Q14.CB (T0311)K55.CB 10.0199 16.6998 21.7097 68.2385 Constraint (T0311)Q14.CB (T0311)I54.CB 10.8160 18.0267 23.4347 68.2385 Constraint (T0311)T43.CB (T0311)M52.CB 8.7779 14.6298 19.0187 68.2090 Constraint (T0311)L42.CB (T0311)M52.CB 7.5306 12.5510 16.3163 68.2090 Constraint (T0311)L42.CB (T0311)E51.CB 10.2377 17.0629 22.1818 68.2090 Constraint (T0311)L41.CB (T0311)M52.CB 4.8937 8.1562 10.6031 68.2090 Constraint (T0311)L41.CB (T0311)E51.CB 7.5751 12.6252 16.4127 68.2090 Constraint (T0311)A30.CB (T0311)A47.CB 12.2461 20.4102 26.5332 68.1982 Constraint (T0311)R25.CB (T0311)A47.CB 12.8352 21.3921 27.8097 68.1871 Constraint (T0311)A28.CB (T0311)E51.CB 9.2942 15.4904 20.1375 68.1209 Constraint (T0311)L24.CB (T0311)I60.CB 7.5066 12.5109 16.2642 68.0790 Constraint (T0311)I33.CB (T0311)I60.CB 7.8761 13.1268 17.0648 68.0607 Constraint (T0311)Q14.CB (T0311)V59.CB 8.3859 13.9765 18.1694 67.9819 Constraint (T0311)S16.CB (T0311)S57.CB 6.2563 10.4271 13.5552 67.6735 Constraint (T0311)E15.CB (T0311)S57.CB 8.4767 14.1278 18.3661 67.6735 Constraint (T0311)N21.CB (T0311)V59.CB 8.1792 13.6319 17.7215 67.6388 Constraint (T0311)R29.CB (T0311)V59.CB 5.8266 9.7110 12.6243 67.5751 Constraint (T0311)E26.CB (T0311)M52.CB 9.6852 16.1420 20.9846 67.3876 Constraint (T0311)R25.CB (T0311)M52.CB 9.8480 16.4133 21.3373 67.3876 Constraint (T0311)E19.CB (T0311)R29.CB 10.6918 17.8197 23.1656 67.3651 Constraint (T0311)E19.CB (T0311)A28.CB 10.3011 17.1684 22.3190 67.3651 Constraint (T0311)R40.CB (T0311)T49.CB 7.3926 12.3210 16.0172 67.2518 Constraint (T0311)S39.CB (T0311)T49.CB 9.6668 16.1113 20.9447 67.2518 Constraint (T0311)S39.CB (T0311)L48.CB 7.3438 12.2396 15.9115 67.2518 Constraint (T0311)A38.CB (T0311)T49.CB 8.1115 13.5192 17.5750 67.2518 Constraint (T0311)A38.CB (T0311)L48.CB 6.1302 10.2170 13.2822 67.2518 Constraint (T0311)T37.CB (T0311)T49.CB 6.5915 10.9858 14.2815 67.2518 Constraint (T0311)T37.CB (T0311)L48.CB 5.4812 9.1353 11.8758 67.2518 Constraint (T0311)I33.CB (T0311)T49.CB 7.0031 11.6718 15.1734 67.2518 Constraint (T0311)I33.CB (T0311)L48.CB 6.3936 10.6561 13.8529 67.2518 Constraint (T0311)F27.CB (T0311)T49.CB 9.8031 16.3385 21.2401 67.2518 Constraint (T0311)L24.CB (T0311)T49.CB 11.1176 18.5294 24.0882 67.2518 Constraint (T0311)I13.CB (T0311)V58.CB 7.9818 13.3030 17.2939 67.2404 Constraint (T0311)I13.CB (T0311)S57.CB 5.9546 9.9243 12.9016 67.2404 Constraint (T0311)I13.CB (T0311)L56.CB 4.4754 7.4590 9.6967 67.2404 Constraint (T0311)I13.CB (T0311)K55.CB 7.3823 12.3038 15.9950 67.2404 Constraint (T0311)I13.CB (T0311)I54.CB 7.9668 13.2779 17.2613 67.2404 Constraint (T0311)M31.CB (T0311)I60.CB 5.9653 9.9421 12.9248 67.1152 Constraint (T0311)E15.CB (T0311)T43.CB 8.9426 14.9043 19.3756 67.0804 Constraint (T0311)F27.CB (T0311)I60.CB 4.7485 7.9142 10.2885 67.0627 Constraint (T0311)S23.CB (T0311)I60.CB 7.9218 13.2031 17.1640 67.0627 Constraint (T0311)A34.CB (T0311)P50.CB 10.9846 18.3076 23.7999 67.0299 Constraint (T0311)E32.CB (T0311)P50.CB 9.3827 15.6378 20.3291 66.9860 Constraint (T0311)K45.CB (T0311)I60.CB 10.9606 18.2677 23.7480 66.9156 Constraint (T0311)L41.CB (T0311)P50.CB 7.4263 12.3772 16.0903 66.9110 Constraint (T0311)N21.CB (T0311)K55.CB 11.4419 19.0699 24.7909 66.8791 Constraint (T0311)R29.CB (T0311)A46.CB 11.5616 19.2694 25.0502 66.8571 Constraint (T0311)L17.CB (T0311)A53.CB 8.5848 14.3080 18.6003 66.8561 Constraint (T0311)Q14.CB (T0311)A53.CB 8.7682 14.6136 18.9977 66.8561 Constraint (T0311)A28.CB (T0311)P50.CB 10.8221 18.0368 23.4479 66.8228 Constraint (T0311)I13.CB (T0311)A47.CB 8.0284 13.3806 17.3948 66.7853 Constraint (T0311)I13.CB (T0311)T43.CB 6.3214 10.5357 13.6965 66.7444 Constraint (T0311)I12.CB (T0311)T43.CB 8.2292 13.7153 17.8299 66.7387 Constraint (T0311)E15.CB (T0311)L56.CB 7.8984 13.1640 17.1131 66.6571 Constraint (T0311)L17.CB (T0311)A46.CB 9.6370 16.0616 20.8801 66.6210 Constraint (T0311)A28.CB (T0311)M52.CB 6.8529 11.4215 14.8480 66.4020 Constraint (T0311)I12.CB (T0311)A46.CB 8.8920 14.8200 19.2659 66.3563 Constraint (T0311)M31.CB (T0311)T49.CB 7.3548 12.2580 15.9355 66.3063 Constraint (T0311)M31.CB (T0311)L48.CB 6.6803 11.1338 14.4739 66.3063 Constraint (T0311)L17.CB (T0311)V59.CB 5.9382 9.8969 12.8660 66.2630 Constraint (T0311)F27.CB (T0311)L48.CB 7.8393 13.0654 16.9851 66.2355 Constraint (T0311)L24.CB (T0311)L48.CB 8.7886 14.6477 19.0420 66.2355 Constraint (T0311)S23.CB (T0311)M52.CB 10.7312 17.8854 23.2510 66.1731 Constraint (T0311)L41.CB (T0311)I60.CB 6.9889 11.6482 15.1427 66.1652 Constraint (T0311)L20.CB (T0311)S39.CB 10.0835 16.8058 21.8475 66.1384 Constraint (T0311)L20.CB (T0311)A38.CB 8.3509 13.9181 18.0935 66.1384 Constraint (T0311)L20.CB (T0311)P35.CB 9.8890 16.4816 21.4261 66.1384 Constraint (T0311)L20.CB (T0311)I33.CB 10.0810 16.8017 21.8422 66.1384 Constraint (T0311)L20.CB (T0311)A30.CB 6.7978 11.3297 14.7286 66.1384 Constraint (T0311)S16.CB (T0311)K45.CB 10.8203 18.0338 23.4440 66.1050 Constraint (T0311)E15.CB (T0311)K45.CB 10.4385 17.3975 22.6167 66.1050 Constraint (T0311)E19.CB (T0311)T43.CB 11.4432 19.0720 24.7935 66.0641 Constraint (T0311)S16.CB (T0311)T43.CB 9.4737 15.7895 20.5263 66.0641 Constraint (T0311)I13.CB (T0311)V59.CB 6.5410 10.9017 14.1723 65.9069 Constraint (T0311)I13.CB (T0311)A53.CB 5.8756 9.7927 12.7305 65.8580 Constraint (T0311)L42.CB (T0311)I60.CB 7.1431 11.9052 15.4768 65.7909 Constraint (T0311)I13.CB (T0311)R29.CB 9.1178 15.1963 19.7552 65.7852 Constraint (T0311)I12.CB (T0311)R29.CB 11.4056 19.0093 24.7121 65.7794 Constraint (T0311)E15.CB (T0311)A46.CB 10.7754 17.9590 23.3467 65.6817 Constraint (T0311)E26.CB (T0311)A46.CB 11.6414 19.4024 25.2231 65.6657 Constraint (T0311)S16.CB (T0311)I54.CB 8.9654 14.9423 19.4250 65.5802 Constraint (T0311)E15.CB (T0311)I54.CB 11.1632 18.6053 24.1869 65.5802 Constraint (T0311)E32.CB (T0311)E51.CB 6.7410 11.2350 14.6054 65.5671 Constraint (T0311)E32.CB (T0311)M52.CB 5.9179 9.8631 12.8221 65.5489 Constraint (T0311)D18.CB (T0311)A53.CB 11.1175 18.5292 24.0879 65.4807 Constraint (T0311)R29.CB (T0311)E51.CB 10.3585 17.2642 22.4434 65.4039 Constraint (T0311)D18.CB (T0311)V59.CB 8.5646 14.2744 18.5567 65.2924 Constraint (T0311)S36.CB (T0311)I60.CB 11.0257 18.3762 23.8891 65.2861 Constraint (T0311)P35.CB (T0311)I60.CB 9.5079 15.8464 20.6004 65.2861 Constraint (T0311)I12.CB (T0311)S57.CB 6.5833 10.9721 14.2638 65.2385 Constraint (T0311)I12.CB (T0311)L56.CB 6.5001 10.8336 14.0836 65.2385 Constraint (T0311)I12.CB (T0311)I54.CB 8.9417 14.9028 19.3737 65.2385 Constraint (T0311)L20.CB (T0311)M31.CB 8.2112 13.6854 17.7910 65.1928 Constraint (T0311)V22.CB (T0311)I60.CB 5.1856 8.6427 11.2356 65.1215 Constraint (T0311)Q14.CB (T0311)A47.CB 9.7527 16.2545 21.1308 65.0664 Constraint (T0311)Q14.CB (T0311)I60.CB 6.8021 11.3369 14.7379 65.0397 Constraint (T0311)S16.CB (T0311)V58.CB 7.6162 12.6937 16.5018 64.9382 Constraint (T0311)S16.CB (T0311)L56.CB 5.6527 9.4212 12.2476 64.9382 Constraint (T0311)E15.CB (T0311)V58.CB 10.2771 17.1284 22.2670 64.9382 Constraint (T0311)D18.CB (T0311)K55.CB 11.1632 18.6054 24.1870 64.5326 Constraint (T0311)A30.CB (T0311)L48.CB 9.1556 15.2593 19.8371 64.5166 Constraint (T0311)R25.CB (T0311)L48.CB 10.6652 17.7753 23.1079 64.5166 Constraint (T0311)S36.CB (T0311)T49.CB 9.4872 15.8119 20.5555 64.4590 Constraint (T0311)S36.CB (T0311)L48.CB 8.1081 13.5135 17.5675 64.4590 Constraint (T0311)P35.CB (T0311)T49.CB 10.5775 17.6292 22.9180 64.4590 Constraint (T0311)A34.CB (T0311)T49.CB 8.7454 14.5756 18.9483 64.4590 Constraint (T0311)A34.CB (T0311)L48.CB 8.0279 13.3798 17.3937 64.4590 Constraint (T0311)E32.CB (T0311)T49.CB 8.0684 13.4474 17.4816 64.4151 Constraint (T0311)A30.CB (T0311)I60.CB 5.9537 9.9229 12.8997 64.4044 Constraint (T0311)E26.CB (T0311)I60.CB 6.8678 11.4463 14.8802 64.4044 Constraint (T0311)R25.CB (T0311)I60.CB 8.9079 14.8466 19.3005 64.4044 Constraint (T0311)E26.CB (T0311)E51.CB 11.7480 19.5800 25.4540 64.3876 Constraint (T0311)R29.CB (T0311)M52.CB 8.5148 14.1913 18.4487 64.3876 Constraint (T0311)A34.CB (T0311)I60.CB 10.3838 17.3063 22.4981 64.2698 Constraint (T0311)A28.CB (T0311)T49.CB 9.3489 15.5816 20.2560 64.2518 Constraint (T0311)A46.CB (T0311)I60.CB 9.9564 16.5941 21.5723 64.1986 Constraint (T0311)S16.CB (T0311)A53.CB 7.8405 13.0675 16.9878 64.1979 Constraint (T0311)E15.CB (T0311)A53.CB 9.4442 15.7404 20.4625 64.1979 Constraint (T0311)L48.CB (T0311)S57.CB 6.4589 10.7649 13.9943 64.0682 Constraint (T0311)A28.CB (T0311)I60.CB 7.4591 12.4318 16.1613 64.0627 Constraint (T0311)L17.CB (T0311)A47.CB 11.0238 18.3730 23.8849 64.0501 Constraint (T0311)L20.CB (T0311)L42.CB 8.3600 13.9334 18.1134 64.0452 Constraint (T0311)L20.CB (T0311)L41.CB 9.6552 16.0920 20.9196 64.0452 Constraint (T0311)L20.CB (T0311)T37.CB 11.2312 18.7187 24.3343 64.0452 Constraint (T0311)A38.CB (T0311)S62.CB 9.4587 15.7645 20.4938 64.0416 Constraint (T0311)L24.CB (T0311)S62.CB 10.2289 17.0481 22.1625 64.0416 Constraint (T0311)T43.CB (T0311)I60.CB 9.9354 16.5590 21.5267 64.0038 Constraint (T0311)S16.CB (T0311)A46.CB 10.4311 17.3852 22.6007 63.9628 Constraint (T0311)I12.CB (T0311)A53.CB 6.8347 11.3911 14.8085 63.8561 Constraint (T0311)R29.CB (T0311)P50.CB 12.4238 20.7064 26.9183 63.8228 Constraint (T0311)I12.CB (T0311)A47.CB 9.0562 15.0937 19.6218 63.7853 Constraint (T0311)N21.CB (T0311)A53.CB 12.7550 21.2584 27.6359 63.7676 Constraint (T0311)S16.CB (T0311)V59.CB 6.2323 10.3872 13.5034 63.6048 Constraint (T0311)E15.CB (T0311)V59.CB 8.7620 14.6032 18.9842 63.6048 Constraint (T0311)I12.CB (T0311)V58.CB 9.0582 15.0970 19.6262 63.5196 Constraint (T0311)I12.CB (T0311)K55.CB 9.1804 15.3007 19.8908 63.5196 Constraint (T0311)P35.CB (T0311)L48.CB 8.9291 14.8818 19.3463 63.4426 Constraint (T0311)E32.CB (T0311)I60.CB 8.6258 14.3764 18.6893 63.4368 Constraint (T0311)V22.CB (T0311)A46.CB 11.0898 18.4830 24.0279 63.4289 Constraint (T0311)A47.CB (T0311)I60.CB 10.6287 17.7146 23.0289 63.3466 Constraint (T0311)P50.CB (T0311)V59.CB 9.1414 15.2357 19.8064 63.3211 Constraint (T0311)L17.CB (T0311)I60.CB 4.7342 7.8903 10.2574 63.3208 Constraint (T0311)A30.CB (T0311)T49.CB 9.9424 16.5706 21.5418 63.3022 Constraint (T0311)E26.CB (T0311)L48.CB 10.6789 17.7982 23.1376 63.3022 Constraint (T0311)S23.CB (T0311)L48.CB 11.1556 18.5927 24.1705 63.3022 Constraint (T0311)E19.CB (T0311)S57.CB 8.8857 14.8095 19.2523 63.1496 Constraint (T0311)L20.CB (T0311)R29.CB 8.3499 13.9164 18.0913 63.1384 Constraint (T0311)L17.CB (T0311)S62.CB 6.7182 11.1971 14.5562 63.0253 Constraint (T0311)Q14.CB (T0311)S63.CB 10.1642 16.9404 22.0225 63.0253 Constraint (T0311)Q14.CB (T0311)S62.CB 7.9703 13.2839 17.2691 63.0253 Constraint (T0311)S16.CB (T0311)K55.CB 8.3113 13.8522 18.0078 62.8450 Constraint (T0311)E15.CB (T0311)K55.CB 10.7093 17.8488 23.2034 62.8450 Constraint (T0311)E19.CB (T0311)I33.CB 11.5277 19.2128 24.9767 62.6988 Constraint (T0311)N21.CB (T0311)I54.CB 13.0497 21.7495 28.2743 62.5549 Constraint (T0311)R25.CB (T0311)E51.CB 12.1834 20.3057 26.3974 62.4042 Constraint (T0311)E15.CB (T0311)A34.CB 12.4425 20.7375 26.9587 62.3093 Constraint (T0311)E19.CB (T0311)R40.CB 12.4086 20.6810 26.8853 62.2815 Constraint (T0311)T49.CB (T0311)V58.CB 8.5430 14.2383 18.5098 62.0836 Constraint (T0311)L48.CB (T0311)V58.CB 8.2338 13.7230 17.8399 62.0836 Constraint (T0311)D18.CB (T0311)S63.CB 11.0241 18.3734 23.8855 62.0547 Constraint (T0311)D18.CB (T0311)S62.CB 8.4483 14.0806 18.3047 62.0547 Constraint (T0311)I54.CB (T0311)S63.CB 6.4546 10.7577 13.9850 61.9484 Constraint (T0311)I13.CB (T0311)S62.CB 6.1533 10.2554 13.3321 61.9484 Constraint (T0311)D18.CB (T0311)K45.CB 10.9239 18.2064 23.6684 61.8023 Constraint (T0311)E32.CB (T0311)L48.CB 8.1863 13.6439 17.7370 61.6799 Constraint (T0311)R29.CB (T0311)T49.CB 11.1489 18.5814 24.1559 61.5166 Constraint (T0311)R29.CB (T0311)L48.CB 10.1810 16.9683 22.0587 61.5166 Constraint (T0311)A28.CB (T0311)L48.CB 7.7541 12.9235 16.8006 61.5166 Constraint (T0311)L20.CB (T0311)T43.CB 11.2303 18.7172 24.3324 61.4742 Constraint (T0311)L20.CB (T0311)R40.CB 11.8073 19.6788 25.5824 61.4742 Constraint (T0311)L20.CB (T0311)S36.CB 12.1784 20.2973 26.3865 61.4742 Constraint (T0311)L20.CB (T0311)A34.CB 11.7039 19.5065 25.3584 61.4742 Constraint (T0311)E19.CB (T0311)L56.CB 8.6063 14.3438 18.6469 61.4307 Constraint (T0311)S16.CB (T0311)A47.CB 11.1221 18.5368 24.0979 61.3918 Constraint (T0311)E15.CB (T0311)A47.CB 11.4195 19.0325 24.7422 61.3918 Constraint (T0311)N21.CB (T0311)I60.CB 7.4826 12.4710 16.2123 61.3580 Constraint (T0311)D18.CB (T0311)I60.CB 7.0146 11.6910 15.1983 61.3339 Constraint (T0311)A38.CB (T0311)S63.CB 11.1859 18.6432 24.2362 61.3064 Constraint (T0311)T37.CB (T0311)S62.CB 11.2956 18.8260 24.4738 61.3064 Constraint (T0311)I33.CB (T0311)S63.CB 11.7533 19.5889 25.4655 61.3064 Constraint (T0311)I33.CB (T0311)S62.CB 10.2317 17.0528 22.1686 61.3064 Constraint (T0311)F27.CB (T0311)S63.CB 9.9023 16.5038 21.4549 61.3064 Constraint (T0311)F27.CB (T0311)S62.CB 7.6378 12.7297 16.5487 61.3064 Constraint (T0311)S23.CB (T0311)S62.CB 10.5823 17.6372 22.9283 61.3064 Constraint (T0311)L17.CB (T0311)S63.CB 9.1254 15.2091 19.7718 61.3064 Constraint (T0311)V22.CB (T0311)M52.CB 9.8294 16.3823 21.2970 61.2781 Constraint (T0311)D18.CB (T0311)I54.CB 12.2324 20.3873 26.5034 61.2775 Constraint (T0311)L20.CB (T0311)E32.CB 10.7183 17.8638 23.2229 61.2084 Constraint (T0311)I12.CB (T0311)V59.CB 8.2267 13.7112 17.8245 61.1698 Constraint (T0311)D18.CB (T0311)E32.CB 12.1134 20.1890 26.2457 61.1601 Constraint (T0311)L41.CB (T0311)S62.CB 8.8095 14.6825 19.0872 61.1298 Constraint (T0311)R40.CB (T0311)S62.CB 11.5627 19.2711 25.0524 61.1298 Constraint (T0311)S39.CB (T0311)S62.CB 11.1544 18.5907 24.1679 61.1298 Constraint (T0311)S36.CB (T0311)P50.CB 11.5203 19.2005 24.9607 61.0409 Constraint (T0311)T49.CB (T0311)V59.CB 9.0617 15.1028 19.6336 60.7501 Constraint (T0311)L48.CB (T0311)V59.CB 7.9408 13.2346 17.2050 60.7501 Constraint (T0311)I12.CB (T0311)E32.CB 10.9811 18.3018 23.7923 60.4569 Constraint (T0311)E15.CB (T0311)S62.CB 7.1017 11.8362 15.3870 60.3671 Constraint (T0311)M31.CB (T0311)S62.CB 8.2846 13.8077 17.9500 60.3608 Constraint (T0311)E26.CB (T0311)T49.CB 12.3420 20.5699 26.7409 60.3022 Constraint (T0311)I13.CB (T0311)I60.CB 4.5911 7.6518 9.9474 60.2295 Constraint (T0311)A53.CB (T0311)S63.CB 6.7478 11.2463 14.6202 60.1612 Constraint (T0311)A53.CB (T0311)S62.CB 6.4956 10.8260 14.0738 60.1612 Constraint (T0311)L20.CB (T0311)S57.CB 7.7203 12.8672 16.7274 59.9392 Constraint (T0311)P35.CB (T0311)P50.CB 12.2020 20.3367 26.4376 59.8265 Constraint (T0311)D18.CB (T0311)A46.CB 11.4418 19.0696 24.7905 59.6601 Constraint (T0311)S16.CB (T0311)I60.CB 3.8377 6.3962 8.3151 59.6462 Constraint (T0311)E15.CB (T0311)I60.CB 6.4552 10.7587 13.9863 59.6462 Constraint (T0311)R29.CB (T0311)I60.CB 8.0087 13.3479 17.3522 59.6173 Constraint (T0311)D11.CB (T0311)L42.CB 5.4705 9.1175 11.8528 59.4573 Constraint (T0311)D11.CB (T0311)L41.CB 6.7400 11.2334 14.6034 59.4573 Constraint (T0311)D11.CB (T0311)R40.CB 8.7248 14.5413 18.9037 59.4573 Constraint (T0311)D11.CB (T0311)S39.CB 8.6410 14.4017 18.7222 59.4573 Constraint (T0311)D11.CB (T0311)A38.CB 8.5404 14.2340 18.5043 59.4573 Constraint (T0311)D11.CB (T0311)T37.CB 10.3077 17.1796 22.3334 59.4573 Constraint (T0311)D11.CB (T0311)S36.CB 11.5073 19.1788 24.9325 59.4573 Constraint (T0311)D11.CB (T0311)P35.CB 11.3197 18.8662 24.5261 59.4573 Constraint (T0311)D11.CB (T0311)A34.CB 12.3832 20.6386 26.8302 59.4573 Constraint (T0311)D11.CB (T0311)F27.CB 8.7840 14.6399 19.0319 59.4573 Constraint (T0311)D11.CB (T0311)L24.CB 8.9721 14.9535 19.4396 59.4573 Constraint (T0311)D11.CB (T0311)S23.CB 10.4836 17.4726 22.7144 59.4573 Constraint (T0311)D11.CB (T0311)V22.CB 9.2036 15.3394 19.9412 59.4573 Constraint (T0311)D11.CB (T0311)N21.CB 10.6937 17.8228 23.1696 59.4573 Constraint (T0311)P35.CB (T0311)S62.CB 12.0098 20.0164 26.0213 59.4109 Constraint (T0311)V22.CB (T0311)S63.CB 10.2833 17.1388 22.2804 59.3652 Constraint (T0311)V22.CB (T0311)S62.CB 7.5834 12.6389 16.4306 59.3652 Constraint (T0311)E19.CB (T0311)K55.CB 10.9546 18.2576 23.7349 59.3374 Constraint (T0311)E19.CB (T0311)I54.CB 11.6763 19.4605 25.2986 59.3374 Constraint (T0311)V22.CB (T0311)E51.CB 12.0172 20.0286 26.0372 59.2992 Constraint (T0311)I13.CB (T0311)S63.CB 7.8765 13.1274 17.0657 59.2132 Constraint (T0311)E19.CB (T0311)V59.CB 8.1674 13.6124 17.6961 59.0991 Constraint (T0311)E19.CB (T0311)V58.CB 9.6602 16.1003 20.9304 59.0374 Constraint (T0311)L42.CB (T0311)S63.CB 10.9985 18.3308 23.8300 59.0366 Constraint (T0311)L42.CB (T0311)S62.CB 8.7773 14.6288 19.0174 59.0366 Constraint (T0311)L20.CB (T0311)L56.CB 7.1195 11.8659 15.4257 58.9412 Constraint (T0311)A30.CB (T0311)S62.CB 8.5528 14.2547 18.5311 58.6481 Constraint (T0311)E26.CB (T0311)S63.CB 12.0102 20.0170 26.0220 58.6481 Constraint (T0311)E26.CB (T0311)S62.CB 9.6848 16.1413 20.9836 58.6481 Constraint (T0311)R25.CB (T0311)S62.CB 11.7748 19.6246 25.5120 58.6481 Constraint (T0311)S16.CB (T0311)S63.CB 6.8843 11.4738 14.9159 58.6481 Constraint (T0311)S16.CB (T0311)S62.CB 4.5360 7.5600 9.8280 58.6481 Constraint (T0311)E15.CB (T0311)S63.CB 8.9257 14.8762 19.3390 58.6481 Constraint (T0311)M31.CB (T0311)S63.CB 9.7720 16.2866 21.1726 58.5736 Constraint (T0311)D11.CB (T0311)M31.CB 10.4045 17.3408 22.5430 58.5117 Constraint (T0311)T37.CB (T0311)S63.CB 12.6587 21.0978 27.4272 58.4696 Constraint (T0311)A46.CB (T0311)S62.CB 11.1576 18.5961 24.1749 58.4423 Constraint (T0311)V22.CB (T0311)L48.CB 10.3931 17.3218 22.5184 58.4071 Constraint (T0311)L41.CB (T0311)S63.CB 10.2261 17.0434 22.1564 58.3946 Constraint (T0311)N21.CB (T0311)S63.CB 11.8589 19.7648 25.6943 58.3946 Constraint (T0311)N21.CB (T0311)S62.CB 9.1013 15.1688 19.7194 58.3946 Constraint (T0311)L24.CB (T0311)S63.CB 12.1967 20.3278 26.4261 58.3064 Constraint (T0311)S23.CB (T0311)S63.CB 12.9214 21.5357 27.9964 58.3064 Constraint (T0311)A28.CB (T0311)S63.CB 12.1855 20.3092 26.4020 58.3064 Constraint (T0311)A28.CB (T0311)S62.CB 10.2434 17.0723 22.1940 58.3064 Constraint (T0311)D11.CB (T0311)T43.CB 6.6448 11.0746 14.3970 58.2658 Constraint (T0311)I12.CB (T0311)I60.CB 5.8954 9.8257 12.7734 58.2276 Constraint (T0311)D11.CB (T0311)A47.CB 9.2615 15.4358 20.0665 58.1658 Constraint (T0311)D11.CB (T0311)A46.CB 8.5873 14.3122 18.6058 58.1658 Constraint (T0311)D11.CB (T0311)K45.CB 8.1687 13.6144 17.6988 58.1658 Constraint (T0311)E19.CB (T0311)A53.CB 10.8384 18.0640 23.4832 58.1460 Constraint (T0311)L20.CB (T0311)K55.CB 8.9662 14.9436 19.4267 57.8460 Constraint (T0311)L20.CB (T0311)I54.CB 10.2736 17.1227 22.2596 57.8460 Constraint (T0311)L20.CB (T0311)A53.CB 9.9879 16.6466 21.6405 57.8460 Constraint (T0311)D11.CB (T0311)I33.CB 10.8910 18.1517 23.5973 57.4571 Constraint (T0311)R25.CB (T0311)T49.CB 12.2260 20.3766 26.4896 57.3025 Constraint (T0311)Q14.CB (T0311)M52.CB 9.5111 15.8518 20.6074 57.1115 Constraint (T0311)E15.CB (T0311)E32.CB 12.0857 20.1429 26.1858 56.9016 Constraint (T0311)A30.CB (T0311)S63.CB 10.3143 17.1905 22.3477 56.8610 Constraint (T0311)L20.CB (T0311)V58.CB 7.5462 12.5769 16.3500 56.8479 Constraint (T0311)D11.CB (T0311)E26.CB 11.2777 18.7961 24.4350 56.7990 Constraint (T0311)D11.CB (T0311)R25.CB 11.8995 19.8325 25.7823 56.7990 Constraint (T0311)E19.CB (T0311)T37.CB 12.1988 20.3314 26.4308 56.7085 Constraint (T0311)E26.CB (T0311)P50.CB 13.1547 21.9246 28.5020 56.6194 Constraint (T0311)D11.CB (T0311)A28.CB 10.7758 17.9597 23.3476 56.4573 Constraint (T0311)E51.CB (T0311)I60.CB 8.9462 14.9103 19.3834 56.3613 Constraint (T0311)K45.CB (T0311)S62.CB 12.4738 20.7896 27.0265 56.2331 Constraint (T0311)T43.CB (T0311)S62.CB 11.5091 19.1819 24.9364 56.2331 Constraint (T0311)I12.CB (T0311)S63.CB 6.9878 11.6464 15.1403 56.2132 Constraint (T0311)I12.CB (T0311)S62.CB 5.5611 9.2686 12.0491 56.2132 Constraint (T0311)E19.CB (T0311)I60.CB 6.2805 10.4676 13.6078 56.1387 Constraint (T0311)I13.CB (T0311)M52.CB 6.8804 11.4673 14.9074 56.1134 Constraint (T0311)I13.CB (T0311)E51.CB 9.3485 15.5809 20.2551 56.1134 Constraint (T0311)L17.CB (T0311)M52.CB 8.9720 14.9533 19.4393 56.0952 Constraint (T0311)D11.CB (T0311)S57.CB 9.0633 15.1055 19.6371 56.0639 Constraint (T0311)D11.CB (T0311)L56.CB 8.3483 13.9138 18.0880 56.0639 Constraint (T0311)D11.CB (T0311)K55.CB 11.2916 18.8194 24.4652 56.0639 Constraint (T0311)D11.CB (T0311)I54.CB 11.2836 18.8060 24.4478 56.0639 Constraint (T0311)Q14.CB (T0311)P64.CB 10.0262 16.7103 21.7234 55.9231 Constraint (T0311)L17.CB (T0311)E51.CB 11.3337 18.8895 24.5563 55.8971 Constraint (T0311)A47.CB (T0311)S62.CB 11.1686 18.6143 24.1986 55.8714 Constraint (T0311)I13.CB (T0311)P50.CB 8.9845 14.9742 19.4665 55.8134 Constraint (T0311)A46.CB (T0311)S63.CB 11.9502 19.9171 25.8922 55.6056 Constraint (T0311)L20.CB (T0311)V59.CB 5.3953 8.9921 11.6898 55.5145 Constraint (T0311)L20.CB (T0311)K45.CB 12.7285 21.2141 27.5784 55.4839 Constraint (T0311)P50.CB (T0311)I60.CB 9.3237 15.5394 20.2013 55.3633 Constraint (T0311)L56.CB (T0311)Q65.CB 7.8735 13.1226 17.0593 55.3408 Constraint (T0311)L41.CB (T0311)P64.CB 8.4463 14.0772 18.3003 55.2206 Constraint (T0311)R40.CB (T0311)P64.CB 11.2501 18.7501 24.3751 55.2206 Constraint (T0311)S39.CB (T0311)P64.CB 11.7793 19.6321 25.5218 55.2206 Constraint (T0311)E19.CB (T0311)S63.CB 9.2986 15.4976 20.1469 55.1406 Constraint (T0311)E19.CB (T0311)S62.CB 6.6896 11.1493 14.4941 55.1406 Constraint (T0311)D18.CB (T0311)P64.CB 11.5281 19.2134 24.9775 55.1135 Constraint (T0311)D11.CB (T0311)V58.CB 11.5558 19.2597 25.0376 55.0475 Constraint (T0311)K55.CB (T0311)P64.CB 6.6861 11.1434 14.4865 55.0347 Constraint (T0311)V22.CB (T0311)A47.CB 12.5667 20.9446 27.2279 54.8946 Constraint (T0311)D11.CB (T0311)A53.CB 8.7666 14.6111 18.9944 54.8724 Constraint (T0311)L42.CB (T0311)P64.CB 9.7728 16.2881 21.1745 54.8463 Constraint (T0311)S16.CB (T0311)P50.CB 10.9289 18.2148 23.6792 54.5990 Constraint (T0311)E32.CB (T0311)S62.CB 10.6418 17.7364 23.0573 54.5892 Constraint (T0311)S16.CB (T0311)M52.CB 9.0671 15.1118 19.6454 54.3763 Constraint (T0311)E15.CB (T0311)M52.CB 10.7962 17.9936 23.3917 54.3763 Constraint (T0311)L20.CB (T0311)A46.CB 12.3771 20.6286 26.8172 54.2657 Constraint (T0311)A38.CB (T0311)P64.CB 9.7531 16.2552 21.1318 54.2042 Constraint (T0311)T37.CB (T0311)P64.CB 10.8321 18.0535 23.4696 54.2042 Constraint (T0311)I33.CB (T0311)P64.CB 10.0526 16.7543 21.7806 54.2042 Constraint (T0311)F27.CB (T0311)P64.CB 9.2223 15.3705 19.9817 54.2042 Constraint (T0311)L24.CB (T0311)P64.CB 11.4556 19.0927 24.8205 54.2042 Constraint (T0311)V22.CB (T0311)P64.CB 10.3404 17.2340 22.4042 54.2042 Constraint (T0311)L17.CB (T0311)P64.CB 9.2242 15.3736 19.9857 54.2042 Constraint (T0311)S16.CB (T0311)E51.CB 11.0654 18.4424 23.9751 54.1782 Constraint (T0311)Q14.CB (T0311)E51.CB 12.0222 20.0371 26.0482 54.1211 Constraint (T0311)I12.CB (T0311)M52.CB 8.8736 14.7893 19.2261 54.1115 Constraint (T0311)I12.CB (T0311)E51.CB 10.8107 18.0178 23.4232 54.1115 Constraint (T0311)I54.CB (T0311)P64.CB 4.4120 7.3533 9.5593 54.0366 Constraint (T0311)L20.CB (T0311)S63.CB 8.9486 14.9143 19.3886 53.9491 Constraint (T0311)L20.CB (T0311)S62.CB 