# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 22.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 303 12.6414 15.8017 23.7026 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 237 303 13.3640 16.7051 25.0576 87.8820 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 303 13.3123 16.6403 24.9605 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 176 250 12.6418 15.8022 23.7034 87.7035 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 176 314 11.6621 14.5776 21.8664 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 303 13.4991 16.8738 25.3107 85.6452 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 285 12.3216 15.4020 23.1030 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 303 12.9819 16.2274 24.3411 84.8820 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 259 341 11.2540 14.0675 21.1012 83.0212 Constraint 237 322 11.7486 14.6858 22.0286 82.8770 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 279 13.1785 16.4731 24.7096 82.8523 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 169 267 12.6140 15.7674 23.6512 82.8523 Constraint 169 250 12.3018 15.3772 23.0659 82.8085 Constraint 259 330 11.4443 14.3054 21.4581 82.7317 Constraint 210 330 10.9683 13.7104 20.5655 82.7317 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 176 330 12.3757 15.4696 23.2044 82.7317 Constraint 250 322 13.3027 16.6284 24.9426 82.6985 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 429 12.8937 16.1171 24.1756 82.3719 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 297 429 13.3226 16.6532 24.9798 82.3719 Constraint 297 421 9.9428 12.4285 18.6427 82.3719 Constraint 292 429 10.4885 13.1107 19.6660 82.3719 Constraint 292 421 6.8174 8.5217 12.7826 82.3719 Constraint 285 429 12.1290 15.1613 22.7419 82.3719 Constraint 285 421 8.4580 10.5724 15.8587 82.3719 Constraint 259 421 7.4615 9.3269 13.9904 82.3719 Constraint 210 429 9.4549 11.8187 17.7280 82.3719 Constraint 182 429 12.7309 15.9136 23.8704 82.3719 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 242 330 12.8767 16.0959 24.1438 81.7861 Constraint 182 421 9.3900 11.7375 17.6063 81.3738 Constraint 210 341 12.4189 15.5236 23.2854 81.3023 Constraint 182 341 10.9744 13.7180 20.5770 81.3023 Constraint 303 404 13.0759 16.3449 24.5173 81.2632 Constraint 297 404 14.4708 18.0885 27.1328 81.2632 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 285 404 11.5874 14.4842 21.7264 81.2632 Constraint 259 404 10.3703 12.9628 19.4442 81.2632 Constraint 210 404 11.2483 14.0603 21.0905 81.2632 Constraint 182 404 14.4846 18.1058 27.1587 81.2632 Constraint 242 429 8.6173 10.7716 16.1574 81.1263 Constraint 176 429 14.2381 17.7976 26.6965 81.0738 Constraint 285 355 9.7587 12.1983 18.2975 80.7947 Constraint 292 435 11.5134 14.3917 21.5876 80.3872 Constraint 285 435 12.9189 16.1487 24.2230 80.3872 Constraint 242 341 12.8247 16.0308 24.0462 80.3567 Constraint 242 404 8.4628 10.5785 15.8677 80.3177 Constraint 303 412 11.6876 14.6094 21.9142 80.2786 Constraint 297 412 12.4440 15.5550 23.3325 80.2786 Constraint 292 412 8.9687 11.2109 16.8164 80.2786 Constraint 285 412 9.2274 11.5342 17.3014 80.2786 Constraint 237 330 15.2991 19.1239 28.6859 80.0735 Constraint 201 330 14.0881 17.6101 26.4152 80.0735 Constraint 190 330 12.5317 15.6646 23.4969 80.0735 Constraint 259 429 10.8417 13.5521 20.3282 80.0717 Constraint 285 350 7.4395 9.2994 13.9491 80.0270 Constraint 259 350 10.2106 12.7633 19.1449 80.0270 Constraint 267 330 11.1639 13.9549 20.9323 79.9388 Constraint 250 330 15.7440 19.6800 29.5200 79.8950 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 297 399 12.0253 15.0317 22.5475 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 259 399 9.5368 11.9210 