6.1109 10.1849 13.2404 53.9491 Constraint (T0311)L20.CB (T0311)I60.CB 4.5663 7.6106 9.8937 53.9491 Constraint (T0311)R29.CB (T0311)S62.CB 10.8525 18.0876 23.5138 53.8610 Constraint (T0311)L41.CB (T0311)Q65.CB 9.9436 16.5727 21.5445 53.8200 Constraint (T0311)A38.CB (T0311)Q65.CB 11.7101 19.5169 25.3720 53.8200 Constraint (T0311)I33.CB (T0311)Q65.CB 12.4056 20.6760 26.8788 53.8200 Constraint (T0311)F27.CB (T0311)Q65.CB 11.1896 18.6493 24.2440 53.8200 Constraint (T0311)V22.CB (T0311)Q65.CB 11.8855 19.8092 25.7520 53.8200 Constraint (T0311)L17.CB (T0311)Q65.CB 10.4694 17.4490 22.6837 53.8200 Constraint (T0311)Q14.CB (T0311)Q65.CB 10.5842 17.6403 22.9323 53.8200 Constraint (T0311)D11.CB (T0311)R29.CB 12.9081 21.5135 27.9676 53.7990 Constraint (T0311)D11.CB (T0311)V59.CB 10.3108 17.1846 22.3400 53.7141 Constraint (T0311)A53.CB (T0311)Q65.CB 6.6094 11.0157 14.3204 53.6524 Constraint (T0311)E19.CB (T0311)K45.CB 12.7826 21.3044 27.6957 53.5858 Constraint (T0311)V22.CB (T0311)T49.CB 12.4901 20.8169 27.0620 53.2919 Constraint (T0311)M31.CB (T0311)P64.CB 8.5901 14.3168 18.6118 53.2587 Constraint (T0311)K55.CB (T0311)Q65.CB 9.3411 15.5686 20.2391 53.2475 Constraint (T0311)Q14.CB (T0311)L48.CB 8.3546 13.9244 18.1017 53.2425 Constraint (T0311)I13.CB (T0311)T49.CB 8.7139 14.5232 18.8801 53.2425 Constraint (T0311)I13.CB (T0311)L48.CB 5.8262 9.7103 12.6234 53.2425 Constraint (T0311)I13.CB (T0311)P64.CB 7.4531 12.4218 16.1484 53.1273 Constraint (T0311)S23.CB (T0311)A47.CB 13.0860 21.8100 28.3530 53.1095 Constraint (T0311)K45.CB (T0311)P64.CB 11.7196 19.5327 25.3925 53.0591 Constraint (T0311)T43.CB (T0311)P64.CB 11.9109 19.8515 25.8069 53.0591 Constraint (T0311)A34.CB (T0311)S62.CB 12.6187 21.0312 27.3405 52.9869 Constraint (T0311)M31.CB (T0311)Q65.CB 10.9975 18.3292 23.8279 52.8744 Constraint (T0311)A47.CB (T0311)S63.CB 11.3344 18.8906 24.5578 52.8714 Constraint (T0311)I12.CB (T0311)P50.CB 9.6984 16.1640 21.0132 52.8134 Constraint (T0311)T49.CB (T0311)I60.CB 9.6850 16.1416 20.9841 52.7923 Constraint (T0311)L48.CB (T0311)I60.CB 7.7541 12.9234 16.8005 52.7923 Constraint (T0311)D11.CB (T0311)L20.CB 9.0665 15.1108 19.6440 52.7723 Constraint (T0311)A53.CB (T0311)P64.CB 4.0569 6.7614 8.7899 52.2495 Constraint (T0311)L17.CB (T0311)L48.CB 8.7754 14.6257 19.0134 52.2261 Constraint (T0311)E15.CB (T0311)L48.CB 9.7358 16.2263 21.0941 52.2261 Constraint (T0311)Q14.CB (T0311)T49.CB 11.3677 18.9462 24.6301 52.0280 Constraint (T0311)A46.CB (T0311)Q65.CB 11.2150 18.6916 24.2991 51.7450 Constraint (T0311)L42.CB (T0311)Q65.CB 10.8369 18.0615 23.4799 51.7267 Constraint (T0311)V22.CB (T0311)P50.CB 12.7830 21.3051 27.6966 51.6506 Constraint (T0311)A30.CB (T0311)P64.CB 9.9922 16.6537 21.6498 51.5460 Constraint (T0311)E26.CB (T0311)P64.CB 11.8049 19.6748 25.5772 51.5460 Constraint (T0311)S16.CB (T0311)P64.CB 7.6536 12.7560 16.5828 51.5460 Constraint (T0311)E15.CB (T0311)P64.CB 9.5806 15.9677 20.7580 51.5460 Constraint (T0311)I54.CB (T0311)Q65.CB 7.0590 11.7649 15.2944 51.5286 Constraint (T0311)A46.CB (T0311)P64.CB 9.6601 16.1002 20.9302 51.3402 Constraint (T0311)R29.CB (T0311)A47.CB 12.7300 21.2166 27.5816 51.3132 Constraint (T0311)D11.CB (T0311)A30.CB 11.3807 18.9678 24.6581 51.2260 Constraint (T0311)A28.CB (T0311)P64.CB 10.9597 18.2662 23.7460 51.2042 Constraint (T0311)S16.CB (T0311)Q65.CB 8.3060 13.8433 17.9963 51.1617 Constraint (T0311)E15.CB (T0311)Q65.CB 9.6183 16.0306 20.8397 51.1617 Constraint (T0311)L17.CB (T0311)T49.CB 11.3342 18.8903 24.5574 51.0117 Constraint (T0311)I13.CB (T0311)Q65.CB 8.3663 13.9439 18.1271 50.7287 Constraint (T0311)S16.CB (T0311)L48.CB 8.5525 14.2542 18.5305 50.5072 Constraint (T0311)R40.CB (T0311)S63.CB 12.8263 21.3772 27.7904 50.4860 Constraint (T0311)E19.CB (T0311)M52.CB 12.0460 20.0767 26.0997 50.2500 Constraint (T0311)I12.CB (T0311)T49.CB 10.1075 16.8458 21.8996 50.2425 Constraint (T0311)I12.CB (T0311)L48.CB 7.3238 12.2064 15.8683 50.2425 Constraint (T0311)E19.CB (T0311)P64.CB 10.3373 17.2289 22.3975 50.1407 Constraint (T0311)E19.CB (T0311)S36.CB 13.2640 22.1066 28.7386 50.0864 Constraint (T0311)E19.CB (T0311)A34.CB 13.1042 21.8404 28.3925 50.0864 Constraint (T0311)E19.CB (T0311)E32.CB 12.1950 20.3250 26.4225 50.0864 Constraint (T0311)D11.CB (T0311)S63.CB 10.0630 16.7717 21.8032 49.9555 Constraint (T0311)D11.CB (T0311)S62.CB 8.2624 13.7706 17.9018 49.9555 Constraint (T0311)L20.CB (T0311)M52.CB 10.6216 17.7026 23.0134 49.9500 Constraint (T0311)L20.CB (T0311)Q65.CB 10.7543 17.9238 23.3010 49.9473 Constraint (T0311)E19.CB (T0311)Q65.CB 10.5850 17.6417 22.9343 49.9473 Constraint (T0311)M52.CB (T0311)S63.CB 9.3838 15.6397 20.3316 49.6070 Constraint (T0311)M52.CB (T0311)S62.CB 8.6401 14.4002 18.7203 49.6070 Constraint (T0311)E51.CB (T0311)S62.CB 9.6252 16.0420 20.8545 49.6070 Constraint (T0311)P50.CB (T0311)S62.CB 9.2845 15.4741 20.1164 49.6070 Constraint (T0311)E32.CB (T0311)P64.CB 10.5775 17.6292 22.9180 49.5803 Constraint (T0311)S16.CB (T0311)T49.CB 11.0868 18.4779 24.0213 49.2928 Constraint (T0311)N21.CB (T0311)M52.CB 12.7674 21.2791 27.6628 49.2154 Constraint (T0311)D18.CB (T0311)M52.CB 11.4723 19.1206 24.8568 49.1912 Constraint (T0311)A47.CB (T0311)Q65.CB 10.1184 16.8640 21.9232 49.1740 Constraint (T0311)I12.CB (T0311)P64.CB 7.1574 11.9290 15.5077 49.1110 Constraint (T0311)L20.CB (T0311)P64.CB 9.7860 16.3101 21.2031 48.9492 Constraint (T0311)A47.CB (T0311)P64.CB 8.8918 14.8197 19.2656 48.7692 Constraint (T0311)I12.CB (T0311)Q65.CB 7.0117 11.6861 15.1919 48.7267 Constraint (T0311)A34.CB (T0311)P64.CB 12.4574 20.7624 26.9911 48.6312 Constraint (T0311)L17.CB (T0311)P50.CB 11.4108 19.0180 24.7235 48.6086 Constraint (T0311)Q14.CB (T0311)P50.CB 11.5836 19.3059 25.0977 48.6086 Constraint (T0311)R29.CB (T0311)P64.CB 12.1866 20.3110 26.4043 48.5460 Constraint (T0311)E32.CB (T0311)S63.CB 11.6746 19.4577 25.2951 48.5385 Constraint (T0311)S23.CB (T0311)E51.CB 12.9646 21.6077 28.0901 48.4144 Constraint (T0311)A30.CB (T0311)Q65.CB 12.1718 20.2863 26.3722 48.3250 Constraint (T0311)R29.CB (T0311)S63.CB 12.6745 21.1242 27.4614 48.2900 Constraint (T0311)D11.CB (T0311)I60.CB 7.9278 13.2129 17.1768 48.2366 Constraint (T0311)E51.CB (T0311)S63.CB 9.4863 15.8105 20.5537 47.8881 Constraint (T0311)P50.CB (T0311)S63.CB 8.5836 14.3060 18.5978 47.8881 Constraint (T0311)S23.CB (T0311)P64.CB 12.5181 20.8636 27.1226 47.8216 Constraint (T0311)N21.CB (T0311)P64.CB 12.2709 20.4514 26.5869 47.8216 Constraint (T0311)E26.CB (T0311)A47.CB 13.0823 21.8038 28.3450 47.4532 Constraint (T0311)L20.CB (T0311)E51.CB 12.3629 20.6048 26.7863 47.3791 Constraint (T0311)T49.CB (T0311)S62.CB 10.4915 17.4858 22.7315 47.0360 Constraint (T0311)L48.CB (T0311)S63.CB 9.5069 15.8448 20.5983 47.0360 Constraint (T0311)D11.CB (T0311)M52.CB 10.2608 17.1013 22.2317 46.6210 Constraint (T0311)D18.CB (T0311)Q65.CB 11.8459 19.7432 25.6661 46.6152 Constraint (T0311)D11.CB (T0311)T49.CB 11.3643 18.9405 24.6227 46.5210 Constraint (T0311)D11.CB (T0311)L48.CB 8.2267 13.7112 17.8246 46.5210 Constraint (T0311)L20.CB (T0311)P50.CB 13.0277 21.7128 28.2267 46.3810 Constraint (T0311)L20.CB (T0311)T49.CB 13.1469 21.9115 28.4850 46.3810 Constraint (T0311)L20.CB (T0311)L48.CB 10.8785 18.1309 23.5702 46.3810 Constraint (T0311)L48.CB (T0311)S62.CB 8.6418 14.4031 18.7240 46.0197 Constraint (T0311)P35.CB (T0311)P64.CB 12.5154 20.8590 27.1167 45.7945 Constraint (T0311)D11.CB (T0311)P64.CB 9.9198 16.5329 21.4928 45.3604 Constraint (T0311)T49.CB (T0311)S63.CB 10.5091 17.5152 22.7698 45.3171 Constraint (T0311)S23.CB (T0311)T49.CB 13.0226 21.7043 28.2156 45.3132 Constraint (T0311)A28.CB (T0311)Q65.CB 13.0012 21.6686 28.1692 44.8296 Constraint (T0311)D18.CB (T0311)A47.CB 12.4252 20.7086 26.9212 44.3018 Constraint (T0311)R40.CB (T0311)Q65.CB 12.4882 20.8136 27.0577 43.9832 Constraint (T0311)D11.CB (T0311)P50.CB 11.2440 18.7400 24.3620 43.9478 Constraint (T0311)M52.CB (T0311)P64.CB 7.1718 11.9530 15.5389 43.5029 Constraint (T0311)E19.CB (T0311)L48.CB 11.6093 19.3488 25.1535 43.3810 Constraint (T0311)E15.CB (T0311)P50.CB 12.1171 20.1952 26.2538 43.0356 Constraint (T0311)T43.CB (T0311)Q65.CB 12.4414 20.7357 26.9563 42.9063 Constraint (T0311)E19.CB (T0311)A46.CB 12.5027 20.8379 27.0893 42.7023 Constraint (T0311)D11.CB (T0311)Q65.CB 9.5576 15.9293 20.7081 42.4500 Constraint (T0311)D18.CB (T0311)L48.CB 10.7547 17.9245 23.3018 42.3318 Constraint (T0311)M52.CB (T0311)Q65.CB 9.3777 15.6295 20.3184 42.1888 Constraint (T0311)S36.CB (T0311)S62.CB 12.9070 21.5117 27.9652 42.0238 Constraint (T0311)T37.CB (T0311)Q65.CB 12.5838 20.9730 27.2649 41.9929 Constraint (T0311)R25.CB (T0311)P64.CB 12.9082 21.5136 27.9677 41.9732 Constraint (T0311)E51.CB (T0311)Q65.CB 9.5175 15.8625 20.6213 41.1725 Constraint (T0311)D11.CB (T0311)E51.CB 12.3374 20.5623 26.7310 41.0480 Constraint (T0311)E51.CB (T0311)P64.CB 6.9043 11.5072 14.9594 40.7859 Constraint (T0311)P50.CB (T0311)P64.CB 5.4889 9.1482 11.8927 40.7859 Constraint (T0311)N21.CB (T0311)L48.CB 13.1201 21.8668 28.4268 40.3541 Constraint (T0311)P50.CB (T0311)Q65.CB 7.5678 12.6129 16.3968 40.1744 Constraint (T0311)L48.CB (T0311)P64.CB 7.0573 11.7622 15.2909 39.9339 Constraint (T0311)K45.CB (T0311)Q65.CB 12.1351 20.2251 26.2927 39.8881 Constraint (T0311)S36.CB (T0311)P64.CB 12.8944 21.4906 27.9378 39.8051 Constraint (T0311)E15.CB (T0311)E51.CB 12.6468 21.0780 27.4014 39.0275 Constraint (T0311)L24.CB (T0311)Q65.CB 12.8779 21.4632 27.9022 38.9834 Constraint (T0311)S57.CB (T0311)M66.CB 5.0844 8.4740 11.0162 38.3582 Constraint (T0311)L56.CB (T0311)M66.CB 6.8246 11.3744 14.7867 38.3582 Constraint (T0311)T49.CB (T0311)P64.CB 7.5834 12.6390 16.4307 38.2150 Constraint (T0311)E15.CB (T0311)T49.CB 12.1171 20.1951 26.2536 37.7294 Constraint (T0311)T49.CB (T0311)Q65.CB 9.7922 16.3204 21.2165 37.6035 Constraint (T0311)L48.CB (T0311)Q65.CB 8.6143 14.3571 18.6643 37.6035 Constraint (T0311)A53.CB (T0311)M66.CB 6.8558 11.4264 14.8543 36.6698 Constraint (T0311)T43.CB (T0311)M66.CB 11.4086 19.0144 24.7187 36.4813 Constraint (T0311)L41.CB (T0311)W67.CB 7.1105 11.8508 15.4061 36.3036 Constraint (T0311)K55.CB (T0311)M66.CB 8.8157 14.6929 19.1007 36.2650 Constraint (T0311)I54.CB (T0311)M66.CB 7.7510 12.9183 16.7938 36.2650 Constraint (T0311)V58.CB (T0311)W67.CB 6.7789 11.2982 14.6877 36.0872 Constraint (T0311)L56.CB (T0311)W67.CB 4.9436 8.2393 10.7111 36.0872 Constraint (T0311)D11.CB (T0311)E32.CB 12.5181 20.8635 27.1226 36.0701 Constraint (T0311)L41.CB (T0311)M66.CB 8.8303 14.7172 19.1324 35.8393 Constraint (T0311)A38.CB (T0311)M66.CB 10.1453 16.9088 21.9815 35.8393 Constraint (T0311)I33.CB (T0311)M66.CB 11.3191 18.8651 24.5247 35.8393 Constraint (T0311)F27.CB (T0311)M66.CB 9.2756 15.4593 20.0971 35.8393 Constraint (T0311)L24.CB (T0311)M66.CB 11.1281 18.5469 24.1110 35.8393 Constraint (T0311)S23.CB (T0311)M66.CB 12.2417 20.4028 26.5236 35.8393 Constraint (T0311)V22.CB (T0311)M66.CB 9.5868 15.9780 20.7714 35.8393 Constraint (T0311)N21.CB (T0311)M66.CB 11.2426 18.7376 24.3589 35.8393 Constraint (T0311)D18.CB (T0311)M66.CB 9.6697 16.1161 20.9509 35.8393 Constraint (T0311)L17.CB (T0311)M66.CB 8.0762 13.4604 17.4985 35.8393 Constraint (T0311)Q14.CB (T0311)M66.CB 8.4042 14.0069 18.2090 35.8393 Constraint (T0311)S39.CB (T0311)S63.CB 12.3744 20.6240 26.8112 35.4881 Constraint (T0311)L42.CB (T0311)M66.CB 9.2373 15.3956 20.0142 35.4650 Constraint (T0311)Q14.CB (T0311)W67.CB 7.5170 12.5284 16.2869 35.2873 Constraint (T0311)S57.CB (T0311)W67.CB 3.8470 6.4117 8.3353 35.0892 Constraint (T0311)M31.CB (T0311)M66.CB 9.8362 16.3937 21.3118 34.8937 Constraint (T0311)A28.CB (T0311)M66.CB 11.5067 19.1778 24.9312 34.8393 Constraint (T0311)A46.CB (T0311)M66.CB 10.8369 18.0615 23.4800 34.7624 Constraint (T0311)R40.CB (T0311)W67.CB 9.6451 16.0751 20.8977 34.5847 Constraint (T0311)S39.CB (T0311)W67.CB 9.9232 16.5386 21.5002 34.5847 Constraint (T0311)S36.CB (T0311)W67.CB 11.9950 19.9916 25.9891 34.2847 Constraint (T0311)T43.CB (T0311)W67.CB 9.5340 15.8899 20.6569 34.2104 Constraint (T0311)L42.CB (T0311)W67.CB 7.5274 12.5456 16.3093 34.2104 Constraint (T0311)R40.CB (T0311)M66.CB 11.5821 19.3035 25.0946 34.0189 Constraint (T0311)K55.CB (T0311)W67.CB 7.0239 11.7065 15.2184 33.9940 Constraint (T0311)A47.CB (T0311)W67.CB 7.7876 12.9794 16.8732 33.9104 Constraint (T0311)A46.CB (T0311)W67.CB 8.6333 14.3889 18.7056 33.9104 Constraint (T0311)K45.CB (T0311)W67.CB 9.7541 16.2568 21.1339 33.9104 Constraint (T0311)I13.CB (T0311)M66.CB 6.2320 10.3866 13.5026 33.7461 Constraint (T0311)I12.CB (T0311)M66.CB 4.9699 8.2832 10.7682 33.7461 Constraint (T0311)A38.CB (T0311)W67.CB 8.1406 13.5677 17.6380 33.5683 Constraint (T0311)L24.CB (T0311)W67.CB 9.6988 16.1646 21.0140 33.5683 Constraint (T0311)D18.CB (T0311)W67.CB 9.2074 15.3457 19.9494 33.5683 Constraint (T0311)L17.CB (T0311)W67.CB 7.2034 12.0057 15.6074 33.5683 Constraint (T0311)T43.CB (T0311)S63.CB 12.8104 21.3507 27.7560 33.4147 Constraint (T0311)A53.CB (T0311)W67.CB 4.3069 7.1782 9.3317 33.4007 Constraint (T0311)T37.CB (T0311)W67.CB 9.6524 16.0874 20.9136 33.2683 Constraint (T0311)P35.CB (T0311)W67.CB 11.3520 18.9201 24.5961 33.2683 Constraint (T0311)A34.CB (T0311)W67.CB 11.6308 19.3846 25.2000 33.2683 Constraint (T0311)I33.CB (T0311)W67.CB 9.1312 15.2186 19.7842 33.2683 Constraint (T0311)F27.CB (T0311)W67.CB 7.7693 12.9488 16.8334 33.2683 Constraint (T0311)S23.CB (T0311)W67.CB 11.1670 18.6117 24.1953 33.2683 Constraint (T0311)V22.CB (T0311)W67.CB 8.8371 14.7286 19.1471 33.2683 Constraint (T0311)E26.CB (T0311)M66.CB 11.6791 19.4651 25.3046 33.1810 Constraint (T0311)L20.CB (T0311)M66.CB 8.5995 14.3325 18.6322 33.1810 Constraint (T0311)E19.CB (T0311)M66.CB 8.2411 13.7351 17.8556 33.1810 Constraint (T0311)S16.CB (T0311)M66.CB 5.9363 9.8939 12.8620 33.1810 Constraint (T0311)E15.CB (T0311)M66.CB 7.4445 12.4075 16.1298 33.1810 Constraint (T0311)S39.CB (T0311)M66.CB 11.5236 19.2060 24.9678 33.0025 Constraint (T0311)T37.CB (T0311)M66.CB 11.6829 19.4714 25.3129 33.0025 Constraint (T0311)I54.CB (T0311)W67.CB 5.8939 9.8232 12.7701 32.9959 Constraint (T0311)R25.CB (T0311)P50.CB 13.2494 22.0823 28.7071 32.6834 Constraint (T0311)I13.CB (T0311)W67.CB 4.9496 8.2493 10.7241 32.4914 Constraint (T0311)N21.CB (T0311)W67.CB 11.0396 18.3993 23.9192 32.3539 Constraint (T0311)M31.CB (T0311)W67.CB 7.8539 13.0898 17.0168 32.3228 Constraint (T0311)A28.CB (T0311)W67.CB 9.6131 16.0219 20.8285 32.2683 Constraint (T0311)A30.CB (T0311)M66.CB 10.9223 18.2039 23.6651 32.2355 Constraint (T0311)A47.CB (T0311)M66.CB 9.9365 16.5608 21.5291 32.1914 Constraint (T0311)I12.CB (T0311)W67.CB 4.3372 7.2287 9.3973 31.4751 Constraint (T0311)E19.CB (T0311)W67.CB 8.5171 14.1952 18.4538 30.9101 Constraint (T0311)S16.CB (T0311)W67.CB 5.6618 9.4364 12.2673 30.9101 Constraint (T0311)E15.CB (T0311)W67.CB 7.1270 11.8783 15.4418 30.9101 Constraint (T0311)A30.CB (T0311)W67.CB 9.4917 15.8195 20.5654 30.6101 Constraint (T0311)E26.CB (T0311)W67.CB 10.5072 17.5119 22.7655 30.6101 Constraint (T0311)R25.CB (T0311)W67.CB 11.8200 19.7001 25.6101 30.6101 Constraint (T0311)L20.CB (T0311)W67.CB 8.3831 13.9718 18.1633 30.6101 Constraint (T0311)D11.CB (T0311)W67.CB 7.3447 12.2411 15.9135 30.2864 Constraint (T0311)K45.CB (T0311)M66.CB 11.5470 19.2449 25.0184 29.6282 Constraint (T0311)R29.CB (T0311)W67.CB 11.2439 18.7399 24.3619 29.6101 Constraint (T0311)A53.CB (T0311)L68.CB 5.6741 9.4569 12.2939 28.8394 Constraint (T0311)D11.CB (T0311)M66.CB 7.7295 12.8825 16.7473 28.4674 Constraint (T0311)V58.CB (T0311)L68.CB 8.5289 14.2149 18.4794 28.4346 Constraint (T0311)S57.CB (T0311)L68.CB 6.0819 10.1365 13.1774 28.4346 Constraint (T0311)L56.CB (T0311)L68.CB 7.0818 11.8030 15.3440 28.4346 Constraint (T0311)K55.CB (T0311)L68.CB 8.7219 14.5364 18.8973 28.4346 Constraint (T0311)I54.CB (T0311)L68.CB 7.3345 12.2241 15.8914 28.4346 Constraint (T0311)E32.CB (T0311)W67.CB 10.1070 16.8450 21.8985 28.3384 Constraint (T0311)E32.CB (T0311)M66.CB 11.8966 19.8276 25.7759 28.3384 Constraint (T0311)E32.CB (T0311)Q65.CB 12.3468 20.5780 26.7514 27.7578 Constraint (T0311)V59.CB (T0311)L68.CB 9.2661 15.4435 20.0766 27.1012 Constraint (T0311)K45.CB (T0311)L68.CB 10.4940 17.4901 22.7371 27.0175 Constraint (T0311)T43.CB (T0311)L68.CB 10.8681 18.1135 23.5475 26.9321 Constraint (T0311)L42.CB (T0311)L68.CB 9.3713 15.6189 20.3045 26.9321 Constraint (T0311)R40.CB (T0311)L68.CB 11.0549 18.4248 23.9522 26.9321 Constraint (T0311)S39.CB (T0311)L68.CB 12.0574 20.0956 26.1243 26.9321 Constraint (T0311)I13.CB (T0311)L68.CB 7.4098 12.3496 16.0545 26.9321 Constraint (T0311)M52.CB (T0311)M66.CB 9.2176 15.3627 19.9715 26.9251 Constraint (T0311)E51.CB (T0311)M66.CB 10.2864 17.1441 22.2873 26.9251 Constraint (T0311)R29.CB (T0311)M66.CB 12.6155 21.0258 27.3336 26.7734 Constraint (T0311)K45.CB (T0311)S63.CB 12.6827 21.1378 27.4791 26.6616 Constraint (T0311)A47.CB (T0311)L68.CB 7.4355 12.3925 16.1103 26.6321 Constraint (T0311)A46.CB (T0311)L68.CB 9.1362 15.2270 19.7950 26.6321 Constraint (T0311)L41.CB (T0311)L68.CB 8.0955 13.4924 17.5402 25.9157 Constraint (T0311)L17.CB (T0311)L68.CB 10.0337 16.7228 21.7396 25.9157 Constraint (T0311)Q14.CB (T0311)L68.CB 9.7464 16.2440 21.1171 25.9157 Constraint (T0311)I12.CB (T0311)L68.CB 6.2836 10.4726 13.6144 25.9157 Constraint (T0311)A38.CB (T0311)L68.CB 10.2725 17.1208 22.2571 25.6157 Constraint (T0311)T37.CB (T0311)L68.CB 11.1223 18.5371 24.0982 25.6157 Constraint (T0311)I33.CB (T0311)L68.CB 10.8489 18.0815 23.5060 25.6157 Constraint (T0311)A28.CB (T0311)L68.CB 11.7482 19.5803 25.4544 25.6157 Constraint (T0311)F27.CB (T0311)L68.CB 10.3287 17.2146 22.3789 25.6157 Constraint (T0311)L24.CB (T0311)L68.CB 12.2529 20.4215 26.5480 25.6157 Constraint (T0311)V22.CB (T0311)L68.CB 11.7124 19.5206 25.3768 25.6157 Constraint (T0311)D11.CB (T0311)L68.CB 8.5629 14.2715 18.5530 24.8061 Constraint (T0311)D18.CB (T0311)T49.CB 13.1802 21.9671 28.5572 24.7698 Constraint (T0311)M31.CB (T0311)L68.CB 9.5691 15.9485 20.7331 24.6701 Constraint (T0311)M52.CB (T0311)W67.CB 7.0998 11.8330 15.3829 24.6542 Constraint (T0311)N21.CB (T0311)Q65.CB 12.6819 21.1366 27.4776 24.6513 Constraint (T0311)P50.CB (T0311)M66.CB 8.8019 14.6699 19.0709 24.2082 Constraint (T0311)M52.CB (T0311)L68.CB 8.3280 13.8800 18.0441 23.9909 Constraint (T0311)E51.CB (T0311)W67.CB 8.1745 13.6242 17.7114 23.6561 Constraint (T0311)P50.CB (T0311)W67.CB 7.0754 11.7923 15.3300 23.3561 Constraint (T0311)T49.CB (T0311)W67.CB 8.0856 13.4760 17.5189 23.3561 Constraint (T0311)L48.CB (T0311)W67.CB 6.1352 10.2254 13.2930 23.3561 Constraint (T0311)L48.CB (T0311)M66.CB 8.6107 14.3511 18.6564 23.3561 Constraint (T0311)S16.CB (T0311)L68.CB 8.0239 13.3732 17.3851 23.2575 Constraint (T0311)A30.CB (T0311)L68.CB 11.5683 19.2805 25.0647 22.9575 Constraint (T0311)L20.CB (T0311)L68.CB 10.9896 18.3159 23.8107 22.9575 Constraint (T0311)E19.CB (T0311)L68.CB 10.9258 18.2097 23.6726 22.9575 Constraint (T0311)E15.CB (T0311)L68.CB 9.2882 15.4803 20.1244 22.9575 Constraint (T0311)E19.CB (T0311)P50.CB 13.3012 22.1686 28.8192 22.8176 Constraint (T0311)E32.CB (T0311)L68.CB 11.7979 19.6632 25.5622 22.7790 Constraint (T0311)L48.CB (T0311)L68.CB 7.2980 12.1633 15.8122 22.6928 Constraint (T0311)S39.CB (T0311)E80.CB 10.5282 17.5470 22.8111 22.4960 Constraint (T0311)T37.CB (T0311)E80.CB 11.0582 18.4303 23.9594 22.4960 Constraint (T0311)R40.CB (T0311)V83.CB 11.7870 19.6451 25.5386 22.2816 Constraint (T0311)E51.CB (T0311)L68.CB 8.7524 14.5873 18.9635 22.2720 Constraint (T0311)A77.CB (T0311)S86.CB 9.1543 15.2572 19.8343 22.1681 Constraint (T0311)E19.CB (T0311)A47.CB 12.9231 21.5385 28.0001 21.8877 Constraint (T0311)L20.CB (T0311)A47.CB 12.8676 21.4461 27.8799 21.8766 Constraint (T0311)P35.CB (T0311)M66.CB 12.4726 20.7877 27.0240 21.7734 Constraint (T0311)R40.CB (T0311)E80.CB 10.0979 16.8298 21.8788 21.6864 Constraint (T0311)T49.CB (T0311)M66.CB 10.1745 16.9575 22.0448 21.6372 Constraint (T0311)K45.CB (T0311)E80.CB 10.1820 16.9700 22.0610 21.6182 Constraint (T0311)R40.CB (T0311)A79.CB 9.9391 16.5652 21.5347 21.5191 Constraint (T0311)P50.CB (T0311)L68.CB 6.5415 10.9024 14.1732 20.9739 Constraint (T0311)T49.CB (T0311)L68.CB 8.0745 13.4574 17.4947 20.9739 Constraint (T0311)K45.CB (T0311)A79.CB 10.4321 17.3869 22.6029 20.8779 Constraint (T0311)R40.CB (T0311)E78.CB 11.2349 18.7249 24.3424 20.7095 Constraint (T0311)A79.CB (T0311)L88.CB 8.7114 14.5190 18.8747 20.5939 Constraint (T0311)E78.CB (T0311)L88.CB 10.2185 17.0308 22.1400 20.5939 Constraint (T0311)S39.CB (T0311)A79.CB 10.2331 17.0552 22.1718 20.5191 Constraint (T0311)S36.CB (T0311)A79.CB 10.9385 18.2308 23.7001 20.5191 Constraint (T0311)T37.CB (T0311)A79.CB 10.3337 17.2229 22.3898 20.5028 Constraint (T0311)T43.CB (T0311)E80.CB 10.3223 17.2039 22.3650 20.4722 Constraint (T0311)A53.CB (T0311)N69.CB 7.7079 12.8466 16.7005 20.1813 Constraint (T0311)L24.CB (T0311)A79.CB 10.4120 17.3533 22.5593 20.1695 Constraint (T0311)K45.CB (T0311)E78.CB 11.2387 18.7312 24.3506 20.0683 Constraint (T0311)K45.CB (T0311)V83.CB 12.3430 20.5717 26.7432 20.0511 Constraint (T0311)D18.CB (T0311)L68.CB 11.3254 18.8756 24.5383 20.0427 Constraint (T0311)E26.CB (T0311)L68.CB 12.8655 21.4424 27.8752 19.9575 Constraint (T0311)L42.CB (T0311)A77.CB 10.3380 17.2300 22.3990 19.7964 Constraint (T0311)L41.CB (T0311)A77.CB 10.4687 17.4478 22.6821 19.7964 Constraint (T0311)V58.CB (T0311)N69.CB 9.4198 15.6997 20.4096 19.7765 Constraint (T0311)S57.CB (T0311)N69.CB 7.2462 12.0770 15.7002 19.7765 Constraint (T0311)L56.CB (T0311)N69.CB 8.1571 13.5952 17.6738 19.7765 Constraint (T0311)K55.CB (T0311)N69.CB 10.0121 16.6868 21.6928 19.7765 Constraint (T0311)I54.CB (T0311)N69.CB 9.1835 15.3058 19.8975 19.7765 Constraint (T0311)T43.CB (T0311)A79.CB 10.6309 17.7182 23.0336 19.7319 Constraint (T0311)A46.CB (T0311)E80.CB 11.4230 19.0384 24.7499 19.6220 Constraint (T0311)E78.CB (T0311)R87.CB 8.7449 14.5748 18.9472 19.6092 Constraint (T0311)S57.CB (T0311)K81.CB 8.3493 13.9155 18.0901 19.6041 Constraint (T0311)L41.CB (T0311)K81.CB 9.8528 16.4214 21.3478 19.5612 Constraint (T0311)S39.CB (T0311)E78.CB 11.7834 19.6390 25.5307 19.5028 Constraint (T0311)P35.CB (T0311)A79.CB 11.0643 18.4405 23.9726 19.5028 Constraint (T0311)A34.CB (T0311)A79.CB 11.4013 19.0022 24.7028 19.5028 Constraint (T0311)D18.CB (T0311)N69.CB 11.5624 19.2707 25.0519 19.2575 Constraint (T0311)A77.CB (T0311)R87.CB 8.9355 14.8925 19.3603 19.2044 Constraint (T0311)I60.CB (T0311)N69.CB 8.1411 13.5686 17.6391 19.1430 Constraint (T0311)D18.CB (T0311)P50.CB 13.1711 21.9518 28.5373 19.1348 Constraint (T0311)W74.CB (T0311)V83.CB 8.9025 14.8374 19.2887 19.1335 Constraint (T0311)L20.CB (T0311)N69.CB 10.9351 18.2252 23.6928 18.9575 Constraint (T0311)E19.CB (T0311)N69.CB 10.3043 17.1738 22.3260 18.9575 Constraint (T0311)S16.CB (T0311)N69.CB 8.1566 13.5944 17.6727 18.9575 Constraint (T0311)E15.CB (T0311)N69.CB 8.9751 14.9585 19.4460 18.9575 Constraint (T0311)A73.CB (T0311)T82.CB 8.9926 14.9877 19.4840 18.9450 Constraint (T0311)L41.CB (T0311)T82.CB 9.7387 16.2311 21.1004 18.8945 Constraint (T0311)I33.CB (T0311)T82.CB 11.0107 18.3512 23.8566 18.8945 Constraint (T0311)L56.CB (T0311)E80.CB 7.9846 13.3077 17.3000 18.7622 Constraint (T0311)S57.CB (T0311)E80.CB 7.1281 11.8801 15.4442 18.6163 Constraint (T0311)K45.CB (T0311)K81.CB 11.7276 19.5460 25.4097 18.5993 Constraint (T0311)E80.CB (T0311)R89.CB 8.8484 14.7473 19.1714 18.5958 Constraint (T0311)L41.CB (T0311)E80.CB 8.1735 13.6225 17.7093 18.5897 Constraint (T0311)M31.CB (T0311)T82.CB 9.4218 15.7030 20.4139 18.5734 Constraint (T0311)L42.CB (T0311)K81.CB 9.8319 16.3865 21.3025 18.5612 Constraint (T0311)S36.CB (T0311)E80.CB 10.8801 18.1335 23.5736 18.5057 Constraint (T0311)V59.CB (T0311)N69.CB 9.7372 16.2286 21.0972 18.4430 Constraint (T0311)T43.CB (T0311)N69.CB 10.9825 18.3041 23.7953 18.2739 Constraint (T0311)I12.CB (T0311)N69.CB 6.4977 10.8294 14.0782 18.2576 Constraint (T0311)A77.CB (T0311)L88.CB 10.1257 16.8762 21.9390 18.2044 Constraint (T0311)A73.CB (T0311)V83.CB 9.5688 15.9480 20.7324 18.1354 Constraint (T0311)N72.CB (T0311)K81.CB 9.8143 16.3572 21.2643 18.1064 Constraint (T0311)A46.CB (T0311)A79.CB 11.1078 18.5130 24.0669 18.0721 Constraint (T0311)E26.CB (T0311)Q65.CB 12.8607 21.4345 27.8649 18.0315 Constraint (T0311)M52.CB (T0311)L70.CB 8.2761 13.7935 17.9315 17.9910 Constraint (T0311)M52.CB (T0311)N69.CB 9.7159 16.1932 21.0512 17.9910 Constraint (T0311)R40.CB (T0311)A77.CB 10.6361 17.7268 23.0448 17.9868 Constraint (T0311)A47.CB (T0311)N69.CB 9.0944 15.1573 19.7045 17.9739 Constraint (T0311)A46.CB (T0311)N69.CB 10.3360 17.2267 22.3947 17.9739 Constraint (T0311)T43.CB (T0311)E78.CB 11.2657 18.7762 24.4091 17.9060 Constraint (T0311)L42.CB (T0311)T82.CB 10.0690 16.7817 21.8162 17.8945 Constraint (T0311)A38.CB (T0311)T82.CB 10.4067 17.3445 22.5479 17.8945 Constraint (T0311)T37.CB (T0311)T82.CB 11.5879 19.3132 25.1072 17.8945 Constraint (T0311)L17.CB (T0311)L76.CB 10.9549 18.2581 23.7356 17.8926 Constraint (T0311)M31.CB (T0311)V83.CB 9.0233 15.0389 19.5506 17.7638 Constraint (T0311)L48.CB (T0311)K81.CB 10.2204 17.0340 22.1442 17.7035 Constraint (T0311)L42.CB (T0311)E80.CB 7.7365 12.8941 16.7624 17.5897 Constraint (T0311)A38.CB (T0311)E80.CB 8.7427 14.5711 18.9424 17.5897 Constraint (T0311)M31.CB (T0311)K81.CB 10.1015 16.8358 21.8866 17.5734 Constraint (T0311)M31.CB (T0311)E80.CB 8.6366 14.3944 18.7127 17.5734 Constraint (T0311)R40.CB (T0311)T82.CB 11.6812 19.4686 25.3092 17.4897 Constraint (T0311)V59.CB (T0311)E80.CB 9.3996 15.6659 20.3657 17.4422 Constraint (T0311)I54.CB (T0311)K81.CB 8.4900 14.1500 18.3950 17.3945 Constraint (T0311)R25.CB (T0311)M66.CB 12.5564 20.9273 27.2055 17.3497 Constraint (T0311)S39.CB (T0311)Q65.CB 11.6278 19.3797 25.1936 17.3478 Constraint (T0311)L42.CB (T0311)N69.CB 9.3391 15.5651 20.2347 17.2576 Constraint (T0311)L41.CB (T0311)N69.CB 8.9063 14.8438 19.2970 17.2576 Constraint (T0311)L17.CB (T0311)N69.CB 9.8873 16.4788 21.4224 17.2576 Constraint (T0311)Q14.CB (T0311)N69.CB 9.5172 15.8620 20.6206 17.2576 Constraint (T0311)I13.CB (T0311)N69.CB 7.3610 12.2683 15.9488 17.2576 Constraint (T0311)S57.CB (T0311)A79.CB 7.7872 12.9787 16.8724 17.2123 Constraint (T0311)L56.CB (T0311)A79.CB 7.9854 13.3090 17.3017 17.2123 Constraint (T0311)D11.CB (T0311)N69.CB 8.5077 14.1796 18.4334 17.1480 Constraint (T0311)I60.CB (T0311)L70.CB 7.0542 11.7571 15.2842 17.1430 Constraint (T0311)K55.CB (T0311)E80.CB 8.9286 14.8809 19.3452 17.1288 Constraint (T0311)E32.CB (T0311)V83.CB 10.9824 18.3040 23.7952 17.0970 Constraint (T0311)A53.CB (T0311)E80.CB 7.8869 13.1448 17.0882 17.0310 Constraint (T0311)A79.CB (T0311)R89.CB 9.3539 15.5898 20.2667 17.0305 Constraint (T0311)E78.CB (T0311)R89.CB 10.9436 18.2393 23.7111 17.0305 Constraint (T0311)E51.CB (T0311)L70.CB 9.7017 16.1696 21.0205 16.9929 Constraint (T0311)S57.CB (T0311)V83.CB 7.8946 13.1576 17.1049 16.9828 Constraint (T0311)S57.CB (T0311)T82.CB 8.1931 13.6551 17.7516 16.9828 Constraint (T0311)I54.CB (T0311)V83.CB 8.4019 14.0032 18.2042 16.9796 Constraint (T0311)I54.CB (T0311)E80.CB 7.6994 12.8324 16.6821 16.9674 Constraint (T0311)N72.CB (T0311)T82.CB 9.5665 15.9442 20.7275 16.9604 Constraint (T0311)A38.CB (T0311)N69.CB 10.9197 18.1994 23.6593 16.9576 Constraint (T0311)F27.CB (T0311)N69.CB 10.5300 17.5499 22.8149 16.9576 Constraint (T0311)V22.CB (T0311)N69.CB 11.4806 19.1343 24.8746 16.9576 Constraint (T0311)L76.CB (T0311)V85.CB 9.3108 15.5180 20.1734 16.9280 Constraint (T0311)Q14.CB (T0311)A77.CB 10.7740 17.9567 23.3437 16.9163 Constraint (T0311)Q14.CB (T0311)L76.CB 10.5388 17.5647 22.8341 16.8926 Constraint (T0311)I13.CB (T0311)A73.CB 10.8556 18.0927 23.5205 16.8692 Constraint (T0311)I12.CB (T0311)A73.CB 10.1596 16.9326 22.0124 16.8692 Constraint (T0311)D18.CB (T0311)E51.CB 12.8259 21.3764 27.7894 16.8021 Constraint (T0311)P35.CB (T0311)L68.CB 13.2257 22.0428 28.6556 16.7790 Constraint (T0311)A34.CB (T0311)L68.CB 12.6911 21.1518 27.4973 16.7790 Constraint (T0311)S57.CB (T0311)L70.CB 6.3192 10.5321 13.6917 16.7785 Constraint (T0311)V58.CB (T0311)L70.CB 8.1334 13.5556 17.6223 16.7766 Constraint (T0311)L56.CB (T0311)L70.CB 6.4765 10.7942 14.0325 16.7766 Constraint (T0311)K55.CB (T0311)L70.CB 8.3640 13.9399 18.1219 16.7766 Constraint (T0311)M52.CB (T0311)K81.CB 9.9363 16.5605 21.5286 16.7157 Constraint (T0311)P50.CB (T0311)L70.CB 8.8291 14.7151 19.1296 16.6929 Constraint (T0311)T49.CB (T0311)L70.CB 9.3052 15.5087 20.1613 16.6929 Constraint (T0311)L48.CB (T0311)L70.CB 7.0837 11.8062 15.3481 16.6929 Constraint (T0311)L48.CB (T0311)N69.CB 8.7918 14.6531 19.0490 16.6929 Constraint (T0311)A47.CB (T0311)L70.CB 8.9288 14.8813 19.3456 16.6929 Constraint (T0311)L41.CB (T0311)V83.CB 9.2193 15.3654 19.9751 16.6922 Constraint (T0311)K45.CB (T0311)A77.CB 9.9603 16.6004 21.5806 16.6788 Constraint (T0311)L42.CB (T0311)A79.CB 8.3087 13.8479 18.0022 16.6128 Constraint (T0311)L41.CB (T0311)A79.CB 7.8217 13.0362 16.9471 16.6128 Constraint (T0311)A30.CB (T0311)E80.CB 8.8848 14.8080 19.2503 16.5734 Constraint (T0311)F27.CB (T0311)E80.CB 7.5631 12.6051 16.3866 16.5734 Constraint (T0311)P50.CB (T0311)E80.CB 9.0867 15.1446 19.6879 16.5697 Constraint (T0311)F27.CB (T0311)T82.CB 8.9443 14.9071 19.3793 16.5650 Constraint (T0311)M31.CB (T0311)A77.CB 11.4252 19.0420 24.7546 16.5404 Constraint (T0311)L76.CB (T0311)S86.CB 9.2492 15.4154 20.0400 16.5232 Constraint (T0311)A46.CB (T0311)K81.CB 12.6799 21.1332 27.4731 16.4638 Constraint (T0311)V58.CB (T0311)Q71.CB 9.4256 15.7094 20.4222 16.4600 Constraint (T0311)S57.CB (T0311)Q71.CB 7.7074 12.8457 16.6994 16.4600 Constraint (T0311)L56.CB (T0311)Q71.CB 7.6597 12.7662 16.5960 16.4600 Constraint (T0311)A34.CB (T0311)M66.CB 12.7720 21.2867 27.6727 16.4369 Constraint (T0311)I12.CB (T0311)A77.CB 10.3016 17.1693 22.3201 16.4202 Constraint (T0311)A46.CB (T0311)A77.CB 11.6872 19.4787 25.3223 16.3494 Constraint (T0311)V58.CB (T0311)K81.CB 9.5852 15.9753 20.7679 16.3317 Constraint (T0311)L56.CB (T0311)A77.CB 9.8878 16.4797 21.4236 16.3209 Constraint (T0311)S36.CB (T0311)V83.CB 11.7425 19.5708 25.4420 16.2951 Constraint (T0311)E51.CB (T0311)N69.CB 10.4957 17.4928 22.7406 16.2721 Constraint (T0311)L56.CB (T0311)K81.CB 8.6089 14.3481 18.6526 16.2707 Constraint (T0311)D18.CB (T0311)L70.CB 9.8926 16.4876 21.4339 16.2576 Constraint (T0311)S16.CB (T0311)L70.CB 6.8485 11.4141 14.8383 16.2576 Constraint (T0311)I12.CB (T0311)L70.CB 6.2807 10.4678 13.6081 16.2576 Constraint (T0311)S39.CB (T0311)L76.CB 9.2637 15.4395 20.0713 16.2447 Constraint (T0311)V58.CB (T0311)A79.CB 9.6742 16.1237 20.9608 16.2258 Constraint (T0311)A53.CB (T0311)L70.CB 6.1439 10.2399 13.3119 16.1833 Constraint (T0311)A53.CB (T0311)V83.CB 8.8259 14.7098 19.1228 16.1803 Constraint (T0311)N72.CB (T0311)V83.CB 10.1305 16.8842 21.9494 16.1508 Constraint (T0311)P50.CB (T0311)Q71.CB 8.3140 13.8567 18.0138 16.1199 Constraint (T0311)L48.CB (T0311)Q71.CB 7.6282 12.7137 16.5278 16.1199 Constraint (T0311)L41.CB (T0311)A73.CB 10.7530 17.9217 23.2982 16.1103 Constraint (T0311)S16.CB (T0311)A73.CB 10.7090 17.8484 23.2029 16.1093 Constraint (T0311)L42.CB (T0311)V83.CB 9.3098 15.5163 20.1712 16.0970 Constraint (T0311)A38.CB (T0311)V83.CB 9.4809 15.8015 20.5419 16.0970 Constraint (T0311)Q65.CB (T0311)A77.CB 8.2043 13.6738 17.7759 16.0787 Constraint (T0311)S75.CB (T0311)D84.CB 9.4461 15.7434 20.4665 16.0630 Constraint (T0311)I60.CB (T0311)A79.CB 9.4101 15.6835 20.3885 16.0188 Constraint (T0311)M31.CB (T0311)N69.CB 10.5365 17.5609 22.8291 16.0120 Constraint (T0311)L56.CB (T0311)V83.CB 7.9346 13.2244 17.1917 15.9810 Constraint (T0311)L56.CB (T0311)T82.CB 8.2539 13.7566 17.8836 15.9707 Constraint (T0311)I54.CB (T0311)T82.CB 8.0884 13.4807 17.5249 15.9675 Constraint (T0311)L20.CB (T0311)L70.CB 9.1895 15.3158 19.9106 15.9576 Constraint (T0311)E19.CB (T0311)L70.CB 8.7471 14.5785 18.9521 15.9576 Constraint (T0311)E15.CB (T0311)L70.CB 7.7239 12.8731 16.7350 15.9576 Constraint (T0311)I33.CB (T0311)E80.CB 9.6819 16.1365 20.9774 15.9067 Constraint (T0311)E32.CB (T0311)E80.CB 11.0549 18.4248 23.9522 15.9067 Constraint (T0311)I12.CB (T0311)N72.CB 11.1652 18.6086 24.1912 15.8528 Constraint (T0311)M31.CB (T0311)D84.CB 11.4922 19.1537 24.8998 15.7792 Constraint (T0311)I54.CB (T0311)L70.CB 7.8596 13.0993 17.0291 15.7785 Constraint (T0311)M52.CB (T0311)E80.CB 8.5989 14.3315 18.6310 15.7157 Constraint (T0311)T49.CB (T0311)E80.CB 9.7947 16.3245 21.2219 15.7157 Constraint (T0311)L48.CB (T0311)E80.CB 8.6068 14.3447 18.6482 15.7157 Constraint (T0311)T43.CB (T0311)T82.CB 11.9764 19.9607 25.9490 15.7025 Constraint (T0311)T37.CB (T0311)V83.CB 10.7623 17.9371 23.3182 15.6922 Constraint (T0311)I33.CB (T0311)V83.CB 9.9962 16.6603 21.6584 15.6922 Constraint (T0311)T43.CB (T0311)L70.CB 9.2373 15.3955 20.0142 15.6594 Constraint (T0311)L42.CB (T0311)E78.CB 9.3256 15.5426 20.2054 15.5965 Constraint (T0311)L41.CB (T0311)E78.CB 8.8199 14.6999 19.1099 15.5965 Constraint (T0311)A38.CB (T0311)A79.CB 8.3183 13.8638 18.0229 15.5965 Constraint (T0311)A38.CB (T0311)E78.CB 10.3458 17.2430 22.4160 15.5965 Constraint (T0311)E32.CB (T0311)A79.CB 10.1236 16.8726 21.9344 15.5965 Constraint (T0311)M31.CB (T0311)A79.CB 7.5999 12.6665 16.4665 15.5965 Constraint (T0311)A30.CB (T0311)A79.CB 8.4685 14.1141 18.3483 15.5965 Constraint (T0311)F27.CB (T0311)A79.CB 7.7694 12.9489 16.8336 15.5965 Constraint (T0311)F27.CB (T0311)E78.CB 10.1280 16.8800 21.9440 15.5965 Constraint (T0311)A30.CB (T0311)T82.CB 8.3532 13.9220 18.0986 15.5772 Constraint (T0311)A53.CB (T0311)K81.CB 8.4536 14.0893 18.3161 15.5729 Constraint (T0311)M52.CB (T0311)T82.CB 9.3348 15.5581 20.2255 15.5698 Constraint (T0311)F27.CB (T0311)L76.CB 10.3971 17.3285 22.5271 15.4686 Constraint (T0311)I60.CB (T0311)E80.CB 9.5855 15.9758 20.7685 15.4458 Constraint (T0311)V59.CB (T0311)L70.CB 7.7984 12.9974 16.8966 15.4431 Constraint (T0311)A46.CB (T0311)L70.CB 9.0060 15.0101 19.5131 15.3594 Constraint (T0311)K45.CB (T0311)L70.CB 9.3942 15.6569 20.3540 15.3594 Constraint (T0311)K45.CB (T0311)N69.CB 10.5566 17.5943 22.8725 15.3594 Constraint (T0311)V58.CB (T0311)E80.CB 8.5781 14.2969 18.5859 15.3317 Constraint (T0311)E80.CB (T0311)R90.CB 9.0795 15.1325 19.6723 15.3198 Constraint (T0311)L17.CB (T0311)L70.CB 8.2133 13.6888 17.7955 15.2576 Constraint (T0311)Q14.CB (T0311)L70.CB 8.2261 13.7102 17.8232 15.2576 Constraint (T0311)I13.CB (T0311)L70.CB 6.3068 10.5113 13.6647 15.2576 Constraint (T0311)D11.CB (T0311)A73.CB 10.0591 16.7652 21.7947 15.2480 Constraint (T0311)L20.CB (T0311)Q71.CB 10.3889 17.3149 22.5093 15.2141 Constraint (T0311)S16.CB (T0311)Q71.CB 8.9867 14.9779 19.4712 15.2141 Constraint (T0311)E15.CB (T0311)Q71.CB 10.0197 16.6995 21.7093 15.2141 Constraint (T0311)T43.CB (T0311)A77.CB 10.0478 16.7463 21.7702 15.1833 Constraint (T0311)S57.CB (T0311)A77.CB 8.6699 14.4498 18.7848 15.1750 Constraint (T0311)M52.CB (T0311)V83.CB 9.1778 15.2963 19.8852 15.1649 Constraint (T0311)V59.CB (T0311)Q71.CB 9.4885 15.8142 20.5584 15.1266 Constraint (T0311)L48.CB (T0311)A73.CB 11.0006 18.3344 23.8347 15.1265 Constraint (T0311)L41.CB (T0311)D84.CB 11.0223 18.3706 23.8818 15.1124 Constraint (T0311)L17.CB (T0311)A73.CB 10.4955 17.4925 22.7402 15.1093 Constraint (T0311)E15.CB (T0311)A73.CB 10.0527 16.7545 21.7809 15.1093 Constraint (T0311)Q14.CB (T0311)A73.CB 9.6469 16.0781 20.9015 15.1093 Constraint (T0311)S16.CB (T0311)N72.CB 10.8962 18.1603 23.6084 15.1093 Constraint (T0311)E15.CB (T0311)N72.CB 10.7460 17.9100 23.2830 15.1093 Constraint (T0311)K45.CB (T0311)D84.CB 12.2182 20.3637 26.4728 15.0761 Constraint (T0311)S57.CB (T0311)E78.CB 8.1776 13.6294 17.7182 15.0664 Constraint (T0311)A47.CB (T0311)E80.CB 10.2712 17.1187 22.2543 15.0490 Constraint (T0311)I60.CB (T0311)E78.CB 10.7855 17.9759 23.3687 15.0207 Constraint (T0311)E51.CB (T0311)T82.CB 9.4434 15.7390 20.4608 14.9968 Constraint (T0311)E51.CB (T0311)K81.CB 9.8574 16.4290 21.3577 14.9968 Constraint (T0311)P50.CB (T0311)T82.CB 8.9083 14.8472 19.3013 14.9968 Constraint (T0311)P50.CB (T0311)K81.CB 8.9109 14.8515 19.3070 14.9968 Constraint (T0311)S16.CB (T0311)A79.CB 9.9457 16.5761 21.5490 14.9882 Constraint (T0311)E15.CB (T0311)A79.CB 10.6916 17.8193 23.1651 14.9882 Constraint (T0311)V59.CB (T0311)A77.CB 10.8861 18.1434 23.5865 14.9875 Constraint (T0311)K55.CB (T0311)V83.CB 8.3711 13.9518 18.1374 14.9829 Constraint (T0311)K55.CB (T0311)T82.CB 8.4467 14.0778 18.3012 14.9829 Constraint (T0311)K55.CB (T0311)K81.CB 9.1612 15.2686 19.8492 14.9829 Constraint (T0311)S57.CB (T0311)D84.CB 9.4955 15.8258 20.5735 14.9819 Constraint (T0311)P50.CB (T0311)N69.CB 8.8709 14.7849 19.2203 14.9740 Constraint (T0311)T49.CB (T0311)N69.CB 10.0444 16.7407 21.7629 14.9740 Constraint (T0311)V22.CB (T0311)L70.CB 9.5555 15.9258 20.7035 14.9576 Constraint (T0311)N21.CB (T0311)L70.CB 11.4675 19.1125 24.8463 14.9576 Constraint (T0311)T37.CB (T0311)E78.CB 11.2429 18.7382 24.3596 14.9297 Constraint (T0311)I33.CB (T0311)A79.CB 8.8011 14.6685 19.0690 14.9297 Constraint (T0311)I33.CB (T0311)E78.CB 10.9929 18.3216 23.8180 14.9297 Constraint (T0311)V59.CB (T0311)A79.CB 9.3721 15.6201 20.3062 14.8923 Constraint (T0311)Q65.CB (T0311)T82.CB 8.8945 14.8242 19.2715 14.8834 Constraint (T0311)L48.CB (T0311)T82.CB 9.7774 16.2957 21.1844 14.8745 Constraint (T0311)S62.CB (T0311)Q71.CB 7.6448 12.7413 16.5637 14.8285 Constraint (T0311)I60.CB (T0311)Q71.CB 8.2008 13.6680 17.7684 14.8266 Constraint (T0311)F27.CB (T0311)A73.CB 11.6345 19.3908 25.2081 14.7939 Constraint (T0311)A47.CB (T0311)Q71.CB 7.6256 12.7094 16.5222 14.7865 Constraint (T0311)A30.CB (T0311)V83.CB 7.9896 13.3160 17.3108 14.7676 Constraint (T0311)F27.CB (T0311)V83.CB 7.7496 12.9159 16.7907 14.7676 Constraint (T0311)I54.CB (T0311)E78.CB 8.3841 13.9735 18.1656 14.7632 Constraint (T0311)P64.CB (T0311)A79.CB 7.4371 12.3952 16.1137 14.6947 Constraint (T0311)A77.CB (T0311)R89.CB 11.4059 19.0099 24.7128 14.6411 Constraint (T0311)V22.CB (T0311)E80.CB 9.4504 15.7507 20.4759 14.6195 Constraint (T0311)M31.CB (T0311)E78.CB 9.4913 15.8189 20.5645 14.6087 Constraint (T0311)T49.CB (T0311)K81.CB 10.1402 16.9003 21.9704 14.5920 Constraint (T0311)A53.CB (T0311)T82.CB 8.4315 14.0525 18.2683 14.5851 Constraint (T0311)M52.CB (T0311)Q71.CB 7.9246 13.2077 17.1701 14.5813 Constraint (T0311)I54.CB (T0311)A79.CB 7.3729 12.2881 15.9746 14.5757 Constraint (T0311)F27.CB (T0311)K81.CB 8.7762 14.6270 19.0152 14.5708 Constraint (T0311)L76.CB (T0311)L88.CB 10.6306 17.7177 23.0330 14.5473 Constraint (T0311)L76.CB (T0311)R87.CB 8.6652 14.4421 18.7747 14.5473 Constraint (T0311)I33.CB (T0311)S86.CB 12.9702 21.6170 28.1021 14.5326 Constraint (T0311)E80.CB (T0311)L91.CB 9.3650 15.6083 20.2908 14.5241 Constraint (T0311)L17.CB (T0311)Q71.CB 9.5955 15.9925 20.7902 14.5141 Constraint (T0311)Q14.CB (T0311)Q71.CB 9.8798 16.4664 21.4063 14.5141 Constraint (T0311)T49.CB (T0311)V83.CB 10.0653 16.7756 21.8082 14.4982 Constraint (T0311)L48.CB (T0311)V83.CB 9.5964 15.9940 20.7922 14.4982 Constraint (T0311)A38.CB (T0311)A73.CB 11.4804 19.1340 24.8742 14.4768 Constraint (T0311)P64.CB (T0311)K81.CB 8.2658 13.7764 17.9093 14.4580 Constraint (T0311)S39.CB (T0311)S75.CB 11.0333 18.3889 23.9056 14.4576 Constraint (T0311)L42.CB (T0311)L76.CB 8.7492 14.5821 18.9567 14.4515 Constraint (T0311)S75.CB (T0311)S86.CB 10.3486 17.2477 22.4220 14.3312 Constraint (T0311)S75.CB (T0311)V85.CB 10.6618 17.7697 23.1006 14.3312 Constraint (T0311)Q65.CB (T0311)A79.CB 7.5757 12.6262 16.4141 14.3104 Constraint (T0311)Q65.CB (T0311)E78.CB 8.3863 13.9772 18.1704 14.3104 Constraint (T0311)S36.CB (T0311)E78.CB 12.1504 20.2507 26.3260 14.2980 Constraint (T0311)L42.CB (T0311)L70.CB 7.1983 11.9972 15.5964 14.2577 Constraint (T0311)L41.CB (T0311)L70.CB 7.1047 11.8412 15.3936 14.2577 Constraint (T0311)D11.CB (T0311)L70.CB 7.9754 13.2923 17.2799 14.2480 Constraint (T0311)L41.CB (T0311)Q71.CB 8.2903 13.8171 17.9623 14.2305 Constraint (T0311)L24.CB (T0311)L76.CB 9.5486 15.9143 20.6886 14.2284 Constraint (T0311)V22.CB (T0311)Q71.CB 10.5836 17.6394 22.9312 14.2141 Constraint (T0311)L56.CB (T0311)E78.CB 8.6077 14.3461 18.6499 14.2124 Constraint (T0311)S36.CB (T0311)L68.CB 13.1542 21.9237 28.5008 14.2058 Constraint (T0311)A53.CB (T0311)A79.CB 7.4234 12.3723 16.0840 14.1811 Constraint (T0311)A53.CB (T0311)D84.CB 10.3080 17.1800 22.3340 14.1793 Constraint (T0311)L41.CB (T0311)L76.CB 8.6309 14.3848 18.7003 14.1515 Constraint (T0311)R40.CB (T0311)L76.CB 8.2862 13.8103 17.9534 14.1515 Constraint (T0311)A38.CB (T0311)L76.CB 9.4198 15.6996 20.4095 14.1515 Constraint (T0311)T37.CB (T0311)L76.CB 9.5679 15.9465 20.7305 14.1515 Constraint (T0311)D11.CB (T0311)Q71.CB 10.5873 17.6455 22.9392 14.1480 Constraint (T0311)L41.CB (T0311)S86.CB 11.1977 18.6629 24.2617 14.1278 Constraint (T0311)L41.CB (T0311)V85.CB 11.7130 19.5217 25.3782 14.1278 Constraint (T0311)A30.CB (T0311)N69.CB 11.8459 19.7432 25.6662 14.1209 Constraint (T0311)V83.CB (T0311)V92.CB 9.2504 15.4174 20.0426 14.1193 Constraint (T0311)D18.CB (T0311)A73.CB 10.5029 17.5048 22.7562 14.1093 Constraint (T0311)D18.CB (T0311)N72.CB 10.6226 17.7043 23.0155 14.1093 Constraint (T0311)L17.CB (T0311)N72.CB 10.2932 17.1554 22.3020 14.1093 Constraint (T0311)R25.CB (T0311)S63.CB 12.3094 20.5156 26.6703 14.0980 Constraint (T0311)W74.CB (T0311)D84.CB 9.7273 16.2122 21.0759 14.0803 Constraint (T0311)Q65.CB (T0311)K81.CB 7.8772 13.1287 17.0673 14.0738 Constraint (T0311)Q65.CB (T0311)E80.CB 6.7485 11.2474 14.6217 14.0737 Constraint (T0311)P64.CB (T0311)A77.CB 7.5790 12.6317 16.4212 14.0310 Constraint (T0311)I60.CB (T0311)A77.CB 9.8309 16.3849 21.3004 14.0207 Constraint (T0311)L42.CB (T0311)A73.CB 10.3093 17.1821 22.3368 14.0171 Constraint (T0311)V58.CB (T0311)V83.CB 8.5678 14.2797 18.5636 14.0104 Constraint (T0311)S39.CB (T0311)A77.CB 10.4363 17.3938 22.6119 13.9964 Constraint (T0311)T37.CB (T0311)A77.CB 11.7216 19.5359 25.3967 13.9964 Constraint (T0311)V59.CB (T0311)V83.CB 8.3425 13.9041 18.0753 13.9964 Constraint (T0311)V59.CB (T0311)T82.CB 8.7069 14.5115 18.8649 13.9964 Constraint (T0311)S16.CB (T0311)E80.CB 9.4237 15.7062 20.4181 13.9882 Constraint (T0311)S16.CB (T0311)E78.CB 11.4410 19.0683 24.7888 13.9882 Constraint (T0311)E15.CB (T0311)E80.CB 9.9752 16.6254 21.6130 13.9882 Constraint (T0311)L76.CB (T0311)R89.CB 11.6617 19.4362 25.2671 13.9744 Constraint (T0311)V22.CB (T0311)A79.CB 9.7447 16.2412 21.1135 13.9645 Constraint (T0311)A38.CB (T0311)L70.CB 8.6168 14.3614 18.6698 13.9577 Constraint (T0311)A28.CB (T0311)L70.CB 9.9474 16.5790 21.5527 13.9577 Constraint (T0311)F27.CB (T0311)L70.CB 8.2399 13.7332 17.8532 13.9577 Constraint (T0311)E26.CB (T0311)L70.CB 10.7902 17.9837 23.3788 13.9577 Constraint (T0311)L24.CB (T0311)L70.CB 10.0727 16.7878 21.8241 13.9577 Constraint (T0311)S23.CB (T0311)L70.CB 11.4980 19.1633 24.9122 13.9577 Constraint (T0311)T49.CB (T0311)T82.CB 9.5684 15.9474 20.7316 13.9252 Constraint (T0311)T43.CB (T0311)V83.CB 11.2269 18.7115 24.3250 13.9051 Constraint (T0311)A38.CB (T0311)K81.CB 9.8006 16.3344 21.2347 13.9041 Constraint (T0311)P64.CB (T0311)A73.CB 9.4384 15.7306 20.4498 13.8999 Constraint (T0311)Q65.CB (T0311)L76.CB 9.2552 15.4253 20.0528 13.8979 Constraint (T0311)L20.CB (T0311)A77.CB 11.6444 19.4072 25.2294 13.8894 Constraint (T0311)S16.CB (T0311)A77.CB 10.0991 16.8318 21.8814 13.8834 Constraint (T0311)I13.CB (T0311)L76.CB 11.6093 19.3488 25.1534 13.8195 Constraint (T0311)V22.CB (T0311)A73.CB 11.7967 19.6611 25.5595 13.8093 Constraint (T0311)V22.CB (T0311)N72.CB 11.3834 18.9723 24.6640 13.8093 Constraint (T0311)P35.CB (T0311)A77.CB 12.2330 20.3883 26.5048 13.7897 Constraint (T0311)L24.CB (T0311)A77.CB 10.9830 18.3050 23.7965 13.7897 Constraint (T0311)R40.CB (T0311)K81.CB 11.1905 18.6508 24.2460 13.7060 Constraint (T0311)P64.CB (T0311)E78.CB 8.2010 13.6684 17.7689 13.6947 Constraint (T0311)E15.CB (T0311)A77.CB 10.1712 16.9520 22.0375 13.6767 Constraint (T0311)I12.CB (T0311)E80.CB 9.1245 15.2075 19.7697 13.6547 Constraint (T0311)I12.CB (T0311)A79.CB 9.0955 15.1592 19.7069 13.6547 Constraint (T0311)R40.CB (T0311)L70.CB 9.6246 16.0410 20.8533 13.6405 Constraint (T0311)S39.CB (T0311)L70.CB 9.8484 16.4140 21.3382 13.6405 Constraint (T0311)A28.CB (T0311)A79.CB 8.9165 14.8608 19.3191 13.5965 Constraint (T0311)E51.CB (T0311)Q71.CB 8.8459 14.7432 19.1662 13.5832 Constraint (T0311)E51.CB (T0311)E80.CB 9.0811 15.1352 19.6757 13.5820 Constraint (T0311)M31.CB (T0311)S86.CB 12.1144 20.1906 26.2478 13.5403 Constraint (T0311)S39.CB (T0311)K81.CB 11.0447 18.4079 23.9303 13.5156 Constraint (T0311)E51.CB (T0311)V83.CB 9.2479 15.4132 20.0372 13.5104 Constraint (T0311)P50.CB (T0311)V83.CB 8.7775 14.6292 19.0179 13.5104 Constraint (T0311)K45.CB (T0311)L76.CB 8.4320 14.0533 18.2693 13.5103 Constraint (T0311)K45.CB (T0311)S75.CB 9.8836 16.4727 21.4145 13.5103 Constraint (T0311)A47.CB (T0311)K81.CB 11.1100 18.5167 24.0718 13.4868 Constraint (T0311)S63.CB (T0311)K81.CB 8.6182 14.3636 18.6727 13.4600 Constraint (T0311)S62.CB (T0311)T82.CB 9.9427 16.5711 21.5425 13.4600 Constraint (T0311)S62.CB (T0311)K81.CB 9.5140 15.8566 20.6136 13.4600 Constraint (T0311)S63.CB (T0311)E80.CB 7.0189 11.6982 15.2077 13.4599 Constraint (T0311)S62.CB (T0311)E80.CB 7.6768 12.7947 16.6331 13.4599 Constraint (T0311)P64.CB (T0311)E80.CB 6.4674 10.7790 14.0127 13.4581 Constraint (T0311)L24.CB (T0311)S75.CB 11.3972 18.9953 24.6939 13.4412 Constraint (T0311)I13.CB (T0311)Q71.CB 8.3444 13.9073 18.0796 13.4372 Constraint (T0311)I60.CB (T0311)K81.CB 10.1772 16.9620 22.0506 13.4356 Constraint (T0311)A53.CB (T0311)A77.CB 9.0798 15.1329 19.6728 13.4252 Constraint (T0311)I54.CB (T0311)D84.CB 9.8075 16.3458 21.2495 13.4134 Constraint (T0311)K55.CB (T0311)Q71.CB 8.4974 14.1624 18.4111 13.3668 Constraint (T0311)A47.CB (T0311)A73.CB 11.6023 19.3371 25.1383 13.3663 Constraint (T0311)I60.CB (T0311)V83.CB 9.4586 15.7643 20.4936 13.3526 Constraint (T0311)K81.CB (T0311)R90.CB 9.0677 15.1128 19.6466 13.3429 Constraint (T0311)W74.CB (T0311)S86.CB 11.0077 18.3462 23.8500 13.3331 Constraint (T0311)W74.CB (T0311)V85.CB 10.7905 17.9842 23.3795 13.3331 Constraint (T0311)S36.CB (T0311)A77.CB 11.3247 18.8746 24.5369 13.3297 Constraint (T0311)L20.CB (T0311)A79.CB 11.2726 18.7876 24.4239 13.2981 Constraint (T0311)T49.CB (T0311)Q71.CB 7.8170 13.0284 16.9369 13.2832 Constraint (T0311)K55.CB (T0311)A77.CB 10.6185 17.6975 23.0067 13.2399 Constraint (T0311)A38.CB (T0311)Q71.CB 9.2625 15.4375 20.0687 13.2141 Constraint (T0311)M31.CB (T0311)Q71.CB 9.2245 15.3742 19.9865 13.2141 Constraint (T0311)A30.CB (T0311)Q71.CB 10.7610 17.9351 23.3156 13.2141 Constraint (T0311)A28.CB (T0311)Q71.CB 10.7989 17.9981 23.3975 13.2141 Constraint (T0311)F27.CB (T0311)Q71.CB 9.4999 15.8332 20.5832 13.2141 Constraint (T0311)E26.CB (T0311)Q71.CB 11.8797 19.7995 25.7394 13.2141 Constraint (T0311)L24.CB (T0311)Q71.CB 10.9075 18.1791 23.6328 13.2141 Constraint (T0311)S23.CB (T0311)Q71.CB 12.4592 20.7654 26.9950 13.2141 Constraint (T0311)M52.CB (T0311)A79.CB 7.1972 11.9953 15.5938 13.1658 Constraint (T0311)L48.CB (T0311)A79.CB 7.4140 12.3566 16.0636 13.1658 Constraint (T0311)L48.CB (T0311)E78.CB 8.5323 14.2204 18.4866 13.1658 Constraint (T0311)N21.CB (T0311)K45.CB 12.3501 20.5835 26.7585 13.1525 Constraint (T0311)P35.CB (T0311)L76.CB 9.8947 16.4912 21.4385 13.1515 Constraint (T0311)A34.CB (T0311)L76.CB 10.4491 17.4152 22.6397 13.1515 Constraint (T0311)A73.CB (T0311)V85.CB 11.9275 19.8792 25.8429 13.1447 Constraint (T0311)I33.CB (T0311)L76.CB 10.4995 17.4992 22.7490 13.1352 Constraint (T0311)L56.CB (T0311)S86.CB 10.7461 17.9101 23.2832 13.1279 Constraint (T0311)E32.CB (T0311)T82.CB 9.8221 16.3702 21.2812 13.1233 Constraint (T0311)E80.CB (T0311)V92.CB 10.0427 16.7378 21.7591 13.1193 Constraint (T0311)Q14.CB (T0311)N72.CB 9.6040 16.0066 20.8086 13.1093 Constraint (T0311)S63.CB (T0311)A73.CB 9.6978 16.1631 21.0120 13.0922 Constraint (T0311)A73.CB (T0311)D84.CB 10.3674 17.2791 22.4628 13.0822 Constraint (T0311)I54.CB (T0311)A77.CB 8.7087 14.5145 18.8688 13.0786 Constraint (T0311)M31.CB (T0311)L70.CB 8.4930 14.1550 18.4015 13.0121 Constraint (T0311)V58.CB (T0311)T82.CB 8.2642 13.7737 17.9059 12.9983 Constraint (T0311)L56.CB (T0311)D84.CB 9.8818 16.4697 21.4106 12.9820 Constraint (T0311)K55.CB (T0311)D84.CB 11.1329 18.5548 24.1212 12.9820 Constraint (T0311)L17.CB (T0311)A77.CB 10.5412 17.5687 22.8393 12.9767 Constraint (T0311)Q71.CB (T0311)K81.CB 9.8472 16.4120 21.3356 12.9381 Constraint (T0311)Q71.CB (T0311)E80.CB 9.1177 15.1962 19.7550 12.9381 Constraint (T0311)P35.CB (T0311)E80.CB 9.8000 16.3334 21.2334 12.9326 Constraint (T0311)A34.CB (T0311)E80.CB 10.8634 18.1057 23.5374 12.9326 Constraint (T0311)K55.CB (T0311)E78.CB 8.9651 14.9418 19.4243 12.9246 Constraint (T0311)K45.CB (T0311)T82.CB 11.7612 19.6020 25.4827 12.9168 Constraint (T0311)A34.CB (T0311)S63.CB 12.8994 21.4989 27.9486 12.9030 Constraint (T0311)R40.CB (T0311)Q71.CB 10.1075 16.8458 21.8996 12.8970 Constraint (T0311)S39.CB (T0311)Q71.CB 10.4422 17.4037 22.6249 12.8970 Constraint (T0311)M66.CB (T0311)A77.CB 10.3309 17.2181 22.3836 12.8966 Constraint (T0311)S63.CB (T0311)A79.CB 7.4765 12.4608 16.1991 12.8870 Constraint (T0311)S63.CB (T0311)E78.CB 8.4205 14.0342 18.2445 12.8870 Constraint (T0311)S63.CB (T0311)A77.CB 7.4890 12.4817 16.2262 12.8870 Constraint (T0311)S62.CB (T0311)A79.CB 7.6621 12.7702 16.6012 12.8870 Constraint (T0311)S62.CB (T0311)E78.CB 8.9158 14.8596 19.3175 12.8870 Constraint (T0311)S62.CB (T0311)A77.CB 8.1022 13.5037 17.5548 12.8870 Constraint (T0311)I12.CB (T0311)V83.CB 10.0525 16.7542 21.7804 12.8451 Constraint (T0311)D11.CB (T0311)A77.CB 11.4869 19.1448 24.8882 12.8264 Constraint (T0311)L41.CB (T0311)N72.CB 11.6426 19.4043 25.2256 12.8093 Constraint (T0311)A38.CB (T0311)N72.CB 11.9083 19.8472 25.8014 12.8093 Constraint (T0311)F27.CB (T0311)N72.CB 11.5410 19.2350 25.0055 12.8093 Constraint (T0311)Q14.CB (T0311)S75.CB 11.3617 18.9362 24.6171 12.8055 Constraint (T0311)I33.CB (T0311)N69.CB 11.4290 19.0484 24.7629 12.7874 Constraint (T0311)A53.CB (T0311)Q71.CB 5.6763 9.4606 12.2987 12.7736 Constraint (T0311)S75.CB (T0311)R87.CB 10.2943 17.1572 22.3043 12.7602 Constraint (T0311)E15.CB (T0311)E78.CB 11.4564 19.0940 24.8222 12.7480 Constraint (T0311)S39.CB (T0311)V83.CB 10.1452 16.9086 21.9812 12.7182 Constraint (T0311)L41.CB (T0311)R87.CB 11.6057 19.3428 25.1457 12.7149 Constraint (T0311)T43.CB (T0311)A73.CB 9.5280 15.8800 20.6440 12.6836 Constraint (T0311)K45.CB (T0311)R87.CB 11.4022 19.0036 24.7047 12.6786 Constraint (T0311)S57.CB (T0311)L76.CB 9.2353 15.3922 20.0099 12.6741 Constraint (T0311)T37.CB (T0311)L70.CB 9.9992 16.6653 21.6649 12.6242 Constraint (T0311)I33.CB (T0311)L70.CB 9.4968 15.8281 20.5765 12.6242 Constraint (T0311)R25.CB (T0311)L70.CB 11.9172 19.8621 25.8207 12.6242 Constraint (T0311)E26.CB (T0311)A79.CB 8.8127 14.6878 19.0942 12.6003 Constraint (T0311)A28.CB (T0311)E80.CB 8.5875 14.3125 18.6063 12.5830 Constraint (T0311)L24.CB (T0311)E80.CB 7.8804 13.1339 17.0741 12.5830 Constraint (T0311)K55.CB (T0311)A79.CB 7.2328 12.0547 15.6711 12.5790 Constraint (T0311)T82.CB (T0311)L91.CB 8.9501 14.9168 19.3918 12.5471 Constraint (T0311)K81.CB (T0311)L91.CB 9.9468 16.5780 21.5515 12.5471 Constraint (T0311)E19.CB (T0311)N72.CB 10.1170 16.8616 21.9201 12.5360 Constraint (T0311)R40.CB (T0311)D84.CB 12.1773 20.2955 26.3841 12.5070 Constraint (T0311)A47.CB (T0311)A79.CB 8.9191 14.8652 19.3248 12.4991 Constraint (T0311)A46.CB (T0311)E78.CB 11.2266 18.7109 24.3242 12.4991 Constraint (T0311)L48.CB (T0311)D84.CB 11.0265 18.3775 23.8908 12.4973 Constraint (T0311)S39.CB (T0311)W74.CB 11.6198 19.3663 25.1762 12.4749 Constraint (T0311)L42.CB (T0311)Q71.CB 8.8336 14.7227 19.1396 12.4373 Constraint (T0311)A46.CB (T0311)A73.CB 10.9991 18.3318 23.8314 12.3836 Constraint (T0311)I54.CB (T0311)Q71.CB 7.5619 12.6031 16.3840 12.3688 Constraint (T0311)P64.CB (T0311)V83.CB 6.3294 10.5490 13.7137 12.3648 Constraint (T0311)P64.CB (T0311)T82.CB 7.6586 12.7644 16.5937 12.3648 Constraint (T0311)T43.CB (T0311)L76.CB 8.8205 14.7009 19.1111 12.3643 Constraint (T0311)S36.CB (T0311)L76.CB 8.6264 14.3773 18.6905 12.3419 Constraint (T0311)I60.CB (T0311)T82.CB 9.5390 15.8983 20.6678 12.3405 Constraint (T0311)V59.CB (T0311)K81.CB 9.0458 15.0763 19.5991 12.2983 Constraint (T0311)L17.CB (T0311)A79.CB 10.3100 17.1833 22.3383 12.2883 Constraint (T0311)T43.CB (T0311)Q71.CB 9.7432 16.2387 21.1103 12.2497 Constraint (T0311)A30.CB (T0311)S86.CB 12.4628 20.7714 27.0028 12.2154 Constraint (T0311)A38.CB (T0311)A77.CB 10.3233 17.2054 22.3670 12.2070 Constraint (T0311)F27.CB (T0311)A77.CB 9.9963 16.6606 21.6587 12.2070 Constraint (T0311)L20.CB (T0311)E80.CB 11.1835 18.6392 24.2310 12.2010 Constraint (T0311)W67.CB (T0311)A77.CB 9.9498 16.5830 21.5579 12.1966 Constraint (T0311)M52.CB (T0311)E78.CB 8.0289 13.3816 17.3960 12.1780 Constraint (T0311)E51.CB (T0311)A79.CB 7.8218 13.0363 16.9472 12.1780 Constraint (T0311)P50.CB (T0311)A79.CB 7.4276 12.3793 16.0931 12.1780 Constraint (T0311)T49.CB (T0311)A79.CB 7.7233 12.8721 16.7338 12.1780 Constraint (T0311)T49.CB (T0311)E78.CB 8.5642 14.2737 18.5558 12.1780 Constraint (T0311)A47.CB (T0311)E78.CB 9.5777 15.9629 20.7517 12.1780 Constraint (T0311)M52.CB (T0311)D84.CB 11.2500 18.7499 24.3749 12.1717 Constraint (T0311)L56.CB (T0311)V85.CB 11.0699 18.4498 23.9848 12.1401 Constraint (T0311)A28.CB (T0311)L76.CB 10.1621 16.9369 22.0179 12.1352 Constraint (T0311)R25.CB (T0311)L76.CB 10.8878 18.1464 23.5903 12.1352 Constraint (T0311)S23.CB (T0311)L76.CB 10.7877 17.9795 23.3733 12.1352 Constraint (T0311)I12.CB (T0311)Q71.CB 7.6065 12.6775 16.4808 12.1209 Constraint (T0311)R40.CB (T0311)R87.CB 12.0449 20.0748 26.0972 12.1056 Constraint (T0311)A28.CB (T0311)V83.CB 9.1772 15.2954 19.8840 12.1009 Constraint (T0311)V58.CB (T0311)E78.CB 9.8723 16.4538 21.3899 12.0940 Constraint (T0311)V58.CB (T0311)A77.CB 9.4456 15.7426 20.4654 12.0940 Constraint (T0311)E15.CB (T0311)L76.CB 9.9127 16.5211 21.4775 12.0195 Constraint (T0311)Q65.CB (T0311)V83.CB 6.9556 11.5927 15.0705 11.9805 Constraint (T0311)A46.CB (T0311)Q71.CB 7.9169 13.1948 17.1532 11.9497 Constraint (T0311)K45.CB (T0311)Q71.CB 8.9078 14.8463 19.3002 11.9497 Constraint (T0311)S39.CB (T0311)T82.CB 10.8742 18.1236 23.5607 11.9080 Constraint (T0311)Q65.CB (T0311)W74.CB 10.3642 17.2736 22.4557 11.8999 Constraint (T0311)M66.CB (T0311)L76.CB 9.4558 15.7597 20.4876 11.8998 Constraint (T0311)V58.CB (T0311)A73.CB 10.5589 17.5982 22.8776 11.8870 Constraint (T0311)S57.CB (T0311)A73.CB 9.3843 15.6405 20.3327 11.8870 Constraint (T0311)L56.CB (T0311)A73.CB 9.6090 16.0151 20.8196 11.8870 Constraint (T0311)T37.CB (T0311)Q71.CB 10.2701 17.1168 22.2519 11.8807 Constraint (T0311)S36.CB (T0311)Q71.CB 12.3592 20.5986 26.7782 11.8807 Constraint (T0311)P35.CB (T0311)Q71.CB 11.9191 19.8652 25.8248 11.8807 Constraint (T0311)I33.CB (T0311)Q71.CB 9.9573 16.5955 21.5742 11.8807 Constraint (T0311)S16.CB (T0311)V83.CB 10.8195 18.0324 23.4422 11.8451 Constraint (T0311)E15.CB (T0311)V83.CB 11.1217 18.5361 24.0969 11.8451 Constraint (T0311)I12.CB (T0311)D84.CB 11.2683 18.7806 24.4147 11.8451 Constraint (T0311)V22.CB (T0311)V83.CB 9.2597 15.4328 20.0626 11.8138 Constraint (T0311)Q71.CB (T0311)T82.CB 9.4050 15.6749 20.3774 11.7922 Constraint (T0311)S23.CB (T0311)S75.CB 12.7680 21.2800 27.6640 11.7786 Constraint (T0311)A79.CB (T0311)R90.CB 8.1006 13.5011 17.5514 11.7699 Constraint (T0311)E78.CB (T0311)R90.CB 10.3053 17.1755 22.3281 11.7699 Constraint (T0311)Q14.CB (T0311)E78.CB 10.8313 18.0522 23.4679 11.7481 Constraint (T0311)P35.CB (T0311)S63.CB 11.8586 19.7643 25.6936 11.6902 Constraint (T0311)I12.CB (T0311)E78.CB 10.1100 16.8500 21.9049 11.6548 Constraint (T0311)R29.CB (T0311)A79.CB 9.1606 15.2677 19.8481 11.6003 Constraint (T0311)A73.CB (T0311)S86.CB 11.6952 19.4920 25.3397 11.5939 Constraint (T0311)E26.CB (T0311)T82.CB 7.7405 12.9008 16.7710 11.5747 Constraint (T0311)E26.CB (T0311)K81.CB 8.9274 14.8790 19.3426 11.5747 Constraint (T0311)L56.CB (T0311)R87.CB 10.7607 17.9344 23.3147 11.5671 Constraint (T0311)T43.CB (T0311)S75.CB 9.8049 16.3414 21.2439 11.5547 Constraint (T0311)R40.CB (T0311)S75.CB 9.6532 16.0886 20.9152 11.5547 Constraint (T0311)S36.CB (T0311)S75.CB 10.6712 17.7853 23.1209 11.5547 Constraint (T0311)A79.CB (T0311)V92.CB 10.3428 17.2380 22.4094 11.5540 Constraint (T0311)K45.CB (T0311)N72.CB 11.0129 18.3549 23.8613 11.5449 Constraint (T0311)K45.CB (T0311)W74.CB 9.9264 16.5439 21.5071 11.5276 Constraint (T0311)A46.CB (T0311)S75.CB 11.8041 19.6735 25.5755 11.5141 Constraint (T0311)S36.CB (T0311)D84.CB 12.4119 20.6865 26.8925 11.5070 Constraint (T0311)E19.CB (T0311)E80.CB 9.6569 16.0949 20.9234 11.4953 Constraint (T0311)E19.CB (T0311)A79.CB 9.9110 16.5183 21.4738 11.4953 Constraint (T0311)R40.CB (T0311)A73.CB 9.2562 15.4270 20.0551 11.4768 Constraint (T0311)R40.CB (T0311)N72.CB 11.2377 18.7296 24.3484 11.4759 Constraint (T0311)N69.CB (T0311)E80.CB 10.5757 17.6261 22.9139 11.4179 Constraint (T0311)S63.CB (T0311)V83.CB 7.1949 11.9915 15.5889 11.3667 Constraint (T0311)S63.CB (T0311)T82.CB 8.3958 13.9930 18.1910 11.3667 Constraint (T0311)S62.CB (T0311)V83.CB 8.1717 13.6195 17.7053 11.3667 Constraint (T0311)A77.CB (T0311)R90.CB 11.2104 18.6840 24.2892 11.3651 Constraint (T0311)L42.CB (T0311)S75.CB 10.6182 17.6969 23.0060 11.3480 Constraint (T0311)W67.CB (T0311)E80.CB 9.0141 15.0235 19.5305 11.3376 Constraint (T0311)N21.CB (T0311)L76.CB 10.5183 17.5306 22.7897 11.3195 Constraint (T0311)D18.CB (T0311)L76.CB 9.7336 16.2226 21.0894 11.3195 Constraint (T0311)V85.CB (T0311)Q94.CB 9.3572 15.5954 20.2740 11.2921 Constraint (T0311)I60.CB (T0311)A73.CB 9.4205 15.7008 20.4110 11.2535 Constraint (T0311)K55.CB (T0311)V85.CB 12.1190 20.1983 26.2578 11.1478 Constraint (T0311)T82.CB (T0311)V92.CB 9.7306 16.2177 21.0830 11.1424 Constraint (T0311)K81.CB (T0311)V92.CB 10.6989 17.8316 23.1810 11.1424 Constraint (T0311)L42.CB (T0311)D84.CB 9.5662 15.9436 20.7267 11.1221 Constraint (T0311)E32.CB (T0311)Q71.CB 10.9940 18.3233 23.8203 11.1209 Constraint (T0311)A30.CB (T0311)L70.CB 9.6193 16.0321 20.8418 11.1209 Constraint (T0311)R29.CB (T0311)L70.CB 11.1112 18.5186 24.0742 11.1209 Constraint (T0311)L24.CB (T0311)N69.CB 11.5960 19.3267 25.1248 11.1209 Constraint (T0311)R40.CB (T0311)N69.CB 10.3143 17.1905 22.3477 11.1209 Constraint (T0311)S39.CB (T0311)N69.CB 11.1482 18.5803 24.1543 11.1209 Constraint (T0311)T37.CB (T0311)N69.CB 10.9329 18.2215 23.6880 11.1209 Constraint (T0311)R29.CB (T0311)L68.CB 12.5180 20.8634 27.1224 11.1209 Constraint (T0311)I33.CB (T0311)K81.CB 10.2395 17.0658 22.1856 11.1169 Constraint (T0311)N72.CB (T0311)D84.CB 11.7886 19.6476 25.5419 11.0976 Constraint (T0311)E19.CB (T0311)A77.CB 9.5613 15.9356 20.7162 11.0905 Constraint (T0311)A46.CB (T0311)V85.CB 12.6776 21.1293 27.4680 11.0856 Constraint (T0311)Q65.CB (T0311)S75.CB 8.8899 14.8165 19.2615 11.0612 Constraint (T0311)I60.CB (T0311)L76.CB 9.0564 15.0939 19.6221 11.0406 Constraint (T0311)E51.CB (T0311)E78.CB 8.0749 13.4581 17.4955 11.0321 Constraint (T0311)P50.CB (T0311)E78.CB 7.3083 12.1805 15.8347 11.0321 Constraint (T0311)V22.CB (T0311)L76.CB 10.5753 17.6255 22.9132 11.0196 Constraint (T0311)L42.CB (T0311)N72.CB 10.7233 17.8722 23.2339 11.0161 Constraint (T0311)I13.CB (T0311)N72.CB 10.0514 16.7523 21.7779 11.0161 Constraint (T0311)Q71.CB (T0311)V83.CB 10.3678 17.2796 22.4635 10.9826 Constraint (T0311)P50.CB (T0311)A73.CB 10.5172 17.5286 22.7872 10.9808 Constraint (T0311)T49.CB (T0311)A73.CB 11.3886 18.9811 24.6754 10.9808 Constraint (T0311)A79.CB (T0311)L91.CB 8.8331 14.7219 19.1384 10.9742 Constraint (T0311)E78.CB (T0311)L91.CB 11.1939 18.6566 24.2535 10.9742 Constraint (T0311)A28.CB (T0311)N69.CB 11.2027 18.6711 24.2725 10.9577 Constraint (T0311)E26.CB (T0311)N69.CB 12.2648 20.4413 26.5736 10.9577 Constraint (T0311)L17.CB (T0311)E80.CB 9.7902 16.3171 21.2122 10.9548 Constraint (T0311)I12.CB (T0311)L76.CB 9.4413 15.7354 20.4561 10.9426 Constraint (T0311)P35.CB (T0311)T82.CB 10.5830 17.6383 22.9297 10.9080 Constraint (T0311)A28.CB (T0311)T82.CB 8.9790 14.9650 19.4545 10.9080 Constraint (T0311)A28.CB (T0311)K81.CB 9.8747 16.4578 21.3952 10.9080 Constraint (T0311)R25.CB (T0311)T82.CB 9.5682 15.9471 20.7312 10.9080 Constraint (T0311)R25.CB (T0311)K81.CB 10.6724 17.7874 23.1236 10.9080 Constraint (T0311)L24.CB (T0311)T82.CB 9.0126 15.0209 19.5272 10.9080 Constraint (T0311)L24.CB (T0311)K81.CB 9.3178 15.5297 20.1886 10.9080 Constraint (T0311)S23.CB (T0311)T82.CB 8.7922 14.6537 19.0499 10.9080 Constraint (T0311)S23.CB (T0311)K81.CB 9.5235 15.8726 20.6343 10.9080 Constraint (T0311)T43.CB (T0311)K81.CB 10.2666 17.1109 22.2442 10.9025 Constraint (T0311)V59.CB (T0311)E78.CB 10.3524 17.2540 22.4302 10.8943 Constraint (T0311)V83.CB (T0311)T93.CB 9.2426 15.4043 20.0256 10.8873 Constraint (T0311)E80.CB (T0311)T93.CB 10.5990 17.6650 22.9644 10.8873 Constraint (T0311)A79.CB (T0311)T93.CB 10.7977 17.9961 23.3949 10.8873 Constraint (T0311)S57.CB (T0311)N72.CB 9.6504 16.0840 20.9091 10.8870 Constraint (T0311)P9.CB (T0311)W67.CB 4.6451 7.7418 10.0643 10.8517 Constraint (T0311)P9.CB (T0311)I60.CB 7.3304 12.2173 15.8825 10.8517 Constraint (T0311)P9.CB (T0311)V59.CB 9.0541 15.0901 19.6171 10.8517 Constraint (T0311)P9.CB (T0311)V58.CB 9.4363 15.7272 20.4454 10.8517 Constraint (T0311)P9.CB (T0311)S57.CB 6.6776 11.1293 14.4681 10.8517 Constraint (T0311)P9.CB (T0311)L56.CB 6.0061 10.0102 13.0133 10.8517 Constraint (T0311)P9.CB (T0311)K55.CB 8.4085 14.0141 18.2183 10.8517 Constraint (T0311)P9.CB (T0311)I54.CB 7.6934 12.8223 16.6689 10.8517 Constraint (T0311)P9.CB (T0311)A53.CB 4.7829 7.9715 10.3630 10.8517 Constraint (T0311)P9.CB (T0311)A47.CB 5.0228 8.3713 10.8827 10.8517 Constraint (T0311)P9.CB (T0311)A46.CB 6.1440 10.2400 13.3120 10.8517 Constraint (T0311)P9.CB (T0311)K45.CB 6.7715 11.2859 14.6717 10.8517 Constraint (T0311)P9.CB (T0311)T43.CB 6.8116 11.3527 14.7585 10.8517 Constraint (T0311)P9.CB (T0311)L42.CB 5.5476 9.2459 12.0197 10.8517 Constraint (T0311)P9.CB (T0311)L41.CB 4.4409 7.4015 9.6219 10.8517 Constraint (T0311)P9.CB (T0311)R40.CB 7.0130 11.6883 15.1948 10.8517 Constraint (T0311)P9.CB (T0311)S39.CB 8.3280 13.8800 18.0440 10.8517 Constraint (T0311)P9.CB (T0311)A38.CB 7.3509 12.2514 15.9269 10.8517 Constraint (T0311)P9.CB (T0311)T37.CB 8.0301 13.3835 17.3986 10.8517 Constraint (T0311)P9.CB (T0311)S36.CB 10.2610 17.1016 22.2321 10.8517 Constraint (T0311)P9.CB (T0311)P35.CB 10.6913 17.8189 23.1645 10.8517 Constraint (T0311)P9.CB (T0311)A34.CB 10.5251 17.5418 22.8043 10.8517 Constraint (T0311)P9.CB (T0311)I33.CB 8.5445 14.2409 18.5132 10.8517 Constraint (T0311)P9.CB (T0311)A30.CB 11.0114 18.3523 23.8580 10.8517 Constraint (T0311)P9.CB (T0311)R29.CB 12.0681 20.1136 26.1476 10.8517 Constraint (T0311)P9.CB (T0311)A28.CB 9.4833 15.8055 20.5472 10.8517 Constraint (T0311)P9.CB (T0311)F27.CB 8.2953 13.8255 17.9732 10.8517 Constraint (T0311)P9.CB (T0311)E26.CB 11.4564 19.0940 24.8222 10.8517 Constraint (T0311)P9.CB (T0311)R25.CB 11.8119 19.6865 25.5924 10.8517 Constraint (T0311)P9.CB (T0311)L24.CB 9.2381 15.3968 20.0158 10.8517 Constraint (T0311)P9.CB (T0311)S23.CB 11.6020 19.3367 25.1376 10.8517 Constraint (T0311)P9.CB (T0311)V22.CB 9.9595 16.5991 21.5789 10.8517 Constraint (T0311)P9.CB (T0311)E19.CB 9.5722 15.9536 20.7397 10.8517 Constraint (T0311)P9.CB (T0311)D18.CB 9.1663 15.2771 19.8602 10.8517 Constraint (T0311)P64.CB (T0311)L76.CB 8.3500 13.9167 18.0917 10.8503 Constraint (T0311)N69.CB (T0311)A79.CB 9.8420 16.4033 21.3243 10.8449 Constraint (T0311)N69.CB (T0311)E78.CB 10.6176 17.6960 23.0048 10.8449 Constraint (T0311)N21.CB (T0311)N72.CB 10.9772 18.2953 23.7839 10.8093 Constraint (T0311)S36.CB (T0311)M66.CB 12.0125 20.0208 26.0271 10.7787 Constraint (T0311)E26.CB (T0311)V83.CB 6.7725 11.2876 14.6738 10.7773 Constraint (T0311)S39.CB (T0311)A73.CB 9.2257 15.3761 19.9889 10.7768 Constraint (T0311)L48.CB (T0311)A77.CB 8.3471 13.9118 18.0853 10.7764 Constraint (T0311)A47.CB (T0311)A77.CB 9.7667 16.2778 21.1611 10.7764 Constraint (T0311)W67.CB (T0311)A79.CB 8.8634 14.7724 19.2041 10.7647 Constraint (T0311)W67.CB (T0311)E78.CB 9.8971 16.4952 21.4438 10.7647 Constraint (T0311)S75.CB (T0311)L88.CB 11.8087 19.6812 25.5856 10.7602 Constraint (T0311)T37.CB (T0311)K81.CB 10.8228 18.0380 23.4494 10.7121 Constraint (T0311)A46.CB (T0311)L76.CB 9.9598 16.5997 21.5796 10.7045 Constraint (T0311)T43.CB (T0311)N72.CB 10.0049 16.6748 21.6773 10.6990 Constraint (T0311)L76.CB (T0311)R90.CB 10.3917 17.3195 22.5153 10.6983 Constraint (T0311)T43.CB (T0311)W74.CB 10.3598 17.2663 22.4462 10.6817 Constraint (T0311)L56.CB (T0311)L76.CB 8.7507 14.5845 18.9598 10.6742 Constraint (T0311)N21.CB (T0311)A77.CB 10.6125 17.6875 22.9938 10.6741 Constraint (T0311)L48.CB (T0311)V85.CB 10.6857 17.8094 23.1523 10.6663 Constraint (T0311)A46.CB (T0311)S86.CB 11.8373 19.7289 25.6476 10.6663 Constraint (T0311)I12.CB (T0311)T82.CB 10.6560 17.7600 23.0879 10.6548 Constraint (T0311)I12.CB (T0311)K81.CB 10.2386 17.0643 22.1835 10.6548 Constraint (T0311)Q14.CB (T0311)A79.CB 9.4484 15.7474 20.4716 10.6548 Constraint (T0311)E51.CB (T0311)A77.CB 9.6822 16.1370 20.9781 10.6426 Constraint (T0311)P50.CB (T0311)A77.CB 8.3926 13.9877 18.1840 10.6426 Constraint (T0311)A53.CB (T0311)A73.CB 10.2851 17.1419 22.2845 10.6325 Constraint (T0311)A53.CB (T0311)N72.CB 11.0068 18.3446 23.8480 10.6306 Constraint (T0311)S86.CB (T0311)S95.CB 9.2817 15.4694 20.1102 10.6254 Constraint (T0311)V85.CB (T0311)S95.CB 10.1135 16.8558 21.9125 10.6254 Constraint (T0311)A28.CB (T0311)E78.CB 10.3797 17.2994 22.4893 10.6061 Constraint (T0311)L24.CB (T0311)E78.CB 10.2801 17.1335 22.2735 10.6061 Constraint (T0311)M52.CB (T0311)A73.CB 10.2465 17.0774 22.2006 10.5880 Constraint (T0311)A30.CB (T0311)K81.CB 7.6290 12.7150 16.5294 10.5869 Constraint (T0311)R29.CB (T0311)E80.CB 8.9490 14.9150 19.3894 10.5869 Constraint (T0311)E26.CB (T0311)E80.CB 7.0899 11.8164 15.3614 10.5869 Constraint (T0311)R25.CB (T0311)E80.CB 8.6953 14.4921 18.8397 10.5869 Constraint (T0311)S23.CB (T0311)E80.CB 7.4794 12.4657 16.2054 10.5869 Constraint (T0311)V59.CB (T0311)R87.CB 11.3292 18.8820 24.5465 10.5806 Constraint (T0311)A77.CB (T0311)L91.CB 11.4565 19.0942 24.8224 10.5694 Constraint (T0311)L56.CB (T0311)L88.CB 11.8123 19.6871 25.5933 10.5671 Constraint (T0311)V59.CB (T0311)A73.CB 10.3196 17.1993 22.3591 10.5535 Constraint (T0311)T37.CB (T0311)S75.CB 10.8055 18.0092 23.4119 10.5384 Constraint (T0311)P35.CB (T0311)S75.CB 11.4953 19.1589 24.9066 10.5384 Constraint (T0311)A34.CB (T0311)S75.CB 11.8440 19.7399 25.6619 10.5384 Constraint (T0311)A46.CB (T0311)W74.CB 12.1678 20.2797 26.3637 10.5295 Constraint (T0311)K45.CB (T0311)A73.CB 9.0544 15.0906 19.6178 10.5295 Constraint (T0311)A46.CB (T0311)V83.CB 11.4989 19.1648 24.9142 10.5213 Constraint (T0311)D11.CB (T0311)L76.CB 12.3085 20.5141 26.6683 10.5027 Constraint (T0311)P35.CB (T0311)A73.CB 11.1286 18.5477 24.1120 10.4768 Constraint (T0311)Q14.CB (T0311)W74.CB 10.5210 17.5350 22.7955 10.4740 Constraint (T0311)M66.CB (T0311)A79.CB 8.4695 14.1158 18.3505 10.4647 Constraint (T0311)M66.CB (T0311)E78.CB 9.7669 16.2782 21.1617 10.4647 Constraint (T0311)L24.CB (T0311)W74.CB 11.8597 19.7661 25.6960 10.4586 Constraint (T0311)L68.CB (T0311)A77.CB 10.6901 17.8168 23.1619 10.4401 Constraint (T0311)W74.CB (T0311)L88.CB 12.1668 20.2780 26.3614 10.4267 Constraint (T0311)W74.CB (T0311)R87.CB 10.1171 16.8619 21.9205 10.4267 Constraint (T0311)E19.CB (T0311)L76.CB 8.6012 14.3354 18.6360 10.4238 Constraint (T0311)S57.CB (T0311)V85.CB 10.3095 17.1824 22.3372 10.4212 Constraint (T0311)D11.CB (T0311)N72.CB 9.8684 16.4473 21.3815 10.4113 Constraint (T0311)A46.CB (T0311)N72.CB 11.6214 19.3690 25.1797 10.3990 Constraint (T0311)R40.CB (T0311)W74.CB 10.6965 17.8275 23.1758 10.3817 Constraint (T0311)P64.CB (T0311)D84.CB 7.4577 12.4295 16.1583 10.3504 Constraint (T0311)S63.CB (T0311)D84.CB 8.2558 13.7597 17.8876 10.3504 Constraint (T0311)S62.CB (T0311)D84.CB 9.8968 16.4946 21.4430 10.3504 Constraint (T0311)P64.CB (T0311)R87.CB 8.7211 14.5352 18.8957 10.3485 Constraint (T0311)P64.CB (T0311)S86.CB 9.3114 15.5189 20.1746 10.3485 Constraint (T0311)P64.CB (T0311)V85.CB 9.1026 15.1710 19.7223 10.3485 Constraint (T0311)A53.CB (T0311)E78.CB 6.6870 11.1450 14.4885 10.3475 Constraint (T0311)V59.CB (T0311)L76.CB 9.6448 16.0747 20.8970 10.3407 Constraint (T0311)S62.CB (T0311)A73.CB 8.2821 13.8034 17.9445 10.2554 Constraint (T0311)I60.CB (T0311)N72.CB 9.5688 15.9480 20.7324 10.2535 Constraint (T0311)L20.CB (T0311)A73.CB 10.2415 17.0691 22.1899 10.2362 Constraint (T0311)L20.CB (T0311)L76.CB 10.1896 16.9827 22.0775 10.2323 Constraint (T0311)L20.CB (T0311)S75.CB 10.7134 17.8557 23.2124 10.2323 Constraint (T0311)S16.CB (T0311)S75.CB 11.0062 18.3436 23.8467 10.2323 Constraint (T0311)S16.CB (T0311)L76.CB 8.5115 14.1858 18.4416 10.2263 Constraint (T0311)R29.CB (T0311)Q71.CB 11.7493 19.5822 25.4569 10.2142 Constraint (T0311)R25.CB (T0311)Q71.CB 12.6432 21.0720 27.3936 10.2142 Constraint (T0311)S23.CB (T0311)P50.CB 13.1868 21.9779 28.5713 10.2108 Constraint (T0311)N72.CB (T0311)S86.CB 12.4191 20.6985 26.9080 10.2045 Constraint (T0311)S75.CB (T0311)R89.CB 12.5357 20.8928 27.1606 10.2026 Constraint (T0311)F27.CB (T0311)S75.CB 10.7973 17.9955 23.3941 10.2016 Constraint (T0311)R87.CB (T0311)T96.CB 