17.8816 79.8809 Constraint 210 399 10.4189 13.0236 19.5354 79.8809 Constraint 182 399 12.8371 16.0464 24.0696 79.8809 Constraint 226 322 12.2680 15.3350 23.0025 79.8770 Constraint 169 330 13.0762 16.3452 24.5178 79.7779 Constraint 221 330 11.1382 13.9227 20.8841 79.7317 Constraint 210 421 6.1105 7.6381 11.4571 79.6366 Constraint 279 421 11.7956 14.7445 22.1168 79.5790 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 182 412 11.8332 14.7915 22.1873 79.2806 Constraint 267 429 14.5460 18.1825 27.2738 79.2790 Constraint 182 435 13.4735 16.8419 25.2628 79.0892 Constraint 242 350 11.7547 14.6934 22.0401 79.0814 Constraint 292 355 11.0754 13.8443 20.7665 79.0758 Constraint 259 355 11.9484 14.9355 22.4033 79.0758 Constraint 221 429 11.9022 14.8778 22.3167 79.0719 Constraint 303 442 13.0089 16.2611 24.3917 79.0538 Constraint 242 399 8.5018 10.6273 15.9409 78.9353 Constraint 161 314 15.0348 18.7935 28.1902 78.9048 Constraint 161 297 13.9721 17.4651 26.1976 78.9048 Constraint 161 292 12.3803 15.4753 23.2130 78.9048 Constraint 161 272 13.2272 16.5340 24.8011 78.9048 Constraint 161 259 14.9702 18.7127 28.0691 78.9048 Constraint 176 341 14.9281 18.6602 27.9903 78.7314 Constraint 242 421 5.1632 6.4540 9.6809 78.6910 Constraint 190 341 14.4889 18.1111 27.1667 78.6441 Constraint 176 421 11.2273 14.0341 21.0511 78.6385 Constraint 259 412 6.9938 8.7423 13.1134 78.5597 Constraint 279 341 8.7088 10.8860 16.3290 78.5094 Constraint 272 341 11.2548 14.0685 21.1027 78.5094 Constraint 267 341 11.0384 13.7980 20.6970 78.5094 Constraint 272 404 15.1160 18.8950 28.3425 78.4704 Constraint 267 404 13.9388 17.4234 26.1352 78.4704 Constraint 250 341 15.1630 18.9537 28.4306 78.4656 Constraint 176 399 15.5165 19.3956 29.0934 78.4597 Constraint 190 429 14.7525 18.4406 27.6609 78.4156 Constraint 303 435 14.6868 18.3585 27.5378 78.3870 Constraint 322 404 12.6266 15.7832 23.6749 78.3514 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 210 350 12.1770 15.2213 22.8319 78.3081 Constraint 182 350 11.6789 14.5987 21.8980 78.3081 Constraint 221 341 12.0222 15.0278 22.5416 78.3023 Constraint 272 429 14.4425 18.0531 27.0796 78.2809 Constraint 221 404 12.4143 15.5179 23.2768 78.2633 Constraint 210 355 14.1394 17.6742 26.5114 78.0595 Constraint 182 355 14.2098 17.7623 26.6435 78.0595 Constraint 297 442 12.1819 15.2273 22.8410 78.0557 Constraint 161 242 13.1421 16.4276 24.6413 77.9592 Constraint 267 421 10.6809 13.3511 20.0266 77.5601 Constraint 210 412 8.1943 10.2429 15.3644 77.5434 Constraint 314 435 11.4413 14.3017 21.4525 77.4754 Constraint 169 429 11.1357 13.9197 20.8795 77.4316 Constraint 297 435 14.7540 18.4425 27.6638 77.3890 Constraint 259 435 10.5927 13.2409 19.8613 77.3703 Constraint 210 435 9.3239 11.6549 17.4824 77.3703 Constraint 176 435 14.2439 17.8049 26.7074 77.3703 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 279 350 9.3782 11.7228 17.5842 77.2341 Constraint 267 350 10.7126 13.3908 20.0862 77.2341 Constraint 190 399 15.2879 19.1099 28.6649 77.2226 Constraint 242 355 12.9701 16.2126 24.3189 77.1139 Constraint 279 399 13.4741 16.8426 25.2639 77.0880 Constraint 272 399 13.7219 17.1524 25.7286 77.0880 Constraint 267 399 12.7295 15.9119 23.8678 77.0880 Constraint 226 330 15.2128 19.0160 28.5240 77.0735 Constraint 285 442 10.8668 13.5836 20.3753 77.0349 Constraint 330 399 11.8276 14.7845 22.1767 76.9691 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 221 399 11.5527 14.4409 21.6613 76.8809 Constraint 272 421 10.5860 13.2324 19.8487 76.8620 Constraint 341 404 14.5172 18.1465 27.2198 76.8538 Constraint 161 322 12.5736 15.7170 23.5756 76.8116 Constraint 237 429 9.8523 12.3154 18.4731 76.6784 Constraint 221 421 7.9938 9.9923 14.9884 76.6366 