8.6554 14.4257 18.7534 10.2003 Constraint (T0311)S86.CB (T0311)T96.CB 9.6784 16.1307 20.9699 10.2003 Constraint (T0311)V85.CB (T0311)T96.CB 10.2006 17.0010 22.1013 10.2003 Constraint (T0311)W67.CB (T0311)T82.CB 9.7513 16.2522 21.1279 10.1917 Constraint (T0311)A53.CB (T0311)V85.CB 10.7696 17.9494 23.3342 10.1848 Constraint (T0311)M31.CB (T0311)R87.CB 11.3639 18.9398 24.6218 10.1573 Constraint (T0311)L48.CB (T0311)N72.CB 11.4007 19.0012 24.7016 10.1421 Constraint (T0311)L24.CB (T0311)V83.CB 7.7467 12.9112 16.7846 10.1105 Constraint (T0311)S75.CB (T0311)R90.CB 11.3323 18.8872 24.5534 10.1026 Constraint (T0311)D18.CB (T0311)A79.CB 10.2931 17.1552 22.3017 10.0911 Constraint (T0311)M52.CB (T0311)A77.CB 8.7237 14.5395 18.9013 10.0886 Constraint (T0311)V22.CB (T0311)E78.CB 10.4514 17.4190 22.6447 10.0674 Constraint (T0311)S63.CB (T0311)L76.CB 7.9055 13.1758 17.1285 10.0426 Constraint (T0311)S62.CB (T0311)L76.CB 7.8366 13.0611 16.9794 10.0426 Constraint (T0311)V58.CB (T0311)D84.CB 10.6312 17.7186 23.0342 10.0095 Constraint (T0311)S57.CB (T0311)S86.CB 9.9717 16.6195 21.6054 10.0019 Constraint (T0311)V59.CB (T0311)D84.CB 11.0761 18.4602 23.9982 9.9973 Constraint (T0311)S57.CB (T0311)L88.CB 11.6489 19.4149 25.2393 9.9942 Constraint (T0311)D18.CB (T0311)A77.CB 9.5578 15.9297 20.7086 9.9863 Constraint (T0311)Q65.CB (T0311)D84.CB 7.0730 11.7884 15.3249 9.9661 Constraint (T0311)Q65.CB (T0311)V85.CB 9.3199 15.5332 20.1932 9.9642 Constraint (T0311)A30.CB (T0311)E78.CB 8.8294 14.7156 19.1303 9.9556 Constraint (T0311)S36.CB (T0311)L91.CB 11.9454 19.9090 25.8818 9.9529 Constraint (T0311)D18.CB (T0311)Q71.CB 9.8036 16.3394 21.2412 9.9410 Constraint (T0311)P9.CB (T0311)M31.CB 8.5797 14.2996 18.5894 9.9061 Constraint (T0311)M31.CB (T0311)L76.CB 8.7395 14.5658 18.9356 9.8956 Constraint (T0311)A30.CB (T0311)L76.CB 9.7285 16.2142 21.0784 9.8956 Constraint (T0311)M66.CB (T0311)T82.CB 9.2669 15.4449 20.0783 9.8917 Constraint (T0311)M66.CB (T0311)K81.CB 9.1734 15.2890 19.8757 9.8917 Constraint (T0311)M66.CB (T0311)E80.CB 8.1236 13.5393 17.6010 9.8917 Constraint (T0311)D84.CB (T0311)T93.CB 10.1163 16.8605 21.9187 9.8892 Constraint (T0311)V58.CB (T0311)N72.CB 10.6621 17.7702 23.1013 9.8870 Constraint (T0311)L56.CB (T0311)N72.CB 9.0942 15.1570 19.7041 9.8870 Constraint (T0311)A73.CB (T0311)R87.CB 10.6990 17.8316 23.1811 9.8557 Constraint (T0311)P9.CB (T0311)M66.CB 6.4748 10.7914 14.0288 9.8353 Constraint (T0311)P9.CB (T0311)Q65.CB 7.3116 12.1860 15.8418 9.8353 Constraint (T0311)P9.CB (T0311)P64.CB 6.4860 10.8099 14.0529 9.8353 Constraint (T0311)P9.CB (T0311)S63.CB 8.2332 13.7219 17.8385 9.8353 Constraint (T0311)P9.CB (T0311)S62.CB 7.2301 12.0502 15.6652 9.8353 Constraint (T0311)P9.CB (T0311)N21.CB 12.1656 20.2761 26.3589 9.8353 Constraint (T0311)P9.CB (T0311)L20.CB 9.8233 16.3722 21.2839 9.8353 Constraint (T0311)D11.CB (T0311)W74.CB 12.2602 20.4336 26.5637 9.8146 Constraint (T0311)A28.CB (T0311)N72.CB 12.1327 20.2212 26.2876 9.8093 Constraint (T0311)E26.CB (T0311)N72.CB 12.1177 20.1961 26.2550 9.8093 Constraint (T0311)R25.CB (T0311)N72.CB 11.7035 19.5058 25.3576 9.8093 Constraint (T0311)L24.CB (T0311)N72.CB 9.6325 16.0542 20.8705 9.8093 Constraint (T0311)S23.CB (T0311)N72.CB 10.8264 18.0440 23.4572 9.8093 Constraint (T0311)F27.CB (T0311)D84.CB 8.5672 14.2786 18.5622 9.7927 Constraint (T0311)T49.CB (T0311)A77.CB 9.0736 15.1227 19.6595 9.7886 Constraint (T0311)P35.CB (T0311)L70.CB 10.6706 17.7843 23.1196 9.7875 Constraint (T0311)A34.CB (T0311)Q71.CB 11.8265 19.7108 25.6240 9.7875 Constraint (T0311)E32.CB (T0311)L70.CB 10.4568 17.4280 22.6565 9.7875 Constraint (T0311)R29.CB (T0311)V83.CB 8.1430 13.5716 17.6431 9.7773 Constraint (T0311)S23.CB (T0311)V83.CB 7.2127 12.0211 15.6274 9.7773 Constraint (T0311)R40.CB (T0311)S86.CB 11.9538 19.9229 25.8998 9.7327 Constraint (T0311)P35.CB (T0311)V83.CB 9.2515 15.4192 20.0450 9.7057 Constraint (T0311)A34.CB (T0311)V83.CB 10.6953 17.8254 23.1731 9.7057 Constraint (T0311)A53.CB (T0311)S86.CB 9.9837 16.6394 21.6313 9.6817 Constraint (T0311)V22.CB (T0311)A77.CB 10.6450 17.7417 23.0642 9.6742 Constraint (T0311)L42.CB (T0311)W74.CB 11.1624 18.6041 24.1853 9.6653 Constraint (T0311)K45.CB (T0311)S86.CB 11.2343 18.7238 24.3410 9.6644 Constraint (T0311)I13.CB (T0311)A79.CB 8.8789 14.7982 19.2377 9.6586 Constraint (T0311)I13.CB (T0311)E80.CB 9.6932 16.1554 21.0020 9.6586 Constraint (T0311)Q14.CB (T0311)E80.CB 9.1078 15.1796 19.7335 9.6548 Constraint (T0311)N21.CB (T0311)Q71.CB 10.5134 17.5224 22.7791 9.6410 Constraint (T0311)E19.CB (T0311)Q71.CB 7.8773 13.1289 17.0676 9.6410 Constraint (T0311)V58.CB (T0311)R87.CB 10.8378 18.0631 23.4820 9.5825 Constraint (T0311)S57.CB (T0311)R87.CB 9.8743 16.4572 21.3944 9.5825 Constraint (T0311)V58.CB (T0311)L76.CB 8.9468 14.9113 19.3847 9.5809 Constraint (T0311)E78.CB (T0311)V92.CB 12.0315 20.0524 26.0682 9.5694 Constraint (T0311)I54.CB (T0311)L76.CB 8.7806 14.6343 19.0245 9.5655 Constraint (T0311)Q65.CB (T0311)S86.CB 9.6186 16.0310 20.8403 9.5594 Constraint (T0311)V59.CB (T0311)N72.CB 10.6813 17.8021 23.1428 9.5535 Constraint (T0311)E19.CB (T0311)A73.CB 8.4952 14.1587 18.4063 9.5362 Constraint (T0311)S36.CB (T0311)R87.CB 11.3978 18.9963 24.6951 9.5346 Constraint (T0311)E19.CB (T0311)E78.CB 10.1090 16.8483 21.9028 9.4954 Constraint (T0311)L24.CB (T0311)A73.CB 9.8288 16.3814 21.2958 9.4605 Constraint (T0311)S23.CB (T0311)A73.CB 11.8263 19.7105 25.6237 9.4605 Constraint (T0311)N21.CB (T0311)N69.CB 12.5336 20.8893 27.1561 9.3846 Constraint (T0311)W67.CB (T0311)K81.CB 9.0155 15.0258 19.5336 9.3821 Constraint (T0311)S36.CB (T0311)W74.CB 11.8480 19.7466 25.6706 9.3817 Constraint (T0311)W67.CB (T0311)L76.CB 8.6858 14.4763 18.8192 9.3631 Constraint (T0311)S63.CB (T0311)R87.CB 9.8144 16.3573 21.2645 9.3504 Constraint (T0311)S63.CB (T0311)V85.CB 10.1920 16.9867 22.0827 9.3504 Constraint (T0311)S62.CB (T0311)R87.CB 10.9661 18.2769 23.7600 9.3504 Constraint (T0311)V83.CB (T0311)Q94.CB 9.0074 15.0124 19.5161 9.3075 Constraint (T0311)T82.CB (T0311)Q94.CB 10.9236 18.2059 23.6677 9.3075 Constraint (T0311)A79.CB (T0311)Q94.CB 10.7708 17.9513 23.3367 9.3075 Constraint (T0311)E19.CB (T0311)E51.CB 12.3835 20.6391 26.8309 9.2900 Constraint (T0311)S63.CB (T0311)N72.CB 8.3933 13.9888 18.1854 9.2554 Constraint (T0311)S62.CB (T0311)N72.CB 8.7892 14.6487 19.0433 9.2554 Constraint (T0311)I60.CB (T0311)S75.CB 10.5478 17.5797 22.8537 9.2535 Constraint (T0311)L20.CB (T0311)N72.CB 9.8838 16.4730 21.4149 9.2362 Constraint (T0311)E15.CB (T0311)S75.CB 10.9304 18.2174 23.6826 9.2324 Constraint (T0311)E19.CB (T0311)S75.CB 9.4592 15.7653 20.4949 9.2323 Constraint (T0311)K55.CB (T0311)S86.CB 10.3176 17.1960 22.3548 9.1632 Constraint (T0311)A38.CB (T0311)D84.CB 9.7666 16.2776 21.1609 9.1259 Constraint (T0311)I33.CB (T0311)D84.CB 11.5698 19.2830 25.0680 9.1259 Constraint (T0311)R29.CB (T0311)T82.CB 7.6976 12.8293 16.6780 9.1208 Constraint (T0311)M52.CB (T0311)L88.CB 12.2969 20.4947 26.6432 9.0978 Constraint (T0311)L48.CB (T0311)L88.CB 11.5853 19.3089 25.1016 9.0978 Constraint (T0311)N21.CB (T0311)A79.CB 9.6138 16.0229 20.8298 9.0828 Constraint (T0311)M66.CB (T0311)V83.CB 8.6259 14.3765 18.6895 9.0821 Constraint (T0311)K45.CB (T0311)V85.CB 11.4825 19.1374 24.8787 9.0692 Constraint (T0311)M66.CB (T0311)S75.CB 8.7878 14.6463 19.0401 9.0631 Constraint (T0311)V59.CB (T0311)S86.CB 11.2317 18.7194 24.3352 9.0095 Constraint (T0311)L68.CB (T0311)A79.CB 10.0013 16.6689 21.6696 9.0081 Constraint (T0311)P50.CB (T0311)N72.CB 11.4175 19.0291 24.7379 8.9962 Constraint (T0311)T49.CB (T0311)N72.CB 12.3701 20.6169 26.8020 8.9962 Constraint (T0311)I12.CB (T0311)W74.CB 11.1650 18.6083 24.1909 8.9778 Constraint (T0311)N21.CB (T0311)A46.CB 11.6912 19.4853 25.3309 8.9776 Constraint (T0311)Q65.CB (T0311)R87.CB 8.2622 13.7703 17.9014 8.9661 Constraint (T0311)S36.CB (T0311)K81.CB 11.9025 19.8375 25.7888 8.9227 Constraint (T0311)K55.CB (T0311)R87.CB 10.6470 17.7450 23.0686 8.9158 Constraint (T0311)V83.CB (T0311)S95.CB 10.0455 16.7425 21.7653 8.9027 Constraint (T0311)T82.CB (T0311)T93.CB 9.7578 16.2631 21.1420 8.9027 Constraint (T0311)K81.CB (T0311)Q94.CB 12.2582 20.4303 26.5593 8.9027 Constraint (T0311)K81.CB (T0311)T93.CB 11.3406 18.9010 24.5713 8.9027 Constraint (T0311)E80.CB (T0311)Q94.CB 10.7755 17.9592 23.3470 8.9027 Constraint (T0311)L76.CB (T0311)L91.CB 10.0889 16.8148 21.8593 8.9027 Constraint (T0311)S75.CB (T0311)L91.CB 11.6106 19.3510 25.1563 8.9027 Constraint (T0311)S57.CB (T0311)W74.CB 10.4555 17.4258 22.6535 8.8889 Constraint (T0311)V58.CB (T0311)W74.CB 10.8203 18.0338 23.4440 8.8870 Constraint (T0311)S57.CB (T0311)S75.CB 10.6369 17.7282 23.0466 8.8870 Constraint (T0311)L56.CB (T0311)S75.CB 10.0958 16.8264 21.8743 8.8870 Constraint (T0311)P9.CB (T0311)L68.CB 5.6193 9.3655 12.1752 8.8530 Constraint (T0311)P9.CB (T0311)M52.CB 6.5333 10.8889 14.1555 8.8530 Constraint (T0311)P9.CB (T0311)E51.CB 8.3954 13.9923 18.1900 8.8530 Constraint (T0311)P9.CB (T0311)P50.CB 6.6459 11.0764 14.3993 8.8530 Constraint (T0311)P9.CB (T0311)T49.CB 6.7822 11.3036 14.6947 8.8530 Constraint (T0311)P9.CB (T0311)L48.CB 4.2137 7.0228 9.1297 8.8530 Constraint (T0311)A30.CB (T0311)D84.CB 9.1688 15.2814 19.8658 8.8049 Constraint (T0311)K55.CB (T0311)A73.CB 10.6497 17.7494 23.0742 8.7938 Constraint (T0311)I54.CB (T0311)A73.CB 10.8478 18.0796 23.5035 8.7938 Constraint (T0311)E26.CB (T0311)D84.CB 8.5622 14.2703 18.5514 8.7927 Constraint (T0311)S63.CB (T0311)S86.CB 10.2176 17.0294 22.1382 8.7775 Constraint (T0311)S62.CB (T0311)S86.CB 11.0706 18.4510 23.9863 8.7775 Constraint (T0311)S62.CB (T0311)V85.CB 11.2938 18.8231 24.4700 8.7775 Constraint (T0311)M52.CB (T0311)L76.CB 8.8864 14.8107 19.2539 8.7630 Constraint (T0311)S39.CB (T0311)D84.CB 10.4747 17.4578 22.6952 8.7211 Constraint (T0311)S36.CB (T0311)T82.CB 11.8353 19.7255 25.6432 8.7160 Constraint (T0311)P35.CB (T0311)K81.CB 10.5358 17.5597 22.8276 8.7160 Constraint (T0311)A34.CB (T0311)T82.CB 10.8844 18.1406 23.5828 8.7160 Constraint (T0311)A34.CB (T0311)K81.CB 11.5881 19.3135 25.1076 8.7160 Constraint (T0311)R25.CB (T0311)V83.CB 7.6453 12.7422 16.5649 8.7057 Constraint (T0311)M52.CB (T0311)S86.CB 9.8193 16.3654 21.2750 8.6817 Constraint (T0311)L48.CB (T0311)S86.CB 9.3867 15.6445 20.3378 8.6817 Constraint (T0311)A47.CB (T0311)V85.CB 10.6355 17.7259 23.0437 8.6817 Constraint (T0311)I13.CB (T0311)T82.CB 10.8404 18.0674 23.4876 8.6587 Constraint (T0311)I13.CB (T0311)K81.CB 11.1338 18.5563 24.1232 8.6587 Constraint (T0311)I13.CB (T0311)E78.CB 10.2912 17.1519 22.2975 8.6587 Constraint (T0311)A79.CB (T0311)S95.CB 11.2566 18.7609 24.3892 8.6407 Constraint (T0311)V22.CB (T0311)T82.CB 7.8365 13.0608 16.9790 8.6209 Constraint (T0311)V22.CB (T0311)K81.CB 8.2548 13.7580 17.8854 8.6209 Constraint (T0311)E26.CB (T0311)E78.CB 9.3065 15.5108 20.1640 8.6100 Constraint (T0311)R25.CB (T0311)A79.CB 8.0250 13.3750 17.3875 8.6100 Constraint (T0311)S23.CB (T0311)A79.CB 7.4351 12.3918 16.1094 8.6100 Constraint (T0311)S23.CB (T0311)E78.CB 10.0637 16.7729 21.8047 8.6100 Constraint (T0311)M52.CB (T0311)N72.CB 11.1555 18.5925 24.1702 8.6034 Constraint (T0311)I54.CB (T0311)S86.CB 9.0396 15.0660 19.5859 8.5902 Constraint (T0311)L70.CB (T0311)K81.CB 9.8294 16.3824 21.2971 8.5811 Constraint (T0311)L70.CB (T0311)E80.CB 8.7671 14.6118 18.9954 8.5811 Constraint (T0311)L68.CB (T0311)E80.CB 9.6697 16.1161 20.9509 8.5811 Constraint (T0311)K55.CB (T0311)L76.CB 9.0814 15.1356 19.6763 8.5809 Constraint (T0311)A77.CB (T0311)V92.CB 12.1757 20.2928 26.3807 8.5713 Constraint (T0311)A47.CB (T0311)V83.CB 9.5010 15.8350 20.5855 8.5675 Constraint (T0311)A47.CB (T0311)T82.CB 9.2201 15.3669 19.9770 8.5675 Constraint (T0311)I13.CB (T0311)A77.CB 10.1618 16.9363 22.0171 8.5539 Constraint (T0311)V59.CB (T0311)W74.CB 10.7645 17.9408 23.3230 8.5535 Constraint (T0311)A38.CB (T0311)S86.CB 10.6970 17.8283 23.1768 8.5461 Constraint (T0311)F27.CB (T0311)S86.CB 10.2987 17.1645 22.3139 8.5461 Constraint (T0311)N21.CB (T0311)A73.CB 11.0979 18.4965 24.0455 8.5363 Constraint (T0311)L17.CB (T0311)S75.CB 10.7183 17.8639 23.2231 8.5324 Constraint (T0311)D18.CB (T0311)S75.CB 10.7895 17.9825 23.3772 8.5324 Constraint (T0311)A53.CB (T0311)L88.CB 11.2466 18.7444 24.3677 8.5180 Constraint (T0311)E19.CB (T0311)K81.CB 10.6634 17.7723 23.1040 8.4954 Constraint (T0311)S39.CB (T0311)N72.CB 9.3000 15.5001 20.1501 8.4759 Constraint (T0311)P35.CB (T0311)N72.CB 10.8157 18.0261 23.4340 8.4759 Constraint (T0311)T37.CB (T0311)A73.CB 10.2527 17.0879 22.2143 8.3836 Constraint (T0311)S36.CB (T0311)A73.CB 9.2412 15.4021 20.0227 8.3836 Constraint (T0311)A34.CB (T0311)A73.CB 11.3312 18.8854 24.5510 8.3836 Constraint (T0311)I33.CB (T0311)A73.CB 12.0460 20.0767 26.0996 8.3836 Constraint (T0311)P35.CB (T0311)W74.CB 12.8627 21.4378 27.8692 8.3653 Constraint (T0311)R25.CB (T0311)S75.CB 12.4486 20.7476 26.9719 8.3519 Constraint (T0311)I60.CB (T0311)R87.CB 11.1895 18.6492 24.2440 8.3486 Constraint (T0311)I60.CB (T0311)S86.CB 11.0392 18.3986 23.9182 8.3383 Constraint (T0311)I60.CB (T0311)D84.CB 10.1330 16.8883 21.9548 8.3383 Constraint (T0311)D84.CB (T0311)Q94.CB 9.9269 16.5448 21.5082 8.3094 Constraint (T0311)L20.CB (T0311)E78.CB 11.2082 18.6803 24.2844 8.3040 Constraint (T0311)D18.CB (T0311)E80.CB 8.7426 14.5710 18.9423 8.2979 Constraint (T0311)S63.CB (T0311)S75.CB 9.6843 16.1404 20.9826 8.2554 Constraint (T0311)S62.CB (T0311)S75.CB 9.7199 16.1998 21.0597 8.2554 Constraint (T0311)I60.CB (T0311)W74.CB 10.1507 16.9179 21.9933 8.2535 Constraint (T0311)D11.CB (T0311)A79.CB 10.3870 17.3117 22.5053 8.2533 Constraint (T0311)T82.CB (T0311)S95.CB 11.7780 19.6300 25.5190 8.2359 Constraint (T0311)E80.CB (T0311)S95.CB 10.9984 18.3307 23.8300 8.2359 Constraint (T0311)S16.CB (T0311)W74.CB 10.3225 17.2042 22.3654 8.2343 Constraint (T0311)E15.CB (T0311)W74.CB 10.5277 17.5462 22.8100 8.2343 Constraint (T0311)A30.CB (T0311)A77.CB 10.1132 16.8553 21.9119 8.2167 Constraint (T0311)R29.CB (T0311)A77.CB 11.8458 19.7431 25.6660 8.2167 Constraint (T0311)A28.CB (T0311)A77.CB 10.5507 17.5844 22.8598 8.2167 Constraint (T0311)E26.CB (T0311)A77.CB 10.3360 17.2267 22.3947 8.2167 Constraint (T0311)S23.CB (T0311)A77.CB 10.3758 17.2930 22.4809 8.2167 Constraint (T0311)I12.CB (T0311)R87.CB 11.1837 18.6394 24.2313 8.1804 Constraint (T0311)L42.CB (T0311)R87.CB 9.3454 15.5757 20.2484 8.1516 Constraint (T0311)A38.CB (T0311)R87.CB 10.3478 17.2464 22.4203 8.1516 Constraint (T0311)I33.CB (T0311)R87.CB 12.0164 20.0273 26.0354 8.1516 Constraint (T0311)A30.CB (T0311)R87.CB 11.2817 18.8028 24.4436 8.1516 Constraint (T0311)F27.CB (T0311)R87.CB 9.8130 16.3551 21.2616 8.1516 Constraint (T0311)L42.CB (T0311)S86.CB 9.0290 15.0484 19.5629 8.1413 Constraint (T0311)L42.CB (T0311)V85.CB 8.8540 14.7566 19.1836 8.1413 Constraint (T0311)E32.CB (T0311)K81.CB 9.2889 15.4815 20.1260 8.1330 Constraint (T0311)R29.CB (T0311)K81.CB 9.0328 15.0547 19.5711 8.1330 Constraint (T0311)R29.CB (T0311)D84.CB 10.7059 17.8432 23.1961 8.1259 Constraint (T0311)A28.CB (T0311)D84.CB 10.2850 17.1416 22.2841 8.1259 Constraint (T0311)R25.CB (T0311)D84.CB 10.0236 16.7060 21.7178 8.1259 Constraint (T0311)L24.CB (T0311)D84.CB 8.7428 14.5713 18.9427 8.1259 Constraint (T0311)S23.CB (T0311)D84.CB 8.2250 13.7084 17.8209 8.1259 Constraint (T0311)P35.CB (T0311)N69.CB 12.1732 20.2886 26.3752 8.1209 Constraint (T0311)A34.CB (T0311)N69.CB 12.2303 20.3838 26.4989 8.1209 Constraint (T0311)E32.CB (T0311)N69.CB 11.5443 19.2406 25.0127 8.1209 Constraint (T0311)R29.CB (T0311)N69.CB 11.9439 19.9064 25.8783 8.1209 Constraint (T0311)R25.CB (T0311)N69.CB 12.8693 21.4489 27.8836 8.1209 Constraint (T0311)S23.CB (T0311)N69.CB 12.6099 21.0166 27.3215 8.1209 Constraint (T0311)K55.CB (T0311)L88.CB 12.5554 20.9257 27.2034 8.1132 Constraint (T0311)M52.CB (T0311)R87.CB 10.1104 16.8507 21.9059 8.1132 Constraint (T0311)L48.CB (T0311)R87.CB 9.8462 16.4103 21.3334 8.1132 Constraint (T0311)A47.CB (T0311)R87.CB 11.1996 18.6659 24.2657 8.1132 Constraint (T0311)A30.CB (T0311)S75.CB 10.3148 17.1913 22.3486 8.1084 Constraint (T0311)N21.CB (T0311)E78.CB 10.4572 17.4287 22.6573 8.0828 Constraint (T0311)P64.CB (T0311)S75.CB 8.9847 14.9745 19.4668 8.0631 Constraint (T0311)P64.CB (T0311)W74.CB 9.2125 15.3541 19.9603 8.0631 Constraint (T0311)M31.CB (T0311)V85.CB 11.8141 19.6901 25.5972 8.0292 Constraint (T0311)V58.CB (T0311)S86.CB 10.3546 17.2577 22.4350 8.0172 Constraint (T0311)P9.CB (T0311)E32.CB 10.9196 18.1993 23.6591 8.0149 Constraint (T0311)L70.CB (T0311)A79.CB 7.4178 12.3630 16.0719 8.0082 Constraint (T0311)L68.CB (T0311)E78.CB 10.5805 17.6341 22.9244 8.0082 Constraint (T0311)A46.CB (T0311)T82.CB 11.0269 18.3782 23.8917 7.9945 Constraint (T0311)Q65.CB (T0311)L88.CB 9.5528 15.9213 20.6977 7.9661 Constraint (T0311)E51.CB (T0311)D84.CB 9.9295 16.5491 21.5138 7.9596 Constraint (T0311)P50.CB (T0311)D84.CB 8.1435 13.5725 17.6442 7.9596 Constraint (T0311)L24.CB (T0311)V85.CB 8.9741 14.9568 19.4438 7.9509 Constraint (T0311)S23.CB (T0311)V85.CB 8.6367 14.3944 18.7128 7.9509 Constraint (T0311)T37.CB (T0311)S86.CB 12.4043 20.6739 26.8760 7.9455 Constraint (T0311)P35.CB (T0311)E78.CB 10.6523 17.7539 23.0800 7.9432 Constraint (T0311)R25.CB (T0311)E78.CB 10.4137 17.3562 22.5631 7.9432 Constraint (T0311)I54.CB (T0311)R87.CB 8.7055 14.5092 18.8620 7.9235 Constraint (T0311)L76.CB (T0311)V92.CB 11.3964 18.9940 24.6922 7.9046 Constraint (T0311)E26.CB (T0311)L76.CB 9.4958 15.8264 20.5743 7.8956 Constraint (T0311)L56.CB (T0311)W74.CB 9.6254 16.0423 20.8550 7.8870 Constraint (T0311)N72.CB (T0311)R87.CB 11.5344 19.2240 24.9912 7.8711 Constraint (T0311)A73.CB (T0311)L88.CB 12.6529 21.0882 27.4146 7.8557 Constraint (T0311)I13.CB (T0311)V83.CB 9.8552 16.4253 21.3528 7.8491 Constraint (T0311)V22.CB (T0311)D84.CB 8.1312 13.5520 17.6175 7.8235 Constraint (T0311)V83.CB (T0311)T96.CB 10.8297 18.0495 23.4643 7.8108 Constraint (T0311)K55.CB (T0311)N72.CB 10.8735 18.1226 23.5593 7.7938 Constraint (T0311)A47.CB (T0311)W74.CB 10.6072 17.6786 22.9822 7.7932 Constraint (T0311)D18.CB (T0311)K81.CB 10.2157 17.0262 22.1341 7.7577 Constraint (T0311)D18.CB (T0311)E78.CB 9.9821 16.6369 21.6279 7.7577 Constraint (T0311)L17.CB (T0311)E78.CB 9.6768 16.1280 20.9664 7.7577 Constraint (T0311)A47.CB (T0311)S86.CB 9.2046 15.3410 19.9433 7.6971 Constraint (T0311)M52.CB (T0311)V85.CB 10.3922 17.3204 22.5165 7.6939 Constraint (T0311)S36.CB (T0311)N72.CB 10.3572 17.2620 22.4406 7.6663 Constraint (T0311)A47.CB (T0311)N72.CB 11.7426 19.5710 25.4423 7.6627 Constraint (T0311)D84.CB (T0311)S95.CB 10.3098 17.1830 22.3379 7.6427 Constraint (T0311)E19.CB (T0311)V83.CB 11.2135 18.6891 24.2958 7.5925 Constraint (T0311)M52.CB (T0311)S75.CB 8.1492 13.5821 17.6567 7.5746 Constraint (T0311)E32.CB (T0311)L76.CB 10.2463 17.0772 22.2004 7.5622 Constraint (T0311)V59.CB (T0311)S75.CB 10.4456 17.4094 22.6322 7.5535 Constraint (T0311)T49.CB (T0311)D84.CB 10.0428 16.7381 21.7595 7.5511 Constraint (T0311)A47.CB (T0311)D84.CB 11.2074 18.6790 24.2826 7.5511 Constraint (T0311)I33.CB (T0311)A77.CB 10.6589 17.7648 23.0943 7.5500 Constraint (T0311)A28.CB (T0311)S86.CB 11.5951 19.3252 25.1228 7.5461 Constraint (T0311)E26.CB (T0311)S86.CB 10.4871 17.4785 22.7221 7.5461 Constraint (T0311)L24.CB (T0311)S86.CB 9.3214 15.5357 20.1965 7.5461 Constraint (T0311)S23.CB (T0311)S86.CB 9.3646 15.6077 20.2900 7.5461 Constraint (T0311)D18.CB (T0311)W74.CB 10.1728 16.9547 22.0412 7.5343 Constraint (T0311)L17.CB (T0311)W74.CB 10.3861 17.3101 22.5031 7.5343 Constraint (T0311)A53.CB (T0311)R87.CB 9.1195 15.1992 19.7589 7.5334 Constraint (T0311)E51.CB (T0311)N72.CB 12.2672 20.4453 26.5789 7.4575 Constraint (T0311)V58.CB (T0311)V85.CB 11.3695 18.9492 24.6339 7.4443 Constraint (T0311)I54.CB (T0311)V85.CB 9.6810 16.1350 20.9755 7.4443 Constraint (T0311)L70.CB (T0311)T82.CB 8.2157 13.6929 17.8008 7.4352 Constraint (T0311)N69.CB (T0311)T82.CB 9.1614 15.2690 19.8497 7.4352 Constraint (T0311)N69.CB (T0311)K81.CB 10.4419 17.4031 22.6241 7.4352 Constraint (T0311)L68.CB (T0311)T82.CB 10.7235 17.8726 23.2344 7.4352 Constraint (T0311)L68.CB (T0311)K81.CB 10.7688 17.9479 23.3323 7.4352 Constraint (T0311)L20.CB (T0311)V83.CB 12.4133 20.6888 26.8955 7.3954 Constraint (T0311)A28.CB (T0311)A73.CB 11.2692 18.7819 24.4165 7.3673 Constraint (T0311)R25.CB (T0311)A73.CB 11.7379 19.5632 25.4321 7.3673 Constraint (T0311)I60.CB (T0311)V85.CB 11.5273 19.2121 24.9757 7.3505 Constraint (T0311)P64.CB (T0311)L88.CB 9.4383 15.7305 20.4496 7.3486 Constraint (T0311)W67.CB (T0311)V83.CB 7.6299 12.7164 16.5314 7.2889 Constraint (T0311)S63.CB (T0311)W74.CB 9.6064 16.0106 20.8138 7.2554 Constraint (T0311)S62.CB (T0311)W74.CB 9.4232 15.7054 20.4170 7.2554 Constraint (T0311)D11.CB (T0311)E78.CB 10.8846 18.1410 23.5833 7.2533 Constraint (T0311)L76.CB (T0311)S95.CB 12.6672 21.1120 27.4456 7.2378 Constraint (T0311)L76.CB (T0311)Q94.CB 12.0903 20.1505 26.1957 7.2378 Constraint (T0311)N21.CB (T0311)W74.CB 11.2219 18.7032 24.3141 7.2343 Constraint (T0311)L20.CB (T0311)W74.CB 9.5590 15.9317 20.7112 7.2343 Constraint (T0311)E19.CB (T0311)W74.CB 8.3836 13.9727 18.1645 7.2343 Constraint (T0311)F27.CB (T0311)W74.CB 11.0707 18.4512 23.9866 7.2190 Constraint (T0311)N21.CB (T0311)L68.CB 12.2939 20.4899 26.6369 7.1702 Constraint (T0311)L42.CB (T0311)R89.CB 9.6581 16.0968 20.9258 7.1516 Constraint (T0311)L42.CB (T0311)L88.CB 9.3610 15.6016 20.2821 7.1516 Constraint (T0311)A30.CB (T0311)L88.CB 11.5563 19.2605 25.0387 7.1516 Constraint (T0311)A28.CB (T0311)R87.CB 11.1701 18.6169 24.2020 7.1516 Constraint (T0311)F27.CB (T0311)L88.CB 9.7912 16.3187 21.2143 7.1516 Constraint (T0311)E80.CB (T0311)T96.CB 11.8910 19.8184 25.7639 7.1441 Constraint (T0311)S39.CB (T0311)S86.CB 9.7631 16.2718 21.1533 7.1413 Constraint (T0311)A38.CB (T0311)V85.CB 9.8988 16.4979 21.4473 7.1413 Constraint (T0311)I12.CB (T0311)S75.CB 9.8458 16.4097 21.3326 7.1392 Constraint (T0311)E51.CB (T0311)R87.CB 8.9367 14.8944 19.3627 7.1209 Constraint (T0311)E51.CB (T0311)V85.CB 9.7611 16.2685 21.1490 7.1209 Constraint (T0311)P50.CB (T0311)R87.CB 7.5879 12.6464 16.4404 7.1209 Constraint (T0311)P50.CB (T0311)V85.CB 7.9183 13.1971 17.1563 7.1209 Constraint (T0311)T49.CB (T0311)R87.CB 9.3568 15.5947 20.2731 7.1209 Constraint (T0311)T49.CB (T0311)V85.CB 9.2198 15.3663 19.9762 7.1209 Constraint (T0311)M31.CB (T0311)S75.CB 8.3250 13.8749 18.0374 7.1084 Constraint (T0311)N21.CB (T0311)E80.CB 8.3703 13.9504 18.1356 6.9896 Constraint (T0311)A30.CB (T0311)V85.CB 10.7296 17.8827 23.2475 6.9631 Constraint (T0311)F27.CB (T0311)V85.CB 8.7667 14.6112 18.9945 6.9631 Constraint (T0311)E26.CB (T0311)V85.CB 9.0483 15.0805 19.6047 6.9631 Constraint (T0311)L41.CB (T0311)L88.CB 10.5024 17.5040 22.7552 6.9374 Constraint (T0311)T43.CB (T0311)D84.CB 9.7506 16.2510 21.1262 6.9340 Constraint (T0311)T37.CB (T0311)D84.CB 11.4329 19.0548 24.7712 6.9340 Constraint (T0311)R8.CB (T0311)I60.CB 9.6569 16.0948 20.9233 6.8531 Constraint (T0311)R8.CB (T0311)V58.CB 12.2499 20.4166 26.5415 6.8531 Constraint (T0311)R8.CB (T0311)S57.CB 9.4869 15.8114 20.5549 6.8531 Constraint (T0311)R8.CB (T0311)L56.CB 8.8345 14.7242 19.1414 6.8531 Constraint (T0311)R8.CB (T0311)K55.CB 11.3660 18.9434 24.6264 6.8531 Constraint (T0311)R8.CB (T0311)I54.CB 10.6693 17.7821 23.1167 6.8531 Constraint (T0311)R8.CB (T0311)A53.CB 7.8881 13.1469 17.0909 6.8531 Constraint (T0311)R8.CB (T0311)M52.CB 9.6856 16.1427 20.9855 6.8531 Constraint (T0311)R8.CB (T0311)E51.CB 11.5411 19.2352 25.0057 6.8531 Constraint (T0311)R8.CB (T0311)P50.CB 9.6584 16.0974 20.9266 6.8531 Constraint (T0311)R8.CB (T0311)T49.CB 9.5643 15.9406 20.7227 6.8531 Constraint (T0311)R8.CB (T0311)L48.CB 6.9927 11.6545 15.1508 6.8531 Constraint (T0311)R8.CB (T0311)A47.CB 7.0179 11.6966 15.2055 6.8531 Constraint (T0311)R8.CB (T0311)A46.CB 8.0099 13.3499 17.3549 6.8531 Constraint (T0311)R8.CB (T0311)K45.CB 7.0321 11.7201 15.2361 6.8531 Constraint (T0311)R8.CB (T0311)T43.CB 6.4232 10.7054 13.9170 6.8531 Constraint (T0311)R8.CB (T0311)L42.CB 6.2895 10.4825 13.6272 6.8531 Constraint (T0311)R8.CB (T0311)L41.CB 6.4731 10.7886 14.0252 6.8531 Constraint (T0311)R8.CB (T0311)R40.CB 8.1703 13.6171 17.7023 6.8531 Constraint (T0311)R8.CB (T0311)S39.CB 9.3136 15.5226 20.1794 6.8531 Constraint (T0311)R8.CB (T0311)A38.CB 9.2167 15.3611 19.9694 6.8531 Constraint (T0311)R8.CB (T0311)T37.CB 10.0094 16.6823 21.6870 6.8531 Constraint (T0311)R8.CB (T0311)S36.CB 11.6690 19.4483 25.2829 6.8531 Constraint (T0311)R8.CB (T0311)P35.CB 12.3177 20.5295 26.6883 6.8531 Constraint (T0311)R8.CB (T0311)A34.CB 12.5909 20.9848 27.2803 6.8531 Constraint (T0311)R8.CB (T0311)I33.CB 10.7687 17.9478 23.3322 6.8531 Constraint (T0311)R8.CB (T0311)A28.CB 11.3110 18.8516 24.5071 6.8531 Constraint (T0311)R8.CB (T0311)F27.CB 10.0560 16.7601 21.7881 6.8531 Constraint (T0311)R8.CB (T0311)E26.CB 12.9846 21.6410 28.1333 6.8531 Constraint (T0311)R8.CB (T0311)L24.CB 10.5371 17.5618 22.8304 6.8531 Constraint (T0311)R8.CB (T0311)V22.CB 11.2232 18.7054 24.3170 6.8531 Constraint (T0311)R8.CB (T0311)E19.CB 9.8984 16.4974 21.4466 6.8531 Constraint (T0311)R8.CB (T0311)D18.CB 9.3175 15.5292 20.1879 6.8531 Constraint (T0311)R8.CB (T0311)L17.CB 8.6833 14.4722 18.8139 6.8531 Constraint (T0311)D11.CB (T0311)K81.CB 11.2782 18.7971 24.4362 6.8485 Constraint (T0311)V22.CB (T0311)R87.CB 9.6723 16.1204 20.9566 6.8357 Constraint (T0311)R29.CB (T0311)E78.CB 9.1717 15.2861 19.8719 6.8228 Constraint (T0311)D84.CB (T0311)T96.CB 10.9757 18.2928 23.7806 6.8127 Constraint (T0311)V58.CB (T0311)S75.CB 9.8529 16.4215 21.3480 6.7938 Constraint (T0311)S36.CB (T0311)L70.CB 9.7178 16.1963 21.0552 6.7875 Constraint (T0311)S36.CB (T0311)N69.CB 11.9498 19.9163 25.8911 6.7875 Constraint (T0311)A34.CB (T0311)L70.CB 9.6057 16.0095 20.8123 6.7875 Constraint (T0311)E32.CB (T0311)S86.CB 12.7803 21.3005 27.6907 6.7846 Constraint (T0311)A53.CB (T0311)L76.CB 8.4687 14.1144 18.3487 6.7803 Constraint (T0311)T49.CB (T0311)S86.CB 7.6645 12.7741 16.6064 6.7093 Constraint (T0311)L17.CB (T0311)K81.CB 9.6531 16.0886 20.9151 6.6645 Constraint (T0311)S16.CB (T0311)T82.CB 10.3091 17.1818 22.3364 6.6645 Constraint (T0311)S16.CB (T0311)K81.CB 9.4771 15.7952 20.5338 6.6645 Constraint (T0311)E15.CB (T0311)T82.CB 10.2231 17.0385 22.1501 6.6645 Constraint (T0311)E15.CB (T0311)K81.CB 9.2682 15.4471 20.0812 6.6645 Constraint (T0311)Q14.CB (T0311)K81.CB 9.2207 15.3678 19.9781 6.6645 Constraint (T0311)I54.CB (T0311)N72.CB 10.6739 17.7899 23.1269 6.6479 Constraint (T0311)V22.CB (T0311)V85.CB 8.5905 14.3176 18.6128 6.6453 Constraint (T0311)A34.CB (T0311)A77.CB 11.8518 19.7530 25.6789 6.6362 Constraint (T0311)L70.CB (T0311)V83.CB 8.3300 13.8833 18.0482 6.6256 Constraint (T0311)V59.CB (T0311)L88.CB 12.1730 20.2884 26.3749 6.5902 Constraint (T0311)M52.CB (T0311)W74.CB 8.8311 14.7185 19.1340 6.5900 Constraint (T0311)E51.CB (T0311)W74.CB 9.8580 16.4300 21.3590 6.5900 Constraint (T0311)D11.CB (T0311)T82.CB 11.5457 19.2428 25.0156 6.5866 Constraint (T0311)R29.CB (T0311)L76.CB 9.6923 16.1538 21.0000 6.5622 Constraint (T0311)K45.CB (T0311)L88.CB 9.8146 16.3576 21.2649 6.5104 Constraint (T0311)E19.CB (T0311)T82.CB 11.3060 18.8433 24.4964 6.4993 Constraint (T0311)E51.CB (T0311)A73.CB 9.4927 15.8212 20.5676 6.4421 Constraint (T0311)T37.CB (T0311)N72.CB 11.7853 19.6422 25.5348 6.3827 Constraint (T0311)A34.CB (T0311)N72.CB 12.1431 20.2385 26.3100 6.3827 Constraint (T0311)L41.CB (T0311)R89.CB 10.7114 17.8523 23.2080 6.3644 Constraint (T0311)T37.CB (T0311)R87.CB 11.6293 19.3821 25.1968 6.3644 Constraint (T0311)M31.CB (T0311)L88.CB 11.1745 18.6241 24.2113 6.3644 Constraint (T0311)E32.CB (T0311)D84.CB 11.7023 19.5039 25.3550 6.3510 Constraint (T0311)L56.CB (T0311)R89.CB 11.3016 18.8359 24.4867 6.3371 Constraint (T0311)N69.CB (T0311)V83.CB 9.0648 15.1080 19.6404 6.3256 Constraint (T0311)L68.CB (T0311)V83.CB 9.4453 15.7422 20.4648 6.3256 Constraint (T0311)P50.CB (T0311)W74.CB 9.9435 16.5724 21.5442 6.2900 Constraint (T0311)D11.CB (T0311)E80.CB 9.9594 16.5990 21.5787 6.2533 Constraint (T0311)V22.CB (T0311)S86.CB 9.2844 15.4739 20.1161 6.2405 Constraint (T0311)V22.CB (T0311)S75.CB 10.9597 18.2662 23.7460 6.2363 Constraint (T0311)V22.CB (T0311)W74.CB 11.0110 18.3517 23.8571 6.2343 Constraint (T0311)V58.CB (T0311)L88.CB 12.1775 20.2958 26.3845 6.2224 Constraint (T0311)R25.CB (T0311)A77.CB 10.7180 17.8633 23.2223 6.2205 Constraint (T0311)Q71.CB (T0311)V85.CB 11.5278 19.2129 24.9768 6.1822 Constraint (T0311)D11.CB (T0311)V83.CB 10.6588 17.7647 23.0941 6.1818 Constraint (T0311)E32.CB (T0311)E78.CB 7.7561 12.9268 16.8048 6.1683 Constraint (T0311)V59.CB (T0311)V85.CB 11.4039 19.0065 24.7085 6.1651 Constraint (T0311)P35.CB (T0311)V85.CB 9.6385 16.0642 20.8835 6.1638 Constraint (T0311)A28.CB (T0311)V85.CB 10.1425 16.9042 21.9754 6.1638 Constraint (T0311)R25.CB (T0311)V85.CB 9.0396 15.0659 19.5857 6.1638 Constraint (T0311)A34.CB (T0311)E78.CB 10.5258 17.5430 22.8058 6.1561 Constraint (T0311)R29.CB (T0311)R87.CB 11.8217 19.7029 25.6137 6.1535 Constraint (T0311)E26.CB (T0311)R87.CB 9.5788 15.9647 20.7541 6.1535 Constraint (T0311)L24.CB (T0311)R87.CB 8.5576 14.2627 18.5415 6.1535 Constraint (T0311)S23.CB (T0311)R87.CB 8.4834 14.1390 18.3807 6.1535 Constraint (T0311)E51.CB (T0311)S86.CB 7.3750 12.2916 15.9791 6.1363 Constraint (T0311)P50.CB (T0311)S86.CB 5.5941 9.3235 12.1205 6.1363 Constraint (T0311)E51.CB (T0311)L76.CB 8.5558 14.2596 18.5375 6.1314 Constraint (T0311)P50.CB (T0311)L76.CB 8.5353 14.2254 18.4931 6.1314 Constraint (T0311)Q14.CB (T0311)T82.CB 9.0110 15.0183 19.5238 5.9977 Constraint (T0311)S63.CB (T0311)L88.CB 10.7370 17.8950 23.2635 5.9903 Constraint (T0311)L41.CB (T0311)R90.CB 11.8690 19.7816 25.7161 5.9756 Constraint (T0311)W67.CB (T0311)R87.CB 9.6191 16.0319 20.8414 5.9726 Constraint (T0311)M66.CB (T0311)L88.CB 10.6599 17.7665 23.0964 5.9726 Constraint (T0311)M66.CB (T0311)R87.CB 9.1339 15.2231 19.7900 5.9726 Constraint (T0311)M66.CB (T0311)S86.CB 10.4720 17.4534 22.6894 5.9726 Constraint (T0311)M66.CB (T0311)V85.CB 10.4375 17.3959 22.6146 5.9726 Constraint (T0311)T43.CB (T0311)S86.CB 8.5246 14.2076 18.4699 5.9494 Constraint (T0311)L48.CB (T0311)S75.CB 7.7521 12.9201 16.7962 5.9411 Constraint (T0311)A47.CB (T0311)S75.CB 9.1319 15.2198 19.7857 5.9411 Constraint (T0311)R40.CB (T0311)L88.CB 10.6063 17.6771 22.9803 5.9374 Constraint (T0311)P35.CB (T0311)D84.CB 9.7947 16.3245 21.2219 5.9340 Constraint (T0311)A34.CB (T0311)D84.CB 11.8888 19.8147 25.7591 5.9340 Constraint (T0311)R8.CB (T0311)M31.CB 10.7991 17.9985 23.3980 5.9075 Constraint (T0311)L41.CB (T0311)W74.CB 9.6473 16.0788 20.9025 5.8855 Constraint (T0311)A38.CB (T0311)W74.CB 10.8573 18.0955 23.5241 5.8855 Constraint (T0311)S23.CB (T0311)Q65.CB 11.5096 19.1827 24.9374 5.8786 Constraint (T0311)N21.CB (T0311)E51.CB 13.5769 22.6282 29.4167 5.8692 Constraint (T0311)L17.CB (T0311)D84.CB 10.3639 17.2732 22.4552 5.8549 Constraint (T0311)L17.CB (T0311)V83.CB 9.4152 15.6920 20.3997 5.8549 Constraint (T0311)S16.CB (T0311)D84.CB 9.8901 16.4836 21.4286 5.8549 Constraint (T0311)E15.CB (T0311)D84.CB 9.2028 15.3380 19.9394 5.8549 Constraint (T0311)Q14.CB (T0311)D84.CB 9.5926 15.9876 20.7839 5.8549 Constraint (T0311)Q14.CB (T0311)V83.CB 8.2756 13.7927 17.9306 5.8549 Constraint (T0311)I12.CB (T0311)V85.CB 10.9239 18.2066 23.6686 5.8549 Constraint (T0311)R8.CB (T0311)L68.CB 6.8709 11.4514 14.8869 5.8367 Constraint (T0311)R8.CB (T0311)W67.CB 6.0436 10.0726 13.0944 5.8367 Constraint (T0311)R8.CB (T0311)M66.CB 8.1814 13.6357 17.7264 5.8367 Constraint (T0311)R8.CB (T0311)Q65.CB 9.5134 15.8557 20.6124 5.8367 Constraint (T0311)R8.CB (T0311)P64.CB 9.3000 15.5000 20.1500 5.8367 Constraint (T0311)R8.CB (T0311)S63.CB 10.6369 17.7281 23.0465 5.8367 Constraint (T0311)R8.CB (T0311)S62.CB 9.2940 15.4900 20.1370 5.8367 Constraint (T0311)R8.CB (T0311)V59.CB 11.1268 18.5447 24.1081 5.8367 Constraint (T0311)R8.CB (T0311)R25.CB 13.2717 22.1195 28.7553 5.8367 Constraint (T0311)R8.CB (T0311)S23.CB 12.5919 20.9865 27.2824 5.8367 Constraint (T0311)R8.CB (T0311)N21.CB 12.6698 21.1164 27.4513 5.8367 Constraint (T0311)R8.CB (T0311)L20.CB 10.7972 17.9953 23.3938 5.8367 Constraint (T0311)K55.CB (T0311)S75.CB 9.7355 16.2259 21.0937 5.7938 Constraint (T0311)K55.CB (T0311)W74.CB 9.6669 16.1114 20.9449 5.7938 Constraint (T0311)A53.CB (T0311)S75.CB 8.5637 14.2729 18.5548 5.7803 Constraint (T0311)S62.CB (T0311)L88.CB 12.1867 20.3112 26.4046 5.7775 Constraint (T0311)L41.CB (T0311)S75.CB 6.8083 11.3472 14.7513 5.7750 Constraint (T0311)A38.CB (T0311)S75.CB 8.6085 14.3475 18.6517 5.7750 Constraint (T0311)I33.CB (T0311)S75.CB 8.6257 14.3761 18.6889 5.7750 Constraint (T0311)E32.CB (T0311)S75.CB 9.6606 16.1010 20.9313 5.7750 Constraint (T0311)P35.CB (T0311)S86.CB 10.1210 16.8683 21.9288 5.7590 Constraint (T0311)R25.CB (T0311)S86.CB 9.9339 16.5565 21.5235 5.7590 Constraint (T0311)D18.CB (T0311)V85.CB 10.8865 18.1442 23.5875 5.6645 Constraint (T0311)D18.CB (T0311)T82.CB 10.0381 16.7302 21.7492 5.6645 Constraint (T0311)L17.CB (T0311)T82.CB 9.4887 15.8144 20.5588 5.6645 Constraint (T0311)S16.CB (T0311)V85.CB 10.8509 18.0848 23.5102 5.6645 Constraint (T0311)N21.CB (T0311)T82.CB 9.5172 15.8620 20.6207 5.6439 Constraint (T0311)N21.CB (T0311)K81.CB 9.1355 15.2258 19.7936 5.6439 Constraint (T0311)I54.CB (T0311)L88.CB 9.9985 16.6642 21.6634 5.5556 Constraint (T0311)S23.CB (T0311)L68.CB 12.5950 20.9917 27.2892 5.5478 Constraint (T0311)A46.CB (T0311)R89.CB 12.1780 20.2967 26.3858 5.5345 Constraint (T0311)K45.CB (T0311)R89.CB 9.9908 16.6514 21.6468 5.5326 Constraint (T0311)T43.CB (T0311)R87.CB 8.6532 14.4220 18.7487 5.5326 Constraint (T0311)L88.CB (T0311)P97.CB 7.4655 12.4425 16.1752 5.5002 Constraint (T0311)E32.CB (T0311)A77.CB 10.9256 18.2094 23.6722 5.4417 Constraint (T0311)S57.CB (T0311)R89.CB 11.4596 19.0993 24.8291 5.4385 Constraint (T0311)L41.CB (T0311)L91.CB 11.3947 18.9912 24.6886 5.3798 Constraint (T0311)E32.CB (T0311)R87.CB 12.2229 20.3715 26.4829 5.3798 Constraint (T0311)S39.CB (T0311)R87.CB 8.9046 14.8410 19.2933 5.3644 Constraint (T0311)A38.CB (T0311)R89.CB 9.8291 16.3819 21.2964 5.3644 Constraint (T0311)A38.CB (T0311)L88.CB 8.6830 14.4717 18.8133 5.3644 Constraint (T0311)T37.CB (T0311)R89.CB 11.6141 19.3568 25.1639 5.3644 Constraint (T0311)T37.CB (T0311)L88.CB 10.7209 17.8681 23.2286 5.3644 Constraint (T0311)A34.CB (T0311)R89.CB 12.2673 20.4454 26.5791 5.3644 Constraint (T0311)A34.CB (T0311)R87.CB 11.9893 19.9822 25.9768 5.3644 Constraint (T0311)I33.CB (T0311)L88.CB 10.7460 17.9099 23.2829 5.3644 Constraint (T0311)A28.CB (T0311)L88.CB 9.6069 16.0115 20.8150 5.3644 Constraint (T0311)T43.CB (T0311)V85.CB 7.9075 13.1792 17.1329 5.3542 Constraint (T0311)R40.CB (T0311)V85.CB 10.6226 17.7044 23.0157 5.3542 Constraint (T0311)S39.CB (T0311)V85.CB 8.0007 13.3345 17.3348 5.3542 Constraint (T0311)T37.CB (T0311)V85.CB 11.3329 18.8882 24.5547 5.3542 Constraint (T0311)S36.CB (T0311)S86.CB 11.0261 18.3769 23.8899 5.3542 Constraint (T0311)A34.CB (T0311)S86.CB 12.3774 20.6289 26.8176 5.3542 Constraint (T0311)A34.CB (T0311)V85.CB 11.6495 19.4158 25.2405 5.3542 Constraint (T0311)W67.CB (T0311)D84.CB 9.8024 16.3373 21.2385 5.2745 Constraint (T0311)S16.CB (T0311)S86.CB 10.7339 17.8898 23.2568 5.2597 Constraint (T0311)N21.CB (T0311)S75.CB 9.8297 16.3828 21.2976 5.2363 Constraint (T0311)K81.CB (T0311)S95.CB 12.3103 20.5172 26.6723 5.2361 Constraint (T0311)E26.CB (T0311)W74.CB 12.2790 20.4649 26.6044 5.2209 Constraint (T0311)E26.CB (T0311)A73.CB 11.7586 19.5976 25.4769 5.2209 Constraint (T0311)I12.CB (T0311)S86.CB 9.9584 16.5973 21.5765 5.1881 Constraint (T0311)N21.CB (T0311)V83.CB 9.8232 16.3720 21.2836 5.1800 Constraint (T0311)R29.CB (T0311)V85.CB 10.2481 17.0801 22.2042 5.1760 Constraint (T0311)V22.CB (T0311)R89.CB 10.1106 16.8510 21.9062 5.1689 Constraint (T0311)V22.CB (T0311)L88.CB 8.7489 14.5815 18.9560 5.1689 Constraint (T0311)L56.CB (T0311)R90.CB 12.1680 20.2801 26.3641 5.1456 Constraint (T0311)M31.CB (T0311)N72.CB 11.0687 18.4479 23.9823 5.1431 Constraint (T0311)T49.CB (T0311)L88.CB 10.4346 17.3910 22.6083 5.1363 Constraint (T0311)T49.CB (T0311)L76.CB 7.3896 12.3159 16.0107 5.1315 Constraint (T0311)T49.CB (T0311)S75.CB 7.4440 12.4066 16.1286 5.1315 Constraint (T0311)L48.CB (T0311)L76.CB 6.5591 10.9319 14.2115 5.1315 Constraint (T0311)A47.CB (T0311)L76.CB 7.9140 13.1901 17.1471 5.1315 Constraint (T0311)M31.CB (T0311)W74.CB 9.8626 16.4376 21.3689 5.1258 Constraint (T0311)A47.CB (T0311)L88.CB 11.1642 18.6070 24.1891 5.1229 Constraint (T0311)E26.CB (T0311)S75.CB 10.6911 17.8184 23.1640 5.1123 Constraint (T0311)A46.CB (T0311)L88.CB 11.3813 18.9689 24.6596 5.1075 Constraint (T0311)R87.CB (T0311)P97.CB 8.6049 14.3415 18.6440 5.0954 Constraint (T0311)S86.CB (T0311)P97.CB 9.9261 16.5435 21.5066 5.0954 Constraint (T0311)V85.CB (T0311)P97.CB 9.4053 15.6756 20.3783 5.0954 Constraint (T0311)V83.CB (T0311)P97.CB 10.8200 18.0333 23.4433 5.0954 Constraint (T0311)E19.CB (T0311)T49.CB 12.1812 20.3020 26.3926 4.9920 Constraint (T0311)L42.CB (T0311)R90.CB 10.5265 17.5441 22.8074 4.9756 Constraint (T0311)F27.CB (T0311)R90.CB 11.9724 19.9539 25.9401 4.9756 Constraint (T0311)M66.CB (T0311)D84.CB 8.5557 14.2595 18.5373 4.9745 Constraint (T0311)R40.CB (T0311)R89.CB 10.4012 17.3353 22.5358 4.9596 Constraint (T0311)T49.CB (T0311)W74.CB 8.6983 14.4971 18.8463 4.9565 Constraint (T0311)L48.CB (T0311)W74.CB 8.1266 13.5443 17.6076 4.9565 Constraint (T0311)S36.CB (T0311)V85.CB 10.3336 17.2227 22.3895 4.9494 Constraint (T0311)T43.CB (T0311)L88.CB 7.6298 12.7163 16.5312 4.9393 Constraint (T0311)Q71.CB (T0311)D84.CB 12.2260 20.3767 26.4897 4.9294 Constraint (T0311)S36.CB (T0311)S63.CB 10.7558 17.9263 23.3041 4.8967 Constraint (T0311)S16.CB (T0311)R87.CB 9.7168 16.1947 21.0531 4.8568 Constraint (T0311)E15.CB (T0311)R87.CB 9.2933 15.4889 20.1356 4.8568 Constraint (T0311)D18.CB (T0311)D84.CB 9.0435 15.0725 19.5943 4.8549 Constraint (T0311)D18.CB (T0311)V83.CB 8.6565 14.4275 18.7557 4.8549 Constraint (T0311)E15.CB (T0311)V85.CB 9.7820 16.3033 21.1943 4.8549 Constraint (T0311)P9.CB (T0311)A77.CB 13.1032 21.8387 28.3903 4.8530 Constraint (T0311)P9.CB (T0311)L76.CB 12.5154 20.8590 27.1167 4.8530 Constraint (T0311)P9.CB (T0311)Q71.CB 12.1202 20.2003 26.2604 4.8530 Constraint (T0311)T37.CB (T0311)W74.CB 11.1946 18.6576 24.2549 4.8086 Constraint (T0311)I54.CB (T0311)W74.CB 9.8692 16.4487 21.3833 4.7957 Constraint (T0311)A53.CB (T0311)W74.CB 9.4401 15.7335 20.4535 4.7957 Constraint (T0311)E51.CB (T0311)S75.CB 6.7415 11.2358 14.6066 4.7952 Constraint (T0311)P50.CB (T0311)S75.CB 7.1559 11.9265 15.5045 4.7952 Constraint (T0311)A28.CB (T0311)S75.CB 9.4329 15.7215 20.4380 4.7750 Constraint (T0311)R29.CB (T0311)S86.CB 11.8359 19.7265 25.6445 4.7712 Constraint (T0311)N21.CB (T0311)V85.CB 10.4109 17.3514 22.5569 4.6561 Constraint (T0311)I54.CB (T0311)S75.CB 7.8013 13.0022 16.9028 4.6344 Constraint (T0311)N72.CB (T0311)V85.CB 11.6430 19.4050 25.2265 4.6315 Constraint (T0311)E51.CB (T0311)L88.CB 9.8733 16.4556 21.3922 4.5633 Constraint (T0311)P50.CB (T0311)L88.CB 7.9364 13.2273 17.1955 4.5633 Constraint (T0311)L56.CB (T0311)L91.CB 12.3595 20.5991 26.7788 4.5499 Constraint (T0311)M52.CB (T0311)V92.CB 13.3638 22.2731 28.9550 4.5499 Constraint (T0311)L48.CB (T0311)V92.CB 11.9493 19.9155 25.8901 4.5499 Constraint (T0311)A47.CB (T0311)V92.CB 11.7594 19.5990 25.4787 4.5499 Constraint (T0311)A46.CB (T0311)R90.CB 12.6931 21.1551 27.5016 4.5499 Constraint (T0311)L70.CB (T0311)R87.CB 9.2117 15.3528 19.9586 4.5488 Constraint (T0311)K45.CB (T0311)V92.CB 9.0924 15.1540 19.7002 4.5480 Constraint (T0311)K45.CB (T0311)L91.CB 10.0649 16.7748 21.8072 4.5480 Constraint (T0311)K45.CB (T0311)R90.CB 10.4733 17.4555 22.6921 4.5480 Constraint (T0311)L48.CB (T0311)R89.CB 11.5146 19.1910 24.9482 4.5422 Constraint (T0311)I13.CB (T0311)S75.CB 11.1587 18.5978 24.1772 4.4430 Constraint (T0311)T43.CB (T0311)L91.CB 8.9384 14.8974 19.3666 4.3798 Constraint (T0311)L42.CB (T0311)L91.CB 9.7133 16.1889 21.0455 4.3798 Constraint (T0311)R40.CB (T0311)L91.CB 10.6928 17.8213 23.1677 4.3798 Constraint (T0311)S39.CB (T0311)L91.CB 8.8884 14.8140 19.2582 4.3798 Constraint (T0311)S39.CB (T0311)R90.CB 10.1158 16.8596 21.9175 4.3798 Constraint (T0311)A38.CB (T0311)L91.CB 9.9170 16.5283 21.4868 4.3798 Constraint (T0311)A38.CB (T0311)R90.CB 11.1919 18.6532 24.2492 4.3798 Constraint (T0311)T37.CB (T0311)L91.CB 11.0458 18.4096 23.9325 4.3798 Constraint (T0311)T37.CB (T0311)R90.CB 12.6547 21.0912 27.4185 4.3798 Constraint (T0311)P35.CB (T0311)L91.CB 9.6732 16.1220 20.9586 4.3798 Constraint (T0311)A34.CB (T0311)L91.CB 11.1235 18.5392 24.1010 4.3798 Constraint (T0311)A34.CB (T0311)R90.CB 13.0915 21.8191 28.3649 4.3798 Constraint (T0311)R29.CB (T0311)L91.CB 12.2132 20.3554 26.4620 4.3798 Constraint (T0311)A28.CB (T0311)L91.CB 10.7389 17.8982 23.2676 4.3798 Constraint (T0311)A28.CB (T0311)R90.CB 12.3338 20.5563 26.7232 4.3798 Constraint (T0311)F27.CB (T0311)L91.CB 10.7778 17.9631 23.3520 4.3798 Constraint (T0311)L24.CB (T0311)L91.CB 9.0644 15.1073 19.6395 4.3798 Constraint (T0311)I33.CB (T0311)R89.CB 11.5258 19.2096 24.9725 4.3721 Constraint (T0311)E32.CB (T0311)L88.CB 12.4910 20.8183 27.0638 4.3721 Constraint (T0311)M31.CB (T0311)R89.CB 11.6532 19.4219 25.2485 4.3721 Constraint (T0311)A30.CB (T0311)R89.CB 11.9933 19.9888 25.9854 4.3721 Constraint (T0311)S39.CB (T0311)R89.CB 7.4724 12.4540 16.1902 4.3664 Constraint (T0311)S39.CB (T0311)L88.CB 6.7263 11.2105 14.5737 4.3664 Constraint (T0311)S36.CB (T0311)R89.CB 10.3531 17.2551 22.4317 4.3664 Constraint (T0311)S36.CB (T0311)L88.CB 9.2547 15.4245 20.0518 4.3664 Constraint (T0311)P35.CB (T0311)R89.CB 9.4234 15.7057 20.4174 4.3664 Constraint (T0311)P35.CB (T0311)L88.CB 7.7270 12.8783 16.7418 4.3664 Constraint (T0311)P35.CB (T0311)R87.CB 9.0175 15.0291 19.5379 4.3664 Constraint (T0311)A34.CB (T0311)L88.CB 10.5060 17.5100 22.7630 4.3664 Constraint (T0311)I33.CB (T0311)V85.CB 10.7892 17.9820 23.3767 4.3664 Constraint (T0311)R29.CB (T0311)L88.CB 10.2258 17.0429 22.1558 4.3664 Constraint (T0311)A28.CB (T0311)R89.CB 10.5736 17.6226 22.9094 4.3664 Constraint (T0311)F27.CB (T0311)R89.CB 9.3245 15.5408 20.2030 4.3664 Constraint (T0311)E26.CB (T0311)R89.CB 9.9089 16.5148 21.4693 4.3664 Constraint (T0311)E26.CB (T0311)L88.CB 7.8299 13.0498 16.9647 4.3664 Constraint (T0311)R25.CB (T0311)R89.CB 9.5969 15.9949 20.7933 4.3664 Constraint (T0311)R25.CB (T0311)L88.CB 7.3902 12.3169 16.0120 4.3664 Constraint (T0311)R25.CB (T0311)R87.CB 8.5651 14.2752 18.5578 4.3664 Constraint (T0311)L24.CB (T0311)R89.CB 7.3019 12.1698 15.8207 4.3664 Constraint (T0311)L24.CB (T0311)L88.CB 5.5576 9.2626 12.0414 4.3664 Constraint (T0311)S23.CB (T0311)R89.CB 7.9637 13.2728 17.2546 4.3664 Constraint (T0311)S23.CB (T0311)L88.CB 5.8010 9.6683 12.5688 4.3664 Constraint (T0311)E26.CB (T0311)V92.CB 11.6458 19.4096 25.2325 4.3104 Constraint (T0311)V22.CB (T0311)V92.CB 10.9144 18.1907 23.6479 4.3104 Constraint (T0311)L70.CB (T0311)V85.CB 10.0052 16.6753 21.6778 4.3093 Constraint (T0311)S36.CB (T0311)Q65.CB 10.5010 17.5016 22.7521 4.3057 Constraint (T0311)P35.CB (T0311)Q65.CB 9.7639 16.2732 21.1551 4.3057 Constraint (T0311)A34.CB (T0311)Q65.CB 10.8422 18.0703 23.4914 4.3057 Constraint (T0311)E19.CB (T0311)D84.CB 9.9677 16.6129 21.5967 4.2591 Constraint (T0311)L20.CB (T0311)K81.CB 10.9303 18.2171 23.6822 4.2146 Constraint (T0311)I12.CB (T0311)L88.CB 10.5023 17.5038 22.7550 4.1901 Constraint (T0311)E15.CB (T0311)S86.CB 9.1371 15.2286 19.7971 4.1881 Constraint (T0311)Q14.CB (T0311)S86.CB 8.3667 13.9445 18.1279 4.1881 Constraint (T0311)Q14.CB (T0311)V85.CB 9.1263 15.2104 19.7735 4.1881 Constraint (T0311)M31.CB (T0311)A73.CB 8.9681 14.9468 19.4309 4.1277 Constraint (T0311)A30.CB (T0311)W74.CB 10.5336 17.5560 22.8228 4.1258 Constraint (T0311)A46.CB (T0311)R87.CB 10.2428 17.0713 22.1926 4.1229 Constraint (T0311)R29.CB (T0311)S75.CB 10.0039 16.6732 21.6751 4.1123 Constraint (T0311)D84.CB (T0311)P97.CB 10.8243 18.0405 23.4527 4.0973 Constraint (T0311)R8.CB (T0311)E32.CB 12.5597 20.9329 27.2127 4.0163 Constraint (T0311)R8.CB (T0311)A30.CB 12.2137 20.3561 26.4629 4.0163 Constraint (T0311)P7.CB (T0311)S57.CB 9.7633 16.2722 21.1538 4.0163 Constraint (T0311)P7.CB (T0311)L56.CB 10.0289 16.7148 21.7292 4.0163 Constraint (T0311)P7.CB (T0311)K55.CB 12.3136 20.5227 26.6795 4.0163 Constraint (T0311)P7.CB (T0311)I54.CB 11.0677 18.4462 23.9801 4.0163 Constraint (T0311)P7.CB (T0311)A53.CB 9.0954 15.1591 19.7068 4.0163 Constraint (T0311)P7.CB (T0311)M52.CB 11.3059 18.8432 24.4961 4.0163 Constraint (T0311)P7.CB (T0311)E51.CB 12.3550 20.5916 26.7691 4.0163 Constraint (T0311)P7.CB (T0311)P50.CB 10.4314 17.3857 22.6014 4.0163 Constraint (T0311)P7.CB (T0311)T49.CB 10.8423 18.0705 23.4916 4.0163 Constraint (T0311)P7.CB (T0311)L48.CB 9.0132 15.0219 19.5285 4.0163 Constraint (T0311)P7.CB (T0311)A47.CB 8.8975 14.8291 19.2779 4.0163 Constraint (T0311)P7.CB (T0311)A46.CB 10.9917 18.3194 23.8153 4.0163 Constraint (T0311)P7.CB (T0311)K45.CB 10.2895 17.1492 22.2940 4.0163 Constraint (T0311)P7.CB (T0311)T43.CB 9.5147 15.8578 20.6151 4.0163 Constraint (T0311)P7.CB (T0311)L42.CB 8.0098 13.3497 17.3547 4.0163 Constraint (T0311)P7.CB (T0311)L41.CB 7.8841 13.1401 17.0821 4.0163 Constraint (T0311)P7.CB (T0311)R40.CB 10.1912 16.9853 22.0808 4.0163 Constraint (T0311)P7.CB (T0311)S39.CB 11.1111 18.5186 24.0741 4.0163 Constraint (T0311)P7.CB (T0311)A38.CB 10.1052 16.8420 21.8946 4.0163 Constraint (T0311)P7.CB (T0311)T37.CB 10.9373 18.2289 23.6975 4.0163 Constraint (T0311)P7.CB (T0311)I33.CB 11.2182 18.6969 24.3060 4.0163 Constraint (T0311)P7.CB (T0311)M31.CB 10.3506 17.2510 22.4264 4.0163 Constraint (T0311)P7.CB (T0311)A30.CB 11.9987 19.9978 25.9971 4.0163 Constraint (T0311)P7.CB (T0311)A28.CB 12.2132 20.3554 26.4620 4.0163 Constraint (T0311)P7.CB (T0311)F27.CB 10.4490 17.4150 22.6395 4.0163 Constraint (T0311)P7.CB (T0311)L24.CB 11.4053 19.0089 24.7115 4.0163 Constraint (T0311)P7.CB (T0311)S23.CB 13.3765 22.2942 28.9825 4.0163 Constraint (T0311)P7.CB (T0311)V22.CB 11.2494 18.7489 24.3736 4.0163 Constraint (T0311)P7.CB (T0311)N21.CB 12.6432 21.0719 27.3935 4.0163 Constraint (T0311)P7.CB (T0311)E19.CB 9.1899 15.3165 