Constraint 242 412 4.5478 5.6848 8.5272 76.5978 Constraint 237 404 10.6942 13.3677 20.0516 76.5861 Constraint 330 404 15.3390 19.1738 28.7607 76.5642 Constraint 176 412 13.4431 16.8039 25.2059 76.5453 Constraint 128 303 11.5995 14.4993 21.7490 76.5309 Constraint 128 297 9.2039 11.5049 17.2573 76.5309 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 285 11.3731 14.2164 21.3246 76.5309 Constraint 128 279 12.6012 15.7515 23.6272 76.5309 Constraint 128 272 10.0640 12.5799 18.8699 76.5309 Constraint 128 267 12.6754 15.8442 23.7663 76.5309 Constraint 128 259 10.6591 13.3239 19.9858 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 303 10.4289 13.0361 19.5541 76.5309 Constraint 104 297 8.7699 10.9623 16.4435 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 285 11.7606 14.7007 22.0511 76.5309 Constraint 104 279 12.8234 16.0292 24.0438 76.5309 Constraint 104 272 11.5604 14.4505 21.6758 76.5309 Constraint 104 267 13.8683 17.3354 26.0031 76.5309 Constraint 104 259 12.2704 15.3380 23.0069 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 250 421 8.8421 11.0526 16.5789 76.4999 Constraint 279 412 12.8178 16.0223 24.0334 76.4877 Constraint 267 412 10.7996 13.4995 20.2492 76.4877 Constraint 250 404 10.1938 12.7422 19.1133 76.4076 Constraint 242 435 7.4484 9.3104 13.9657 76.4064 Constraint 292 442 8.5292 10.6615 15.9923 76.3368 Constraint 272 435 14.6203 18.2753 27.4130 76.2963 Constraint 279 355 12.0010 15.0012 22.5019 76.2829 Constraint 161 237 10.7659 13.4574 20.1860 76.2466 Constraint 314 442 9.9883 12.4854 18.7281 76.1419 Constraint 201 341 15.8787 19.8484 29.7726 76.0731 Constraint 237 421 7.4874 9.3592 14.0388 75.9803 Constraint 201 421 9.7990 12.2487 18.3731 75.9803 Constraint 341 429 14.3255 17.9068 26.8602 75.8691 Constraint 341 421 11.4898 14.3622 21.5433 75.8691 Constraint 341 412 13.8049 17.2561 25.8842 75.8691 Constraint 169 421 8.9878 11.2348 16.8522 75.7127 Constraint 201 429 12.4930 15.6162 23.4244 75.6803 Constraint 190 421 11.1614 13.9518 20.9276 75.6803 Constraint 169 404 14.0084 17.5105 26.2658 75.6339 Constraint 201 404 14.4713 18.0891 27.1336 75.5880 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 104 242 11.4981 14.3726 21.5589 75.5853 Constraint 330 429 13.9294 17.4117 26.1176 75.5796 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 330 412 14.3025 17.8781 26.8172 75.5796 Constraint 136 297 11.7726 14.7157 22.0736 75.5603 Constraint 136 292 10.8565 13.5706 20.3559 75.5603 Constraint 136 272 13.0259 16.2824 24.4236 75.5603 Constraint 136 259 14.4178 18.0223 27.0335 75.5603 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 272 350 11.5500 14.4375 21.6562 75.5152 Constraint 279 404 15.3391 19.1738 28.7608 75.4811 Constraint 322 435 13.1473 16.4341 24.6512 75.3822 Constraint 221 350 11.7683 14.7104 22.0656 75.3081 Constraint 267 355 12.8804 16.1005 24.1508 75.0685 Constraint 221 355 13.9192 17.3990 26.0985 75.0595 Constraint 259 442 8.2727 10.3409 15.5113 75.0205 Constraint 210 442 5.4866 6.8583 10.2874 75.0205 Constraint 182 442 9.7964 12.2455 18.3682 75.0205 Constraint 176 442 10.2646 12.8307 19.2460 75.0205 Constraint 350 429 12.6638 15.8298 23.7446 74.8711 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 350 412 11.9101 14.8876 22.3314 74.8711 Constraint 272 412 11.8342 14.7927 22.1891 74.7688 Constraint 250 429 11.4606 14.3258 21.4887 74.7127 Constraint 190 435 14.2692 17.8365 26.7548 74.7120 Constraint 355 429 12.5629 15.7036 23.5554 74.6225 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 136 242 12.9478 16.1848 24.2771 74.6147 Constraint 267 435 14.3407 17.9259 26.8889 74.5774 Constraint 221 412 8.7844 10.9805 16.4708 74.5617 Constraint 169 399 13.4309 16.7886 25.1829 74.5493 Constraint 237 399 11.3527 14.1909 21.2863 74.4874 Constraint 201 399 14.2153 17.7691 26.6536 74.4874 Constraint 221 435 11.4092 14.2615 21.3923 74.3703 Constraint 190 404 15.9828 19.9785 29.9678 74.3070 Constraint 242 442 5.0966 6.3707 9.5561 74.0749 Constraint 237 341 15.8564 19.8205 29.7308 74.0729 Constraint 161 279 16.7997 20.9996 31.4994 74.0679 Constraint 272 355 14.1765 17.7206 26.5809 74.0522 Constraint 322 442 10.8722 13.5903 20.3854 74.0487 Constraint 250 399 10.9015 13.6269 20.4403 74.0089 Constraint 237 412 6.9851 8.7314 13.0971 73.8871 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 303 13.6099 17.0124 25.5186 73.8727 Constraint 122 297 12.1073 15.1341 22.7012 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 285 13.3253 16.6566 24.9849 73.8727 Constraint 122 279 15.3646 19.2057 28.8086 73.8727 Constraint 122 272 13.1702 16.4628 24.6942 73.8727 Constraint 122 259 12.3283 15.4103 23.1155 73.8727 Constraint 122 237 9.7652 12.2065 18.3097 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 303 14.0408 17.5510 26.3265 73.8727 Constraint 113 297 12.5651 15.7064 23.5596 73.8727 Constraint 113 292 11.4170 14.2712 21.4068 73.8727 Constraint 113 285 14.8791 18.5989 27.8983 73.8727 Constraint 113 272 14.7221 18.4027 27.6040 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 190 14.0933 17.6166 26.4250 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 237 12.3132 15.3916 23.0873 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 104 190 11.6819 14.6023 21.9035 73.8727 Constraint 169 341 15.2725 19.0906 28.6358 73.8363 Constraint 201 435 11.6374 14.5468 21.8202 73.6957 Constraint 128 250 13.0108 16.2634 24.3952 73.6941 Constraint 169 412 11.3895 14.2368 21.3552 73.6195 Constraint 136 314 11.9606 14.9507 22.4261 73.6191 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 201 412 11.0577 13.8221 20.7332 73.5871 Constraint 190 412 12.4721 15.5901 23.3852 73.5871 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 169 435 10.9970 13.7462 20.6194 73.4281 Constraint 250 412 6.2222 7.7777 11.6665 73.4086 Constraint 272 442 11.3355 14.1693 21.2540 73.2439 Constraint 226 341 16.0772 20.0965 30.1447 73.0731 Constraint 122 242 10.0349 12.5437 18.8155 72.9271 Constraint 113 242 12.9781 16.2226 24.3339 72.9271 Constraint 136 237 12.1250 15.1562 22.7344 72.9020 Constraint 226 429 12.9954 16.2443 24.3665 72.6803 Constraint 226 421 9.8794 12.3493 18.5239 72.6803 Constraint 355 435 15.3149 19.1436 28.7155 72.6378 Constraint 226 404 13.5578 16.9472 25.4208 72.5880 Constraint 279 442 13.5406 16.9257 25.3886 72.5772 Constraint 136 221 12.1229 15.1536 22.7304 72.5603 Constraint 250 350 13.6536 17.0670 25.6005 72.5595 Constraint 237 442 4.7453 5.9316 8.8975 72.3622 Constraint 330 442 14.4053 18.0066 27.0100 72.2616 Constraint 250 355 14.8004 18.5005 27.7508 72.2341 Constraint 267 442 11.8434 14.8042 22.2063 72.2276 Constraint 169 442 7.3068 9.1335 13.7002 72.0946 Constraint 221 442 8.0438 10.0548 15.0822 72.0205 Constraint 237 435 7.5949 9.4936 14.2404 71.9085 Constraint 341 442 15.2789 19.0986 28.6479 71.8843 Constraint 250 435 9.4344 11.7930 17.6895 71.7300 Constraint 279 429 15.2274 19.0343 28.5514 71.6752 Constraint 350 442 14.0108 17.5136 26.2703 71.5530 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 226 399 13.7871 17.2339 25.8509 71.4874 Constraint 279 435 15.9977 19.9972 29.9957 71.4593 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 279 11.9043 14.8803 22.3205 71.4434 Constraint 96 272 10.8873 13.6091 20.4137 71.4434 Constraint 96 267 12.2068 15.2585 22.8877 71.4434 Constraint 96 259 9.8491 12.3114 18.4671 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 303 12.2685 15.3357 23.0035 71.4377 Constraint 88 297 12.0961 15.1201 22.6802 71.4377 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 285 13.0498 16.3123 24.4684 71.4377 Constraint 88 279 15.4296 19.2870 28.9305 71.4377 Constraint 88 272 14.5615 18.2019 27.3028 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 88 182 11.5724 14.4655 21.6983 71.4377 Constraint 88 176 13.2501 16.5626 24.8439 71.4377 Constraint 161 330 16.1209 20.1512 30.2267 71.4371 Constraint 128 341 12.9852 16.2316 24.3473 71.3342 Constraint 104 341 10.6683 13.3354 20.0031 71.3342 Constraint 355 442 14.9023 18.6279 27.9419 71.3044 Constraint 122 267 14.9703 18.7129 28.0694 71.3017 Constraint 176 404 16.3240 20.4050 30.6075 71.2762 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 303 382 12.1960 15.2450 22.8675 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 297 382 14.3908 17.9885 26.9827 71.1209 Constraint 292 391 7.9484 9.9355 14.9032 71.1209 Constraint 292 382 11.5404 14.4255 21.6383 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 285 382 10.2339 12.7924 19.1885 71.1209 Constraint 259 391 6.6353 8.2941 12.4412 71.1209 Constraint 259 382 9.4031 11.7538 17.6308 71.1209 Constraint 182 391 11.7541 14.6926 22.0389 71.1209 Constraint 182 382 15.2742 19.0928 28.6392 71.1209 Constraint 113 237 12.9045 16.1307 24.1960 71.0359 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 113 314 10.8516 13.5645 20.3467 70.9608 Constraint 128 226 10.2451 12.8064 19.2096 70.8727 Constraint 122 226 12.2553 15.3191 22.9787 70.8727 Constraint 122 221 11.0976 13.8720 20.8080 70.8727 Constraint 113 226 15.1378 18.9223 28.3834 70.8727 Constraint 113 221 13.4325 16.7907 25.1860 70.8727 Constraint 104 226 13.5350 16.9187 25.3781 70.8727 Constraint 303 449 13.1094 16.3868 24.5801 70.7960 Constraint 226 412 9.5531 11.9414 17.9120 70.5871 Constraint 201 442 7.5016 9.3770 14.0654 70.5751 Constraint 190 442 10.2434 12.8042 19.2063 70.5751 Constraint 96 242 8.7861 10.9826 16.4739 70.4979 Constraint 161 285 16.2592 20.3240 30.4861 70.4950 Constraint 161 267 16.3958 20.4948 30.7422 70.4950 Constraint 250 442 8.0056 10.0069 15.0104 70.3965 Constraint 144 297 14.6034 18.2543 27.3815 70.3651 Constraint 144 292 12.8734 16.0918 24.1377 70.3651 Constraint 144 272 15.3928 19.2410 28.8615 70.3651 Constraint 128 435 11.3295 14.1619 21.2428 70.3317 Constraint 128 429 9.9404 12.4255 18.6383 70.3317 Constraint 104 435 13.8044 17.2555 25.8833 70.3317 Constraint 104 429 11.4047 14.2559 21.3838 70.3317 Constraint 104 421 9.4483 11.8104 17.7156 70.3317 Constraint 136 226 13.3731 16.7164 25.0746 69.9020 Constraint 303 375 12.3813 15.4766 23.2149 69.8228 Constraint 292 375 12.7174 15.8968 23.8451 69.8228 Constraint 285 375 11.6796 14.5995 21.8993 69.8228 Constraint 259 375 11.6638 14.5798 21.8697 69.8228 Constraint 237 375 14.4052 18.0065 27.0098 69.8228 Constraint 210 375 14.0296 17.5370 26.3055 69.8228 Constraint 104 330 8.1029 10.1287 15.1930 69.7387 Constraint 136 303 14.1178 17.6473 26.4709 69.5699 Constraint 136 285 14.6107 18.2634 27.3951 69.5699 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 144 242 13.4383 16.7979 25.1969 69.4195 Constraint 144 237 12.0665 15.0831 22.6246 69.4195 Constraint 210 382 12.5022 15.6278 23.4417 69.4020 Constraint 136 429 13.0660 16.3325 24.4988 69.3611 Constraint 96 350 9.5716 11.9645 17.9467 69.3563 Constraint 96 341 10.1789 12.7236 19.0855 69.3563 Constraint 88 341 12.3224 15.4031 23.1046 69.3505 Constraint 128 421 7.8524 9.8154 14.7232 69.3154 Constraint 292 449 9.1902 11.4878 17.2317 69.0771 Constraint 285 449 12.0952 15.1190 22.6786 69.0771 Constraint 161 429 14.1014 17.6268 26.4401 68.9723 Constraint 161 421 12.8166 16.0208 24.0311 68.9723 Constraint 226 435 11