19.9114 4.0163 Constraint (T0311)P7.CB (T0311)D18.CB 9.5181 15.8635 20.6225 4.0163 Constraint (T0311)P7.CB (T0311)L17.CB 9.0819 15.1365 19.6774 4.0163 Constraint (T0311)P7.CB (T0311)S16.CB 7.1694 11.9490 15.5338 4.0163 Constraint (T0311)H6.CB (T0311)I54.CB 12.7614 21.2689 27.6496 4.0163 Constraint (T0311)H6.CB (T0311)A53.CB 10.6527 17.7544 23.0807 4.0163 Constraint (T0311)H6.CB (T0311)P50.CB 11.3445 18.9075 24.5797 4.0163 Constraint (T0311)H6.CB (T0311)T49.CB 11.7080 19.5134 25.3674 4.0163 Constraint (T0311)H6.CB (T0311)L48.CB 10.5216 17.5361 22.7969 4.0163 Constraint (T0311)H6.CB (T0311)A47.CB 9.9194 16.5323 21.4919 4.0163 Constraint (T0311)H6.CB (T0311)K45.CB 11.4524 19.0874 24.8136 4.0163 Constraint (T0311)H6.CB (T0311)T43.CB 11.5609 19.2682 25.0486 4.0163 Constraint (T0311)H6.CB (T0311)L42.CB 10.8465 18.0775 23.5007 4.0163 Constraint (T0311)H6.CB (T0311)L41.CB 10.2323 17.0538 22.1700 4.0163 Constraint (T0311)H6.CB (T0311)R40.CB 12.2171 20.3618 26.4703 4.0163 Constraint (T0311)H6.CB (T0311)A38.CB 12.7864 21.3107 27.7039 4.0163 Constraint (T0311)H6.CB (T0311)E19.CB 12.2876 20.4793 26.6230 4.0163 Constraint (T0311)H6.CB (T0311)D18.CB 12.7919 21.3199 27.7159 4.0163 Constraint (T0311)H6.CB (T0311)L17.CB 12.2937 20.4895 26.6363 4.0163 Constraint (T0311)H6.CB (T0311)S16.CB 10.2225 17.0375 22.1487 4.0163 Constraint (T0311)H6.CB (T0311)E15.CB 9.2975 15.4958 20.1445 4.0163 Constraint (T0311)Q65.CB (T0311)R89.CB 11.0827 18.4712 24.0126 3.9980 Constraint (T0311)A73.CB (T0311)R89.CB 12.4600 20.7667 26.9967 3.9826 Constraint (T0311)V22.CB (T0311)R90.CB 10.7513 17.9188 23.2945 3.9775 Constraint (T0311)S57.CB (T0311)V92.CB 12.8407 21.4012 27.8216 3.9769 Constraint (T0311)L56.CB (T0311)V92.CB 11.9799 19.9664 25.9564 3.9769 Constraint (T0311)A53.CB (T0311)V92.CB 12.4518 20.7531 26.9790 3.9769 Constraint (T0311)M66.CB (T0311)R90.CB 10.9559 18.2599 23.7378 3.9758 Constraint (T0311)Q71.CB (T0311)R87.CB 10.0886 16.8143 21.8586 3.9758 Constraint (T0311)L70.CB (T0311)S86.CB 8.6650 14.4416 18.7741 3.9758 Constraint (T0311)N69.CB (T0311)R87.CB 9.5862 15.9770 20.7701 3.9758 Constraint (T0311)N69.CB (T0311)S86.CB 9.7534 16.2557 21.1324 3.9758 Constraint (T0311)N69.CB (T0311)V85.CB 10.9056 18.1760 23.6289 3.9758 Constraint (T0311)L68.CB (T0311)L88.CB 10.9985 18.3308 23.8301 3.9758 Constraint (T0311)L68.CB (T0311)R87.CB 9.4927 15.8211 20.5674 3.9758 Constraint (T0311)L68.CB (T0311)S86.CB 11.5062 19.1770 24.9301 3.9758 Constraint (T0311)T43.CB (T0311)V92.CB 6.9357 11.5595 15.0273 3.9750 Constraint (T0311)T43.CB (T0311)R90.CB 8.7245 14.5408 18.9031 3.9750 Constraint (T0311)L42.CB (T0311)V92.CB 8.5406 14.2342 18.5045 3.9750 Constraint (T0311)L41.CB (T0311)V92.CB 9.6953 16.1588 21.0064 3.9750 Constraint (T0311)R40.CB (T0311)V92.CB 8.9273 14.8788 19.3425 3.9750 Constraint (T0311)R40.CB (T0311)R90.CB 11.4360 19.0601 24.7781 3.9750 Constraint (T0311)S39.CB (T0311)V92.CB 7.4550 12.4251 16.1526 3.9750 Constraint (T0311)A38.CB (T0311)V92.CB 9.2536 15.4227 20.0495 3.9750 Constraint (T0311)T37.CB (T0311)V92.CB 10.0566 16.7610 21.7893 3.9750 Constraint (T0311)S36.CB (T0311)V92.CB 8.7475 14.5792 18.9530 3.9750 Constraint (T0311)S36.CB (T0311)R90.CB 11.6658 19.4430 25.2759 3.9750 Constraint (T0311)P35.CB (T0311)V92.CB 9.1294 15.2156 19.7803 3.9750 Constraint (T0311)A34.CB (T0311)V92.CB 10.4319 17.3865 22.6025 3.9750 Constraint (T0311)I33.CB (T0311)V92.CB 11.1695 18.6159 24.2006 3.9750 Constraint (T0311)M31.CB (T0311)V92.CB 12.5149 20.8582 27.1157 3.9750 Constraint (T0311)A28.CB (T0311)V92.CB 10.6665 17.7775 23.1108 3.9750 Constraint (T0311)F27.CB (T0311)V92.CB 10.9879 18.3131 23.8071 3.9750 Constraint (T0311)W67.CB (T0311)L88.CB 9.0674 15.1123 19.6460 3.9726 Constraint (T0311)W67.CB (T0311)S86.CB 9.1117 15.1862 19.7420 3.9726 Constraint (T0311)W67.CB (T0311)V85.CB 8.7164 14.5274 18.8856 3.9726 Constraint (T0311)T43.CB (T0311)R89.CB 5.9199 9.8666 12.8265 3.9616 Constraint (T0311)S23.CB (T0311)W74.CB 12.1849 20.3081 26.4006 3.8874 Constraint (T0311)I13.CB (T0311)D84.CB 9.3614 15.6023 20.2830 3.8587 Constraint (T0311)D18.CB (T0311)L88.CB 9.9045 16.5075 21.4598 3.8568 Constraint (T0311)D18.CB (T0311)R87.CB 8.5516 14.2527 18.5285 3.8568 Constraint (T0311)L17.CB (T0311)R87.CB 9.0157 15.0262 19.5341 3.8568 Constraint (T0311)S16.CB (T0311)L88.CB 10.2282 17.0470 22.1610 3.8568 Constraint (T0311)E15.CB (T0311)L88.CB 9.5855 15.9759 20.7687 3.8568 Constraint (T0311)E80.CB (T0311)P97.CB 10.5317 17.5528 22.8187 3.8557 Constraint (T0311)P9.CB (T0311)W74.CB 12.3561 20.5935 26.7716 3.8531 Constraint (T0311)P9.CB (T0311)A73.CB 10.1298 16.8829 21.9478 3.8531 Constraint (T0311)P9.CB (T0311)L70.CB 7.3951 12.3252 16.0228 3.8531 Constraint (T0311)R8.CB (T0311)L76.CB 12.7352 21.2253 27.5929 3.8531 Constraint (T0311)R8.CB (T0311)A73.CB 10.1295 16.8825 21.9473 3.8531 Constraint (T0311)R8.CB (T0311)Q71.CB 11.7520 19.5866 25.4626 3.8531 Constraint (T0311)N21.CB (T0311)D84.CB 8.9532 14.9221 19.3987 3.8465 Constraint (T0311)I33.CB (T0311)W74.CB 10.4187 17.3645 22.5739 3.7923 Constraint (T0311)P64.CB (T0311)R89.CB 9.9311 16.5518 21.5173 3.7852 Constraint (T0311)Q71.CB (T0311)S86.CB 9.6886 16.1476 20.9919 3.7028 Constraint (T0311)L17.CB (T0311)V85.CB 9.0472 15.0786 19.6022 3.6683 Constraint (T0311)I13.CB (T0311)S86.CB 9.4663 15.7771 20.5102 3.5968 Constraint (T0311)V59.CB (T0311)L91.CB 12.4158 20.6930 26.9010 3.5634 Constraint (T0311)K55.CB (T0311)R89.CB 12.7282 21.2136 27.5777 3.5576 Constraint (T0311)M52.CB (T0311)R89.CB 12.1310 20.2183 26.2838 3.5576 Constraint (T0311)A47.CB (T0311)R89.CB 11.4279 19.0464 24.7604 3.5576 Constraint (T0311)A46.CB (T0311)D84.CB 11.4724 19.1206 24.8568 3.5531 Constraint (T0311)A46.CB (T0311)V92.CB 10.9251 18.2084 23.6710 3.5499 Constraint (T0311)A46.CB (T0311)L91.CB 12.2733 20.4555 26.5922 3.5499 Constraint (T0311)V58.CB (T0311)R89.CB 12.7625 21.2708 27.6521 3.4539 Constraint (T0311)I13.CB (T0311)W74.CB 10.2369 17.0615 22.1799 3.4431 Constraint (T0311)Q65.CB (T0311)L91.CB 9.3463 15.5772 20.2503 3.4028 Constraint (T0311)M31.CB (T0311)L91.CB 11.0682 18.4469 23.9810 3.3952 Constraint (T0311)P35.CB (T0311)R90.CB 10.6180 17.6967 23.0057 3.3818 Constraint (T0311)E26.CB (T0311)L91.CB 10.2188 17.0314 22.1408 3.3818 Constraint (T0311)E26.CB (T0311)R90.CB 11.2758 18.7930 24.4310 3.3818 Constraint (T0311)R25.CB (T0311)L91.CB 9.0735 15.1225 19.6593 3.3818 Constraint (T0311)R25.CB (T0311)R90.CB 10.6282 17.7136 23.0277 3.3818 Constraint (T0311)L24.CB (T0311)R90.CB 8.9641 14.9402 19.4223 3.3818 Constraint (T0311)S23.CB (T0311)L91.CB 8.2340 13.7234 17.8404 3.3818 Constraint (T0311)S23.CB (T0311)R90.CB 9.2898 15.4829 20.1278 3.3818 Constraint (T0311)V22.CB (T0311)L91.CB 9.9665 16.6109 21.5941 3.3818 Constraint (T0311)E32.CB (T0311)V85.CB 12.0478 20.0797 26.1036 3.3740 Constraint (T0311)R29.CB (T0311)R89.CB 11.7234 19.5390 25.4006 3.3740 Constraint (T0311)I60.CB (T0311)R89.CB 11.1128 18.5214 24.0778 3.3601 Constraint (T0311)I60.CB (T0311)L88.CB 11.2123 18.6872 24.2934 3.3601 Constraint (T0311)N5.CB (T0311)A53.CB 11.0870 18.4783 24.0218 3.3388 Constraint (T0311)N5.CB (T0311)M52.CB 12.9977 21.6628 28.1616 3.3388 Constraint (T0311)N5.CB (T0311)P50.CB 12.7480 21.2467 27.6206 3.3388 Constraint (T0311)N5.CB (T0311)T49.CB 12.1321 20.2202 26.2863 3.3388 Constraint (T0311)N5.CB (T0311)L48.CB 10.6207 17.7012 23.0115 3.3388 Constraint (T0311)N5.CB (T0311)A47.CB 8.9965 14.9941 19.4924 3.3388 Constraint (T0311)N5.CB (T0311)K45.CB 9.8897 16.4828 21.4276 3.3388 Constraint (T0311)N5.CB (T0311)T43.CB 9.5882 15.9803 20.7744 3.3388 Constraint (T0311)N5.CB (T0311)L42.CB 9.2568 15.4280 20.0564 3.3388 Constraint (T0311)N5.CB (T0311)L41.CB 9.6949 16.1581 21.0055 3.3388 Constraint (T0311)N5.CB (T0311)R40.CB 11.0723 18.4538 23.9900 3.3388 Constraint (T0311)N5.CB (T0311)S39.CB 12.1950 20.3250 26.4225 3.3388 Constraint (T0311)N5.CB (T0311)A38.CB 12.1869 20.3114 26.4049 3.3388 Constraint (T0311)N5.CB (T0311)T37.CB 12.8600 21.4333 27.8633 3.3388 Constraint (T0311)N5.CB (T0311)F27.CB 13.3555 22.2591 28.9369 3.3388 Constraint (T0311)N5.CB (T0311)L24.CB 13.4179 22.3632 29.0721 3.3388 Constraint (T0311)N5.CB (T0311)L17.CB 11.5813 19.3022 25.0928 3.3388 Constraint (T0311)N5.CB (T0311)S16.CB 10.2087 17.0144 22.1188 3.3388 Constraint (T0311)N5.CB (T0311)E15.CB 8.5700 14.2834 18.5684 3.3388 Constraint (T0311)N5.CB (T0311)Q14.CB 8.7535 14.5891 18.9658 3.3388 Constraint (T0311)A73.CB (T0311)R90.CB 10.9065 18.1775 23.6308 3.3315 Constraint (T0311)N72.CB (T0311)L91.CB 11.5937 19.3228 25.1197 3.3315 Constraint (T0311)N72.CB (T0311)R90.CB 10.6172 17.6953 23.0040 3.3315 Constraint (T0311)E78.CB (T0311)T93.CB 9.5403 15.9004 20.6706 3.3296 Constraint (T0311)S75.CB (T0311)V92.CB 8.5593 14.2655 18.5451 3.3296 Constraint (T0311)W74.CB (T0311)V92.CB 9.9992 16.6653 21.6648 3.3296 Constraint (T0311)W74.CB (T0311)L91.CB 10.6167 17.6945 23.0028 3.3296 Constraint (T0311)W74.CB (T0311)R90.CB 9.5648 15.9414 20.7238 3.3296 Constraint (T0311)A30.CB (T0311)V92.CB 13.3014 22.1690 28.8197 3.3181 Constraint (T0311)L70.CB (T0311)D84.CB 10.4251 17.3752 22.5878 3.3112 Constraint (T0311)N69.CB (T0311)D84.CB 11.0609 18.4348 23.9653 3.3112 Constraint (T0311)R29.CB (T0311)Q65.CB 10.6655 17.7758 23.1086 3.3076 Constraint (T0311)R25.CB (T0311)Q65.CB 9.9586 16.5977 21.5770 3.3076 Constraint (T0311)W74.CB (T0311)R89.CB 11.2794 18.7989 24.4386 3.2961 Constraint (T0311)N21.CB (T0311)S86.CB 10.0842 16.8070 21.8491 3.2635 Constraint (T0311)E19.CB (T0311)L88.CB 10.2838 17.1397 22.2816 3.2611 Constraint (T0311)E19.CB (T0311)R87.CB 9.2668 15.4447 20.0781 3.2611 Constraint (T0311)L20.CB (T0311)T82.CB 10.4679 17.4466 22.6805 3.2146 Constraint (T0311)I13.CB (T0311)R87.CB 9.0457 15.0761 19.5990 3.1920 Constraint (T0311)I13.CB (T0311)V85.CB 9.7474 16.2456 21.1193 3.1920 Constraint (T0311)L17.CB (T0311)L88.CB 9.4474 15.7457 20.4694 3.1901 Constraint (T0311)S16.CB (T0311)R89.CB 10.9310 18.2183 23.6838 3.1901 Constraint (T0311)E15.CB (T0311)R89.CB 10.1737 16.9561 22.0430 3.1901 Constraint (T0311)Q14.CB (T0311)R89.CB 9.2923 15.4871 20.1333 3.1901 Constraint (T0311)Q14.CB (T0311)L88.CB 8.5587 14.2645 18.5439 3.1901 Constraint (T0311)Q14.CB (T0311)R87.CB 6.7470 11.2451 14.6186 3.1901 Constraint (T0311)I12.CB (T0311)R89.CB 10.7252 17.8753 23.2379 3.1901 Constraint (T0311)A30.CB (T0311)A73.CB 9.1116 15.1860 19.7418 3.1277 Constraint (T0311)E19.CB (T0311)V85.CB 9.4589 15.7649 20.4944 3.0726 Constraint (T0311)F27.CB (T0311)Q94.CB 12.7576 21.2627 27.6415 3.0562 Constraint (T0311)R25.CB (T0311)Q94.CB 12.2783 20.4638 26.6029 3.0562 Constraint (T0311)L24.CB (T0311)S95.CB 12.2703 20.4504 26.5856 3.0562 Constraint (T0311)S23.CB (T0311)S95.CB 12.2027 20.3379 26.4393 3.0562 Constraint (T0311)S23.CB (T0311)Q94.CB 11.3966 18.9944 24.6927 3.0562 Constraint (T0311)V22.CB (T0311)Q94.CB 12.3149 20.5249 26.6823 3.0562 Constraint (T0311)V59.CB (T0311)R89.CB 11.5999 19.3332 25.1332 3.0269 Constraint (T0311)P9.CB (T0311)A79.CB 13.3698 22.2830 28.9679 3.0163 Constraint (T0311)E19.CB (T0311)R90.CB 12.4991 20.8318 27.0813 3.0007 Constraint (T0311)P7.CB (T0311)L68.CB 5.9356 9.8927 12.8605 3.0000 Constraint (T0311)P7.CB (T0311)W67.CB 5.1750 8.6251 11.2126 3.0000 Constraint (T0311)P7.CB (T0311)M66.CB 6.1714 10.2856 13.3713 3.0000 Constraint (T0311)P7.CB (T0311)Q65.CB 7.6938 12.8230 16.6698 3.0000 Constraint (T0311)P7.CB (T0311)P64.CB 8.3841 13.9736 18.1656 3.0000 Constraint (T0311)P7.CB (T0311)S63.CB 9.1242 15.2071 19.7692 3.0000 Constraint (T0311)P7.CB (T0311)S62.CB 8.0537 13.4228 17.4497 3.0000 Constraint (T0311)P7.CB (T0311)I60.CB 8.5912 14.3187 18.6143 3.0000 Constraint (T0311)P7.CB (T0311)V59.CB 11.2329 18.7216 24.3380 3.0000 Constraint (T0311)P7.CB (T0311)V58.CB 11.7650 19.6083 25.4908 3.0000 Constraint (T0311)P7.CB (T0311)L20.CB 10.2335 17.0559 22.1726 3.0000 Constraint (T0311)H6.CB (T0311)L68.CB 6.1345 10.2241 13.2913 3.0000 Constraint (T0311)H6.CB (T0311)W67.CB 7.1212 11.8686 15.4292 3.0000 Constraint (T0311)H6.CB (T0311)M66.CB 8.2761 13.7934 17.9315 3.0000 Constraint (T0311)H6.CB (T0311)Q65.CB 8.5226 14.2043 18.4656 3.0000 Constraint (T0311)H6.CB (T0311)P64.CB 9.4430 15.7383 20.4598 3.0000 Constraint (T0311)H6.CB (T0311)S63.CB 10.6036 17.6726 22.9744 3.0000 Constraint (T0311)H6.CB (T0311)S62.CB 10.4626 17.4376 22.6689 3.0000 Constraint (T0311)H6.CB (T0311)I60.CB 11.4070 19.0117 24.7153 3.0000 Constraint (T0311)H6.CB (T0311)S57.CB 10.7354 17.8923 23.2600 3.0000 Constraint (T0311)H6.CB (T0311)L56.CB 11.0450 18.4084 23.9309 3.0000 Constraint (T0311)H6.CB (T0311)M52.CB 12.6137 21.0228 27.3296 3.0000 Constraint (T0311)H6.CB (T0311)A46.CB 11.4732 19.1220 24.8586 3.0000 Constraint (T0311)H6.CB (T0311)L20.CB 13.5519 22.5865 29.3625 3.0000 Constraint (T0311)N5.CB (T0311)L68.CB 8.4486 14.0811 18.3054 3.0000 Constraint (T0311)N5.CB (T0311)W67.CB 8.2848 13.8080 17.9504 3.0000 Constraint (T0311)N5.CB (T0311)M66.CB 9.8069 16.3449 21.2483 3.0000 Constraint (T0311)N5.CB (T0311)Q65.CB 10.8833 18.1388 23.5804 3.0000 Constraint (T0311)N5.CB (T0311)P64.CB 11.2967 18.8278 24.4762 3.0000 Constraint (T0311)N5.CB (T0311)S63.CB 12.5756 20.9594 27.2472 3.0000 Constraint (T0311)N5.CB (T0311)S62.CB 11.6977 19.4962 25.3451 3.0000 Constraint (T0311)N5.CB (T0311)I60.CB 11.8466 19.7444 25.6677 3.0000 Constraint (T0311)N5.CB (T0311)S57.CB 11.9903 19.9838 25.9789 3.0000 Constraint (T0311)N5.CB (T0311)L56.CB 11.5441 19.2402 25.0123 3.0000 Constraint (T0311)N5.CB (T0311)A46.CB 10.6663 17.7772 23.1103 3.0000 Constraint (T0311)N5.CB (T0311)L20.CB 13.5338 22.5563 29.3232 3.0000 Constraint (T0311)N5.CB (T0311)E19.CB 11.6852 19.4753 25.3179 3.0000 Constraint (T0311)N5.CB (T0311)D18.CB 11.5270 19.2117 24.9752 3.0000 Constraint (T0311)Q65.CB (T0311)R90.CB 10.1456 16.9093 21.9821 2.9980 Constraint (T0311)N21.CB (T0311)A47.CB 12.2509 20.4181 26.5436 2.9886 Constraint (T0311)I54.CB (T0311)R89.CB 11.8498 19.7496 25.6745 2.9846 Constraint (T0311)A53.CB (T0311)R89.CB 10.6527 17.7545 23.0809 2.9846 Constraint (T0311)K45.CB (T0311)S95.CB 11.6960 19.4934 25.3414 2.9827 Constraint (T0311)K45.CB (T0311)Q94.CB 9.3037 15.5062 20.1580 2.9827 Constraint (T0311)K45.CB (T0311)T93.CB 8.1381 13.5635 17.6325 2.9827 Constraint (T0311)T43.CB (T0311)S95.CB 10.9000 18.1666 23.6166 2.9827 Constraint (T0311)T43.CB (T0311)Q94.CB 8.5825 14.3042 18.5954 2.9827 Constraint (T0311)T43.CB (T0311)T93.CB 6.6246 11.0411 14.3534 2.9827 Constraint (T0311)L42.CB (T0311)S95.CB 13.1426 21.9043 28.4756 2.9827 Constraint (T0311)L42.CB (T0311)Q94.CB 10.7713 17.9522 23.3378 2.9827 Constraint (T0311)L42.CB (T0311)T93.CB 8.5025 14.1708 18.4220 2.9827 Constraint (T0311)L41.CB (T0311)Q94.CB 11.2072 18.6787 24.2823 2.9827 Constraint (T0311)L41.CB (T0311)T93.CB 9.5097 15.8496 20.6044 2.9827 Constraint (T0311)R40.CB (T0311)S95.CB 12.7015 21.1692 27.5200 2.9827 Constraint (T0311)R40.CB (T0311)Q94.CB 9.9424 16.5707 21.5419 2.9827 Constraint (T0311)R40.CB (T0311)T93.CB 9.0179 15.0298 19.5388 2.9827 Constraint (T0311)S39.CB (T0311)Q94.CB 9.6890 16.1483 20.9928 2.9827 Constraint (T0311)S39.CB (T0311)T93.CB 8.1998 13.6663 17.7662 2.9827 Constraint (T0311)A38.CB (T0311)Q94.CB 11.7316 19.5527 25.4185 2.9827 Constraint (T0311)A38.CB (T0311)T93.CB 10.0853 16.8089 21.8516 2.9827 Constraint (T0311)T37.CB (T0311)Q94.CB 11.7149 19.5248 25.3823 2.9827 Constraint (T0311)T37.CB (T0311)T93.CB 10.8754 18.1257 23.5634 2.9827 Constraint (T0311)S36.CB (T0311)Q94.CB 10.4765 17.4609 22.6992 2.9827 Constraint (T0311)S36.CB (T0311)T93.CB 10.0211 16.7019 21.7125 2.9827 Constraint (T0311)P35.CB (T0311)T93.CB 10.7727 17.9546 23.3410 2.9827 Constraint (T0311)A34.CB (T0311)Q94.CB 12.4008 20.6680 26.8684 2.9827 Constraint (T0311)A34.CB (T0311)T93.CB 11.8263 19.7105 25.6237 2.9827 Constraint (T0311)I33.CB (T0311)Q94.CB 13.2823 22.1372 28.7783 2.9827 Constraint (T0311)I33.CB (T0311)T93.CB 12.1757 20.2928 26.3807 2.9827 Constraint (T0311)A28.CB (T0311)T93.CB 11.9889 19.9815 25.9759 2.9827 Constraint (T0311)F27.CB (T0311)T93.CB 11.9054 19.8423 25.7950 2.9827 Constraint (T0311)L68.CB (T0311)D84.CB 10.0330 16.7217 21.7382 2.9777 Constraint (T0311)R29.CB (T0311)V92.CB 12.2709 20.4515 26.5870 2.9769 Constraint (T0311)R25.CB (T0311)V92.CB 8.9351 14.8919 19.3594 2.9769 Constraint (T0311)L24.CB (T0311)V92.CB 6.8781 11.4635 14.9026 2.9769 Constraint (T0311)S23.CB (T0311)V92.CB 8.2458 13.7431 17.8660 2.9769 Constraint (T0311)W67.CB (T0311)L91.CB 9.0415 15.0691 19.5899 2.9759 Constraint (T0311)W67.CB (T0311)R89.CB 9.7834 16.3057 21.1974 2.9759 Constraint (T0311)M66.CB (T0311)R89.CB 10.5646 17.6077 22.8900 2.9759 Constraint (T0311)L70.CB (T0311)R89.CB 9.4433 15.7388 20.4604 2.9758 Constraint (T0311)L70.CB (T0311)L88.CB 8.8449 14.7415 19.1639 2.9758 Constraint (T0311)N69.CB (T0311)L91.CB 10.4143 17.3572 22.5644 2.9758 Constraint (T0311)N69.CB (T0311)R90.CB 9.9391 16.5651 21.5347 2.9758 Constraint (T0311)N69.CB (T0311)R89.CB 10.9440 18.2400 23.7120 2.9758 Constraint (T0311)N69.CB (T0311)L88.CB 9.9910 16.6516 21.6471 2.9758 Constraint (T0311)L70.CB (T0311)V92.CB 10.8479 18.0798 23.5038 2.9045 Constraint (T0311)N21.CB (T0311)L88.CB 10.5291 17.5484 22.8129 2.8587 Constraint (T0311)N21.CB (T0311)R87.CB 9.4231 15.7052 20.4168 2.8587 Constraint (T0311)D11.CB (T0311)D84.CB 10.0149 16.6916 21.6990 2.8582 Constraint (T0311)P9.CB (T0311)N72.CB 11.8415 19.7358 25.6565 2.8367 Constraint (T0311)P9.CB (T0311)N69.CB 6.5076 10.8460 14.0998 2.8367 Constraint (T0311)R8.CB (T0311)A77.CB 11.3375 18.8958 24.5645 2.8367 Constraint (T0311)R8.CB (T0311)S75.CB 13.2930 22.1550 28.8015 2.8367 Constraint (T0311)R8.CB (T0311)W74.CB 10.5985 17.6641 22.9634 2.8367 Constraint (T0311)R8.CB (T0311)N72.CB 11.5718 19.2863 25.0722 2.8367 Constraint (T0311)R8.CB (T0311)L70.CB 5.0400 8.4000 10.9200 2.8367 Constraint (T0311)R8.CB (T0311)N69.CB 6.8401 11.4002 14.8203 2.8367 Constraint (T0311)V59.CB (T0311)R90.CB 11.8456 19.7427 25.6656 2.8354 Constraint (T0311)A34.CB (T0311)W74.CB 11.7125 19.5208 25.3771 2.7923 Constraint (T0311)A28.CB (T0311)W74.CB 10.0020 16.6700 21.6710 2.7923 Constraint (T0311)S63.CB (T0311)R89.CB 11.8589 19.7649 25.6943 2.7872 Constraint (T0311)S62.CB (T0311)R89.CB 10.8387 18.0645 23.4838 2.7872 Constraint (T0311)D11.CB (T0311)R87.CB 10.1668 16.9446 22.0280 2.7644 Constraint (T0311)Q71.CB (T0311)L91.CB 10.7825 17.9709 23.3621 2.7363 Constraint (T0311)Q71.CB (T0311)R90.CB 10.5567 17.5945 22.8729 2.7363 Constraint (T0311)E19.CB (T0311)S86.CB 9.5834 15.9723 20.7640 2.6678 Constraint (T0311)E78.CB (T0311)S95.CB 10.6657 17.7761 23.1089 2.6629 Constraint (T0311)E78.CB (T0311)Q94.CB 10.8019 18.0031 23.4040 2.6629 Constraint (T0311)A77.CB (T0311)S95.CB 12.0487 20.0812 26.1055 2.6629 Constraint (T0311)A77.CB (T0311)Q94.CB 11.8626 19.7711 25.7024 2.6629 Constraint (T0311)A77.CB (T0311)T93.CB 10.0010 16.6683 21.6688 2.6629 Constraint (T0311)L76.CB (T0311)T93.CB 8.8194 14.6991 19.1088 2.6629 Constraint (T0311)S75.CB (T0311)S95.CB 10.0348 16.7246 21.7420 2.6629 Constraint (T0311)S75.CB (T0311)T93.CB 7.7141 12.8568 16.7139 2.6629 Constraint (T0311)W74.CB (T0311)S95.CB 11.4965 19.1608 24.9091 2.6629 Constraint (T0311)W74.CB (T0311)Q94.CB 11.6236 19.3727 25.1844 2.6629 Constraint (T0311)W74.CB (T0311)T93.CB 9.0602 15.1004 19.6305 2.6629 Constraint (T0311)E26.CB (T0311)T93.CB 12.1506 20.2510 26.3263 2.6514 Constraint (T0311)S23.CB (T0311)T93.CB 10.6023 17.6706 22.9717 2.6514 Constraint (T0311)V22.CB (T0311)T93.CB 11.2808 18.8013 24.4417 2.6514 Constraint (T0311)D18.CB (T0311)S86.CB 7.9097 13.1828 17.1377 2.5968 Constraint (T0311)L17.CB (T0311)S86.CB 7.4038 12.3396 16.0415 2.5968 Constraint (T0311)P64.CB (T0311)R90.CB 9.0637 15.1061 19.6379 2.5938 Constraint (T0311)W67.CB (T0311)R90.CB 8.9353 14.8922 19.3599 2.5710 Constraint (T0311)A53.CB (T0311)L91.CB 11.3454 18.9091 24.5818 2.5653 Constraint (T0311)M52.CB (T0311)L91.CB 11.7925 19.6541 25.5503 2.5653 Constraint (T0311)L48.CB (T0311)L91.CB 10.8991 18.1652 23.6148 2.5653 Constraint (T0311)A47.CB (T0311)L91.CB 11.2669 18.7782 24.4116 2.5653 Constraint (T0311)A46.CB (T0311)T96.CB 12.2699 20.4499 26.5848 2.5576 Constraint (T0311)K45.CB (T0311)T96.CB 11.8004 19.6673 25.5675 2.5576 Constraint (T0311)R25.CB (T0311)L68.CB 11.0466 18.4109 23.9342 2.5479 Constraint (T0311)N21.CB (T0311)L91.CB 12.1281 20.2135 26.2775 2.4050 Constraint (T0311)L20.CB (T0311)L91.CB 12.5017 20.8361 27.0870 2.4050 Constraint (T0311)L20.CB (T0311)R90.CB 12.5922 20.9870 27.2831 2.4050 Constraint (T0311)E19.CB (T0311)L91.CB 12.7945 21.3241 27.7214 2.4050 Constraint (T0311)D11.CB (T0311)S75.CB 11.1600 18.6000 24.1801 2.4048 Constraint (T0311)M66.CB (T0311)L91.CB 7.8014 13.0024 16.9031 2.4029 Constraint (T0311)I33.CB (T0311)R90.CB 12.0504 20.0841 26.1093 2.4029 Constraint (T0311)E32.CB (T0311)L91.CB 11.1449 18.5749 24.1474 2.4029 Constraint (T0311)E32.CB (T0311)R90.CB 12.1713 20.2855 26.3712 2.4029 Constraint (T0311)M31.CB (T0311)R90.CB 11.2189 18.6982 24.3077 2.4029 Constraint (T0311)I12.CB (T0311)L91.CB 11.0514 18.4190 23.9447 2.4029 Constraint (T0311)Q71.CB (T0311)R89.CB 10.8914 18.1523 23.5980 2.4028 Constraint (T0311)I33.CB (T0311)L91.CB 9.5708 15.9514 20.7368 2.3952 Constraint (T0311)A30.CB (T0311)L91.CB 10.9239 18.2064 23.6684 2.3952 Constraint (T0311)S39.CB (T0311)S95.CB 11.3108 18.8513 24.5067 2.3894 Constraint (T0311)S36.CB (T0311)S95.CB 12.2791 20.4652 26.6048 2.3894 Constraint (T0311)P35.CB (T0311)S95.CB 12.3649 20.6082 26.7906 2.3894 Constraint (T0311)P35.CB (T0311)Q94.CB 10.6810 17.8016 23.1421 2.3894 Constraint (T0311)A28.CB (T0311)Q94.CB 12.6016 21.0026 27.3034 2.3894 Constraint (T0311)L24.CB (T0311)Q94.CB 10.2106 17.0177 22.1230 2.3894 Constraint (T0311)N21.CB (T0311)R90.CB 12.5272 20.8787 27.1424 2.3340 Constraint (T0311)A73.CB (T0311)V92.CB 10.6114 17.6857 22.9914 2.3315 Constraint (T0311)A73.CB (T0311)L91.CB 11.0682 18.4470 23.9810 2.3315 Constraint (T0311)N72.CB (T0311)V92.CB 10.1067 16.8445 21.8979 2.3315 Constraint (T0311)Q71.CB (T0311)V92.CB 9.8536 16.4227 21.3495 2.3315 Constraint (T0311)N69.CB (T0311)V92.CB 10.9349 18.2248 23.6922 2.3315 Constraint (T0311)L68.CB (T0311)V92.CB 10.7682 17.9470 23.3311 2.3315 Constraint (T0311)D18.CB (T0311)V92.CB 13.0744 21.7906 28.3278 2.3315 Constraint (T0311)S16.CB (T0311)V92.CB 13.1607 21.9344 28.5148 2.3315 Constraint (T0311)E19.CB (T0311)R89.CB 10.8776 18.1293 23.5681 2.2630 Constraint (T0311)T82.CB (T0311)T96.CB 10.7024 17.8373 23.1885 2.2378 Constraint (T0311)N21.CB (T0311)R89.CB 11.1648 18.6080 24.1904 2.1920 Constraint (T0311)D18.CB (T0311)R89.CB 9.0214 15.0356 19.5463 2.1920 Constraint (T0311)L17.CB (T0311)R89.CB 8.9619 14.9365 19.4175 2.1920 Constraint (T0311)I13.CB (T0311)R89.CB 9.9167 16.5278 21.4862 2.1920 Constraint (T0311)I13.CB (T0311)L88.CB 9.5335 15.8892 20.6559 2.1920 Constraint (T0311)D11.CB (T0311)S86.CB 8.8763 14.7939 19.2321 2.1914 Constraint (T0311)D11.CB (T0311)V85.CB 10.1787 16.9645 22.0539 2.1914 Constraint (T0311)I60.CB (T0311)R90.CB 11.6393 19.3989 25.2185 2.1687 Constraint (T0311)V58.CB (T0311)R90.CB 11.7382 19.5637 25.4328 2.1687 Constraint (T0311)S57.CB (T0311)R90.CB 10.9860 18.3100 23.8030 2.1687 Constraint (T0311)K55.CB (T0311)R90.CB 10.8854 18.1424 23.5851 2.1687 Constraint (T0311)A30.CB (T0311)N72.CB 8.5336 14.2227 18.4895 2.1431 Constraint (T0311)R29.CB (T0311)N72.CB 10.9713 18.2854 23.7711 2.1431 Constraint (T0311)L20.CB (T0311)R87.CB 11.1649 18.6082 24.1906 2.0715 Constraint (T0311)L20.CB (T0311)D84.CB 10.0582 16.7636 21.7927 2.0715 Constraint (T0311)P9.CB (T0311)E80.CB 12.6138 21.0229 27.3298 2.0163 Constraint (T0311)N21.CB (T0311)T49.CB 13.6347 22.7244 29.5418 2.0002 Constraint (T0311)E19.CB (T0311)V92.CB 11.7778 19.6297 25.5186 2.0002 Constraint (T0311)D18.CB (T0311)R90.CB 11.3285 18.8809 24.5451 1.9986 Constraint (T0311)L17.CB (T0311)R90.CB 11.2860 18.8100 24.4529 1.9986 Constraint (T0311)S16.CB (T0311)R90.CB 11.0967 18.4945 24.0428 1.9986 Constraint (T0311)E15.CB (T0311)R90.CB 10.1127 16.8545 21.9109 1.9986 Constraint (T0311)Q14.CB (T0311)R90.CB 9.4199 15.6999 20.4099 1.9986 Constraint (T0311)I12.CB (T0311)R90.CB 10.0868 16.8114 21.8548 1.9986 Constraint (T0311)W67.CB (T0311)V92.CB 9.7045 16.1742 21.0265 1.9981 Constraint (T0311)M66.CB (T0311)V92.CB 9.4246 15.7076 20.4199 1.9981 Constraint (T0311)Q65.CB (T0311)V92.CB 9.2122 15.3536 19.9597 1.9981 Constraint (T0311)P64.CB (T0311)V92.CB 8.4379 14.0631 18.2821 1.9981 Constraint (T0311)P64.CB (T0311)L91.CB 6.3856 10.6427 13.8355 1.9981 Constraint (T0311)N72.CB (T0311)R89.CB 11.1295 18.5491 24.1138 1.9980 Constraint (T0311)N72.CB (T0311)L88.CB 10.6978 17.8297 23.1786 1.9980 Constraint (T0311)S57.CB (T0311)L91.CB 11.1487 18.5812 24.1555 1.9923 Constraint (T0311)S57.CB (T0311)T93.CB 13.4369 22.3948 29.1133 1.9846 Constraint (T0311)L56.CB (T0311)Q94.CB 13.2980 22.1633 28.8122 1.9846 Constraint (T0311)L56.CB (T0311)T93.CB 12.0116 20.0194 26.0252 1.9846 Constraint (T0311)A53.CB (T0311)T93.CB 13.2089 22.0148 28.6193 1.9846 Constraint (T0311)L48.CB (T0311)Q94.CB 12.0674 20.1124 26.1461 1.9846 Constraint (T0311)L48.CB (T0311)T93.CB 12.1775 20.2959 26.3846 1.9846 Constraint (T0311)A47.CB (T0311)S95.CB 13.6121 22.6868 29.4929 1.9846 Constraint (T0311)A47.CB (T0311)Q94.CB 10.4596 17.4327 22.6625 1.9846 Constraint (T0311)A47.CB (T0311)T93.CB 11.4860 19.1433 24.8863 1.9846 Constraint (T0311)A46.CB (T0311)S95.CB 12.7173 21.1955 27.5541 1.9846 Constraint (T0311)A46.CB (T0311)Q94.CB 9.4372 15.7287 20.4473 1.9846 Constraint (T0311)A46.CB (T0311)T93.CB 10.2891 17.1486 22.2931 1.9846 Constraint (T0311)T43.CB (T0311)T96.CB 10.7415 17.9024 23.2732 1.9846 Constraint (T0311)L42.CB (T0311)T96.CB 13.3764 22.2940 28.9822 1.9846 Constraint (T0311)S39.CB (T0311)T96.CB 12.1433 20.2388 26.3105 1.9846 Constraint (T0311)S36.CB (T0311)T96.CB 13.7254 22.8756 29.7383 1.9846 Constraint (T0311)R29.CB (T0311)T93.CB 13.7625 22.9375 29.8188 1.9846 Constraint (T0311)R25.CB (T0311)T93.CB 10.5743 17.6239 22.9110 1.9846 Constraint (T0311)L24.CB (T0311)T93.CB 8.0505 13.4174 17.4427 1.9846 Constraint (T0311)Q71.CB (T0311)L88.CB 8.7251 14.5418 18.9044 1.9759 Constraint (T0311)L70.CB (T0311)L91.CB 7.5520 12.5867 16.3627 1.9759 Constraint (T0311)L70.CB (T0311)R90.CB 7.4563 12.4272 16.1554 1.9759 Constraint (T0311)L68.CB (T0311)L91.CB 9.4088 15.6814 20.3858 1.9759 Constraint (T0311)L68.CB (T0311)R90.CB 10.3264 17.2107 22.3739 1.9759 Constraint (T0311)L68.CB (T0311)R89.CB 10.7567 17.9278 23.3062 1.9759 Constraint (T0311)L68.CB (T0311)V85.CB 8.8592 14.7654 19.1950 1.9759 Constraint (T0311)L20.CB (T0311)V85.CB 8.3443 13.9072 18.0794 1.8812 Constraint (T0311)E32.CB (T0311)W74.CB 8.6834 14.4724 18.8141 1.7942 Constraint (T0311)E32.CB (T0311)A73.CB 7.6687 12.7811 16.6154 1.7942 Constraint (T0311)R29.CB (T0311)W74.CB 10.1767 16.9611 22.0494 1.7942 Constraint (T0311)R29.CB (T0311)A73.CB 9.0224 15.0373 19.5485 1.7942 Constraint (T0311)R25.CB (T0311)W74.CB 11.3496 18.9161 24.5909 1.7942 Constraint (T0311)A79.CB (T0311)P97.CB 10.3058 17.1763 22.3292 1.6648 Constraint (T0311)A79.CB (T0311)T96.CB 9.6807 16.1346 20.9749 1.6648 Constraint (T0311)L76.CB (T0311)T96.CB 12.0730 20.1217 26.1582 1.6648 Constraint (T0311)S75.CB (T0311)P97.CB 11.6055 19.3425 25.1452 1.6648 Constraint (T0311)S75.CB (T0311)T96.CB 10.6393 17.7321 23.0518 1.6648 Constraint (T0311)S75.CB (T0311)Q94.CB 7.9681 13.2801 17.2641 1.6648 Constraint (T0311)A73.CB (T0311)S95.CB 12.9569 21.5948 28.0733 1.6648 Constraint (T0311)A73.CB (T0311)Q94.CB 12.7893 21.3155 27.7102 1.6648 Constraint (T0311)A73.CB (T0311)T93.CB 10.9489 18.2482 23.7226 1.6648 Constraint (T0311)N72.CB (T0311)P97.CB 11.6156 19.3594 25.1672 1.6648 Constraint (T0311)N72.CB (T0311)T96.CB 10.2202 17.0337 22.1438 1.6648 Constraint (T0311)N72.CB (T0311)S95.CB 11.3032 18.8386 24.4902 1.6648 Constraint (T0311)N72.CB (T0311)Q94.CB 11.7303 19.5506 25.4157 1.6648 Constraint (T0311)N72.CB (T0311)T93.CB 9.9281 16.5468 21.5108 1.6648 Constraint (T0311)Q71.CB (T0311)P97.CB 10.2128 17.0213 22.1277 1.6648 Constraint (T0311)Q71.CB (T0311)T96.CB 9.1021 15.1701 19.7211 1.6648 Constraint (T0311)Q71.CB (T0311)S95.CB 10.1272 16.8787 21.9423 1.6648 Constraint (T0311)Q71.CB (T0311)Q94.CB 10.7437 17.9061 23.2779 1.6648 Constraint (T0311)Q71.CB (T0311)T93.CB 8.7831 14.6385 19.0300 1.6648 Constraint (T0311)L70.CB (T0311)S95.CB 11.4087 19.0145 24.7189 1.6648 Constraint (T0311)L70.CB (T0311)Q94.CB 11.4646 19.1077 24.8400 1.6648 Constraint (T0311)L70.CB (T0311)T93.CB 9.5421 15.9035 20.6745 1.6648 Constraint (T0311)N69.CB (T0311)S95.CB 11.4969 19.1614 24.9099 1.6648 Constraint (T0311)N69.CB (T0311)Q94.CB 11.8753 19.7921 25.7298 1.6648 Constraint (T0311)N69.CB (T0311)T93.CB 10.0553 16.7588 21.7864 1.6648 Constraint (T0311)L68.CB (T0311)P97.CB 9.9980 16.6633 21.6623 1.6648 Constraint (T0311)L68.CB (T0311)T96.CB 8.7991 14.6651 19.0647 1.6648 Constraint (T0311)L68.CB (T0311)S95.CB 9.7168 16.1946 21.0530 1.6648 Constraint (T0311)L68.CB (T0311)Q94.CB 10.8403 18.0671 23.4873 1.6648 Constraint (T0311)L68.CB (T0311)T93.CB 8.9849 14.9749 19.4673 1.6648 Constraint (T0311)D18.CB (T0311)T93.CB 12.6133 21.0221 27.3288 1.6648 Constraint (T0311)S62.CB (T0311)R90.CB 11.4690 19.1149 24.8494 1.5957 Constraint (T0311)K55.CB (T0311)L91.CB 11.0794 18.4657 24.0054 1.5730 Constraint (T0311)I54.CB (T0311)R90.CB 8.9316 14.8860 19.3518 1.5730 Constraint (T0311)A53.CB (T0311)R90.CB 9.0192 15.0320 19.5416 1.5730 Constraint (T0311)M52.CB (T0311)R90.CB 9.0806 15.1344 19.6747 1.5730 Constraint (T0311)E51.CB (T0311)R90.CB 8.6475 14.4125 18.7363 1.5730 Constraint (T0311)P50.CB (T0311)R90.CB 7.5921 12.6535 16.4495 1.5730 Constraint (T0311)T49.CB (T0311)L91.CB 10.3913 17.3189 22.5145 1.5730 Constraint (T0311)T49.CB (T0311)R90.CB 8.4691 14.1152 18.3497 1.5730 Constraint (T0311)T49.CB (T0311)R89.CB 10.3891 17.3151 22.5097 1.5730 Constraint (T0311)L48.CB (T0311)R90.CB 9.0579 15.0966 19.6255 1.5730 Constraint (T0311)A47.CB (T0311)R90.CB 9.5959 15.9931 20.7911 1.5730 Constraint (T0311)L70.CB (T0311)T96.CB 9.6025 16.0042 20.8055 1.5710 Constraint (T0311)V59.CB (T0311)T96.CB 13.2075 22.0125 28.6162 1.5710 Constraint (T0311)L20.CB (T0311)S86.CB 9.1067 15.1779 19.7312 1.4763 Constraint (T0311)E32.CB (T0311)R89.CB 11.5198 19.1996 24.9595 1.4029 Constraint (T0311)A30.CB (T0311)R90.CB 11.3718 18.9530 24.6389 1.4029 Constraint (T0311)D18.CB (T0311)L91.CB 12.0788 20.1313 26.1707 1.4029 Constraint (T0311)L17.CB (T0311)L91.CB 10.5599 17.5998 22.8798 1.4029 Constraint (T0311)S16.CB (T0311)L91.CB 10.3974 17.3289 22.5276 1.4029 Constraint (T0311)E15.CB (T0311)L91.CB 10.8469 18.0782 23.5017 1.4029 Constraint (T0311)Q14.CB (T0311)L91.CB 9.4705 15.7841 20.5194 1.4029 Constraint (T0311)R29.CB (T0311)R90.CB 11.9502 19.9170 25.8922 1.3971 Constraint (T0311)N21.CB (T0311)V92.CB 9.7433 16.2388 21.1104 1.3335 Constraint (T0311)L20.CB (T0311)V92.CB 10.4361 17.3935 22.6115 1.3335 Constraint (T0311)D11.CB (T0311)R89.CB 8.6594 14.4323 18.7619 1.1914 Constraint (T0311)D11.CB (T0311)L88.CB 9.1769 15.2948 19.8833 1.1914 Constraint (T0311)P35.CB (T0311)P97.CB 13.2022 22.0037 28.6048 1.0715 Constraint (T0311)M31.CB (T0311)S95.CB 12.4042 20.6737 26.8758 1.0715 Constraint (T0311)A30.CB (T0311)P97.CB 10.8239 18.0399 23.4518 1.0715 Constraint (T0311)A30.CB (T0311)T96.CB 11.2018 18.6696 24.2705 1.0715 Constraint (T0311)A30.CB (T0311)S95.CB 9.6058 16.0096 20.8125 1.0715 Constraint (T0311)A30.CB (T0311)Q94.CB 11.3419 18.9032 24.5741 1.0715 Constraint (T0311)R29.CB (T0311)P97.CB 10.9159 18.1931 23.6511 1.0715 Constraint (T0311)R29.CB (T0311)T96.CB 11.5312 19.2187 24.9844 1.0715 Constraint (T0311)R29.CB (T0311)S95.CB 10.5073 17.5122 22.7658 1.0715 Constraint (T0311)R29.CB (T0311)Q94.CB 12.6897 21.1495 27.4944 1.0715 Constraint (T0311)A28.CB (T0311)T96.CB 13.4943 22.4905 29.2376 1.0715 Constraint (T0311)A28.CB (T0311)S95.CB 12.6521 21.0869 27.4129 1.0715 Constraint (T0311)F27.CB (T0311)P97.CB 11.9313 19.8855 25.8511 1.0715 Constraint (T0311)F27.CB (T0311)T96.CB 12.1805 20.3009 26.3911 1.0715 Constraint (T0311)F27.CB (T0311)S95.CB 11.1462 18.5770 24.1501 1.0715 Constraint (T0311)E26.CB (T0311)P97.CB 8.9269 14.8781 19.3415 1.0715 Constraint (T0311)E26.CB (T0311)T96.CB 9.2820 15.4701 20.1111 1.0715 Constraint (T0311)E26.CB (T0311)S95.CB 8.4394 14.0656 18.2853 1.0715 Constraint (T0311)E26.CB (T0311)Q94.CB 10.1249 16.8749 21.9373 1.0715 Constraint (T0311)R25.CB (T0311)P97.CB 10.3448 17.2414 22.4138 1.0715 Constraint (T0311)R25.CB (T0311)T96.CB 10.9018 18.1696 23.6205 1.0715 Constraint (T0311)R25.CB (T0311)S95.CB 10.6429 17.7382 23.0596 1.0715 Constraint (T0311)L24.CB (T0311)P97.CB 12.1506 20.2510 26.3264 1.0715 Constraint (T0311)L24.CB (T0311)T96.CB 12.4999 20.8332 27.0831 1.0715 Constraint (T0311)S23.CB (T0311)P97.CB 8.9941 14.9902 19.4872 1.0715 Constraint (T0311)S23.CB (T0311)T96.CB 9.3684 15.6140 20.2982 1.0715 Constraint (T0311)V22.CB (T0311)P97.CB 9.6042 16.0070 20.8091 1.0715 Constraint (T0311)V22.CB (T0311)T96.CB 9.7968 16.3280 21.2264 1.0715 Constraint (T0311)V22.CB (T0311)S95.CB 8.8726 14.7876 19.2239 1.0715 Constraint (T0311)N21.CB (T0311)P97.CB 8.2864 13.8107 17.9539 1.0715 Constraint (T0311)N21.CB (T0311)T96.CB 8.1118 13.5196 17.5755 1.0715 Constraint (T0311)N21.CB (T0311)S95.CB 7.6392 12.7320 16.5516 1.0715 Constraint (T0311)N21.CB (T0311)Q94.CB 7.7286 12.8809 16.7452 1.0715 Constraint (T0311)L20.CB (T0311)P97.CB 10.3540 17.2567 22.4337 1.0715 Constraint (T0311)L20.CB (T0311)T96.CB 10.2911 17.1519 22.2975 1.0715 Constraint (T0311)L20.CB (T0311)S95.CB 8.9004 14.8340 19.2842 1.0715 Constraint (T0311)L20.CB (T0311)Q94.CB 9.0343 15.0571 19.5742 1.0715 Constraint (T0311)L20.CB (T0311)R89.CB 9.8677 16.4461 21.3800 1.0715 Constraint (T0311)L20.CB (T0311)L88.CB 8.8709 14.7849 19.2204 1.0715 Constraint (T0311)E19.CB (T0311)S95.CB 11.0189 18.3649 23.8744 1.0715 Constraint (T0311)E19.CB (T0311)Q94.CB 10.4917 17.4862 22.7320 1.0715 Constraint (T0311)D18.CB (T0311)S95.CB 11.4724 19.1207 24.8569 1.0715 Constraint (T0311)D18.CB (T0311)Q94.CB 11.2813 18.8021 24.4427 1.0715 Constraint (T0311)L17.CB (T0311)P97.CB 12.0072 20.0120 26.0156 1.0715 Constraint (T0311)L17.CB (T0311)T96.CB 11.9709 19.9515 25.9369 1.0715 Constraint (T0311)L17.CB (T0311)S95.CB 11.2002 18.6670 24.2671 1.0715 Constraint (T0311)L17.CB (T0311)Q94.CB 11.6854 19.4757 25.3184 1.0715 Constraint (T0311)S16.CB (T0311)S95.CB 12.4177 20.6962 26.9050 1.0715 Constraint (T0311)S16.CB (T0311)Q94.CB 12.4436 20.7394 26.9612 1.0715 Constraint (T0311)P9.CB (T0311)S75.CB 12.4107 20.6845 26.8899 1.0163 Constraint (T0311)R8.CB (T0311)R29.CB 13.0279 21.7131 28.2271 1.0163 Constraint (T0311)P7.CB (T0311)S36.CB 10.4630 17.4384 22.6699 1.0163 Constraint (T0311)P7.CB (T0311)P35.CB 11.0986 18.4977 24.0470 1.0163 Constraint (T0311)P7.CB (T0311)A34.CB 9.6273 16.0454 20.8591 1.0163 Constraint (T0311)P7.CB (T0311)E32.CB 7.5694 12.6157 16.4004 1.0163 Constraint (T0311)P7.CB (T0311)R29.CB 10.5266 17.5444 22.8077 1.0163 Constraint (T0311)P7.CB (T0311)E26.CB 11.4417 19.0696 24.7905 1.0163 Constraint (T0311)P7.CB (T0311)R25.CB 12.1531 20.2552 26.3318 1.0163 Constraint (T0311)H6.CB (T0311)E51.CB 12.5687 20.9479 27.2322 1.0163 Constraint (T0311)H6.CB (T0311)S39.CB 13.2850 22.1416 28.7841 1.0163 Constraint (T0311)H6.CB (T0311)T37.CB 9.7407 16.2344 21.1047 1.0163 Constraint (T0311)H6.CB (T0311)S36.CB 12.9068 21.5114 27.9648 1.0163 Constraint (T0311)H6.CB (T0311)P35.CB 13.5316 22.5527 29.3185 1.0163 Constraint (T0311)H6.CB (T0311)A34.CB 11.6725 19.4542 25.2904 1.0163 Constraint (T0311)H6.CB (T0311)I33.CB 8.8694 14.7823 19.2170 1.0163 Constraint (T0311)H6.CB (T0311)E32.CB 8.4933 14.1556 18.4022 1.0163 Constraint (T0311)H6.CB (T0311)M31.CB 7.8484 13.0807 17.0049 1.0163 Constraint (T0311)H6.CB (T0311)A30.CB 10.2444 17.0740 22.1962 1.0163 Constraint (T0311)H6.CB (T0311)R29.CB 12.1885 20.3142 26.4085 1.0163 Constraint (T0311)H6.CB (T0311)A28.CB 11.3711 18.9518 24.6373 1.0163 Constraint (T0311)H6.CB (T0311)F27.CB 10.8712 18.1186 23.5542 1.0163 Constraint (T0311)H6.CB (T0311)E26.CB 13.5477 22.5794 29.3533 1.0163 Constraint (T0311)H6.CB (T0311)L24.CB 13.4954 22.4923 29.2399 1.0163 Constraint (T0311)H6.CB (T0311)V22.CB 12.9978 21.6630 28.1619 1.0163 Constraint (T0311)I13.CB (T0311)R90.CB 10.5363 17.5604 22.8285 1.0005 Constraint (T0311)S63.CB (T0311)V92.CB 10.8220 18.0366 23.4476 1.0000 Constraint (T0311)S63.CB (T0311)L91.CB 8.6240 14.3733 18.6853 1.0000 Constraint (T0311)S63.CB (T0311)R90.CB 9.9101 16.5168 21.4719 1.0000 Constraint (T0311)S62.CB (T0311)V92.CB 13.3859 22.3099 29.0029 1.0000 Constraint (T0311)S62.CB (T0311)L91.CB 10.9724 18.2874 23.7736 1.0000 Constraint (T0311)I60.CB (T0311)L91.CB 12.2480 20.4134 26.5374 1.0000 Constraint (T0311)V58.CB (T0311)V92.CB 12.5440 20.9066 27.1786 1.0000 Constraint (T0311)V58.CB (T0311)L91.CB 9.4684 15.7806 20.5148 1.0000 Constraint (T0311)K55.CB (T0311)V92.CB 12.7007 21.1678 27.5182 1.0000 Constraint (T0311)I54.CB (T0311)V92.CB 9.4962 15.8270 20.5750 1.0000 Constraint (T0311)I54.CB (T0311)L91.CB 6.7536 11.2559 14.6327 1.0000 Constraint (T0311)E51.CB (T0311)V92.CB 10.4098 17.3496 22.5545 1.0000 Constraint (T0311)E51.CB (T0311)L91.CB 8.1662 13.6103 17.6934 1.0000 Constraint (T0311)E51.CB (T0311)R89.CB 8.8150 14.6916 19.0991 1.0000 Constraint (T0311)P50.CB (T0311)V92.CB 8.0299 13.3832 17.3982 1.0000 Constraint (T0311)P50.CB (T0311)L91.CB 6.3844 10.6406 13.8328 1.0000 Constraint (T0311)P50.CB (T0311)R89.CB 5.8941 9.8234 12.7705 1.0000 Constraint (T0311)T49.CB (T0311)V92.CB 10.9266 18.2109 23.6742 1.0000 Constraint (T0311)P9.CB (T0311)V83.CB 12.9534 21.5891 28.0658 1.0000 Constraint (T0311)T82.CB (T0311)P97.CB 8.5573 14.2622 18.5409 0.9981 Constraint (T0311)K81.CB (T0311)P97.CB 7.6964 12.8274 16.6756 0.9981 Constraint (T0311)K81.CB (T0311)T96.CB 7.6088 12.6813 16.4857 0.9981 Constraint (T0311)E78.CB (T0311)P97.CB 10.2558 17.0930 22.2209 0.9981 Constraint (T0311)E78.CB (T0311)T96.CB 10.0312 16.7187 21.7344 0.9981 Constraint (T0311)A77.CB (T0311)P97.CB 9.3442 15.5736 20.2457 0.9981 Constraint (T0311)A77.CB (T0311)T96.CB 10.2084 17.0140 22.1182 0.9981 Constraint (T0311)W74.CB (T0311)P97.CB 11.2683 18.7805 24.4147 0.9981 Constraint (T0311)W74.CB (T0311)T96.CB 9.2006 15.3343 19.9346 0.9981 Constraint (T0311)A73.CB (T0311)P97.CB 12.9087 21.5144 27.9688 0.9981 Constraint (T0311)A73.CB (T0311)T96.CB 10.3645 17.2741 22.4563 0.9981 Constraint (T0311)L70.CB (T0311)P97.CB 10.1356 16.8926 21.9604 0.9981 Constraint (T0311)N69.CB (T0311)P97.CB 11.2145 18.6909 24.2982 0.9981 Constraint (T0311)N69.CB (T0311)T96.CB 8.3599 13.9331 18.1131 0.9981 Constraint (T0311)W67.CB (T0311)P97.CB 7.0488 11.7480 15.2723 0.9981 Constraint (T0311)W67.CB (T0311)T96.CB 4.0424 6.7373 8.7585 0.9981 Constraint (T0311)W67.CB (T0311)S95.CB 6.8049 11.3416 14.7440 0.9981 Constraint (T0311)W67.CB (T0311)Q94.CB 7.4263 12.3772 16.0904 0.9981 Constraint (T0311)W67.CB (T0311)T93.CB 3.8640 6.4400 8.3720 0.9981 Constraint (T0311)M66.CB (T0311)P97.CB 9.6137 16.0229 20.8297 0.9981 Constraint (T0311)M66.CB (T0311)T96.CB 6.3546 10.5910 13.7683 0.9981 Constraint (T0311)M66.CB (T0311)S95.CB 8.0122 13.3536 17.3597 0.9981 Constraint (T0311)M66.CB (T0311)Q94.CB 8.5617 14.2695 18.5504 0.9981 Constraint (T0311)M66.CB (T0311)T93.CB 4.9689 8.2816 10.7661 0.9981 Constraint (T0311)Q65.CB (T0311)P97.CB 9.6891 16.1485 20.9931 0.9981 Constraint (T0311)Q65.CB (T0311)T96.CB 7.1099 11.8499 15.4048 0.9981 Constraint (T0311)Q65.CB (T0311)S95.CB 8.4862 14.1437 18.3868 0.9981 Constraint (T0311)Q65.CB (T0311)Q94.CB 10.1033 16.8388 21.8904 0.9981 Constraint (T0311)Q65.CB (T0311)T93.CB 6.5793 10.9655 14.2551 0.9981 Constraint (T0311)P64.CB (T0311)P97.CB 6.0818 10.1364 13.1773 0.9981 Constraint (T0311)P64.CB (T0311)T96.CB 3.7492 6.2487 8.1233 0.9981 Constraint (T0311)P64.CB (T0311)S95.CB 5.4893 9.1489 11.8935 0.9981 Constraint (T0311)P64.CB (T0311)Q94.CB 7.3551 12.2585 15.9360 0.9981 Constraint (T0311)P64.CB (T0311)T93.CB 4.1585 6.9308 9.0101 0.9981 Constraint (T0311)V59.CB (T0311)T93.CB 13.0596 21.7659 28.2957 0.9981 Constraint (T0311)L41.CB (T0311)S95.CB 11.9726 19.9543 25.9406 0.9981 Constraint (T0311)T37.CB (T0311)S95.CB 13.6978 22.8296 29.6785 0.9981 Constraint (T0311)E32.CB (T0311)T93.CB 13.6533 22.7554 29.5821 0.9981 Constraint (T0311)E32.CB (T0311)V92.CB 12.0457 20.0762 26.0991 0.9981 Constraint (T0311)M31.CB (T0311)T93.CB 11.9718 19.9529 25.9388 0.9981 Constraint (T0311)L17.CB (T0311)T93.CB 12.0287 20.0479 26.0622 0.9981 Constraint (T0311)L17.CB (T0311)V92.CB 12.7323 21.2205 27.5866 0.9981 Constraint (T0311)S16.CB (T0311)T93.CB 12.4551 20.7585 26.9860 0.9981 Constraint (T0311)E15.CB (T0311)T93.CB 11.0138 18.3564 23.8633 0.9981 Constraint (T0311)E15.CB (T0311)V92.CB 11.9529 19.9216 25.8980 0.9981 Constraint (T0311)Q14.CB (T0311)S95.CB 13.1031 21.8386 28.3901 0.9981 Constraint (T0311)Q14.CB (T0311)Q94.CB 12.0304 20.0506 26.0658 0.9981 Constraint (T0311)Q14.CB (T0311)T93.CB 8.7963 14.6605 19.0586 0.9981 Constraint (T0311)Q14.CB (T0311)V92.CB 9.8305 16.3842 21.2994 0.9981 Constraint (T0311)I12.CB (T0311)Q94.CB 12.1588 20.2646 26.3440 0.9981 Constraint (T0311)I12.CB (T0311)T93.CB 9.5899 15.9832 20.7781 0.9981 Constraint (T0311)I12.CB (T0311)V92.CB 9.5154 15.8590 20.6167 0.9981 Constraint (T0311)V59.CB (T0311)V92.CB 12.8330 21.3883 27.8048 0.9923 Constraint (T0311)I33.CB (T0311)N72.CB 9.4323 15.7204 20.4365 0.8096 Constraint (T0311)E32.CB (T0311)N72.CB 8.7678 14.6130 18.9969 0.8096 Constraint (T0311)L76.CB (T0311)P97.CB 13.2531 22.0884 28.7149 0.6667 Constraint (T0311)V58.CB (T0311)S95.CB 13.4039 22.3398 29.0417 0.6667 Constraint (T0311)L56.CB (T0311)S95.CB 13.5383 22.5638 29.3329 0.6667 Constraint (T0311)I33.CB (T0311)P97.CB 12.8609 21.4348 27.8652 0.6667 Constraint (T0311)M31.CB (T0311)P97.CB 11.6400 19.4000 25.2200 0.6667 Constraint (T0311)M31.CB (T0311)T96.CB 12.7216 21.2027 27.5636 0.6667 Constraint (T0311)M31.CB (T0311)Q94.CB 13.6712 22.7853 29.6209 0.6667 Constraint (T0311)A30.CB (T0311)T93.CB 12.7103 21.1838 27.5389 0.6667 Constraint (T0311)A28.CB (T0311)P97.CB 11.9585 19.9309 25.9101 0.6667 Constraint (T0311)N21.CB (T0311)T93.CB 9.4442 15.7403 20.4624 0.6667 Constraint (T0311)L20.CB (T0311)T93.CB 10.5588 17.5981 22.8775 0.6667 Constraint (T0311)E19.CB (T0311)P97.CB 11.2827 18.8044 24.4457 0.6667 Constraint (T0311)E19.CB (T0311)T96.CB 10.4871 17.4785 22.7221 0.6667 Constraint (T0311)E19.CB (T0311)T93.CB 11.6860 19.4767 25.3197 0.6667 Constraint (T0311)D18.CB (T0311)P97.CB 11.1394 18.5657 24.1354 0.6667 Constraint (T0311)D18.CB (T0311)T96.CB 10.2402 17.0670 22.1871 0.6667 Constraint (T0311)S16.CB (T0311)P97.CB 12.7879 21.3131 27.7070 0.6667 Constraint (T0311)S16.CB (T0311)T96.CB 12.5896 20.9826 27.2774 0.6667 Constraint (T0311)E15.CB (T0311)T96.CB 13.4478 22.4130 29.1369 0.6667 Constraint (T0311)E15.CB (T0311)S95.CB 13.7666 22.9444 29.8277 0.6667 Constraint (T0311)E15.CB (T0311)Q94.CB 13.0519 21.7531 28.2790 0.6667 Constraint (T0311)Q14.CB (T0311)T96.CB 13.7953 22.9921 29.8898 0.6667 Constraint (T0311)D11.CB (T0311)R90.CB 7.0848 11.8080 15.3504 0.5957 Constraint (T0311)L56.CB (T0311)P97.CB 11.9550 19.9250 25.9025 0.5730 Constraint (T0311)L56.CB (T0311)T96.CB 11.9886 19.9810 25.9753 0.5730 Constraint (T0311)K55.CB (T0311)P97.CB 12.4012 20.6686 26.8692 0.5730 Constraint (T0311)K55.CB (T0311)T96.CB 12.3934 20.6556 26.8523 0.5730 Constraint (T0311)I54.CB (T0311)P97.CB 13.4059 22.3432 29.0461 0.5730 Constraint (T0311)A53.CB (T0311)P97.CB 11.9065 19.8442 25.7975 0.5730 Constraint (T0311)A53.CB (T0311)T96.CB 12.6840 21.1400 27.4821 0.5730 Constraint (T0311)M52.CB (T0311)P97.CB 9.5025 15.8375 20.5887 0.5730 Constraint (T0311)M52.CB (T0311)T96.CB 10.0296 16.7159 21.7307 0.5730 Constraint (T0311)E51.CB (T0311)P97.CB 11.1865 18.6442 24.2374 0.5730 Constraint (T0311)E51.CB (T0311)T96.CB 12.1460 20.2433 26.3163 0.5730 Constraint (T0311)P50.CB (T0311)P97.CB 11.6298 19.3830 25.1979 0.5730 Constraint (T0311)P50.CB (T0311)T96.CB 13.0250 21.7084 28.2209 0.5730 Constraint (T0311)T49.CB (T0311)P97.CB 8.6090 14.3483 18.6528 0.5730 Constraint (T0311)T49.CB (T0311)T96.CB 9.9843 16.6405 21.6327 0.5730 Constraint (T0311)L48.CB (T0311)P97.CB 8.4593 14.0989 18.3286 0.5730 Constraint (T0311)L48.CB (T0311)T96.CB 9.4056 15.6760 20.3788 0.5730 Constraint (T0311)A47.CB (T0311)P97.CB 5.2933 8.8221 11.4688 0.5730 Constraint (T0311)A47.CB (T0311)T96.CB 6.8689 11.4481 14.8825 0.5730 Constraint (T0311)A46.CB (T0311)P97.CB 7.5627 12.6045 16.3858 0.5730 Constraint (T0311)K45.CB (T0311)P97.CB 9.1906 15.3177 19.9130 0.5730 Constraint (T0311)A38.CB (T0311)S95.CB 12.2080 20.3466 26.4506 0.4048 Constraint (T0311)P35.CB (T0311)T96.CB 12.7884 21.3140 27.7082 0.4048 Constraint (T0311)A34.CB (T0311)S95.CB 12.6154 21.0257 27.3334 0.4048 Constraint (T0311)I33.CB (T0311)S95.CB 12.8836 21.4727 27.9145 0.4048 Constraint (T0311)E32.CB (T0311)S95.CB 13.1913 21.9856 28.5812 0.4048 Constraint (T0311)I13.CB (T0311)S95.CB 13.7228 22.8713 29.7326 0.4048 Constraint (T0311)I13.CB (T0311)L91.CB 9.5056 15.8426 20.5954 0.4048 Constraint (T0311)N5.CB (T0311)A73.CB 13.1379 21.8964 28.4653 0.3388 Constraint (T0311)N5.CB (T0311)K55.CB 13.7815 22.9692 29.8599 0.3388 Constraint (T0311)N5.CB (T0311)I54.CB 11.6977 19.4962 25.3451 0.3388 Constraint (T0311)N5.CB (T0311)E51.CB 10.1192 16.8653 21.9249 0.3388 Constraint (T0311)N5.CB (T0311)S36.CB 10.4178 17.3630 22.5719 0.3388 Constraint (T0311)N5.CB (T0311)P35.CB 11.4697 19.1162 24.8511 0.3388 Constraint (T0311)N5.CB (T0311)A34.CB 9.0852 15.1419 19.6845 0.3388 Constraint (T0311)N5.CB (T0311)I33.CB 6.7696 11.2826 14.6674 0.3388 Constraint (T0311)N5.CB (T0311)E32.CB 6.7494 11.2491 14.6238 0.3388 Constraint (T0311)N5.CB (T0311)M31.CB 6.9810 11.6350 15.1255 0.3388 Constraint (T0311)N5.CB (T0311)A30.CB 9.8695 16.4492 21.3839 0.3388 Constraint (T0311)N5.CB (T0311)R29.CB 10.8781 18.1302 23.5692 0.3388 Constraint (T0311)N5.CB (T0311)A28.CB 9.7691 16.2819 21.1664 0.3388 Constraint (T0311)N5.CB (T0311)E26.CB 12.8335 21.3892 27.8059 0.3388 Constraint (T0311)N5.CB (T0311)R25.CB 13.1181 21.8635 28.4225 0.3388 Constraint (T0311)N5.CB (T0311)V22.CB 13.0173 21.6955 28.2042 0.3388 Constraint (T0311)T96.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: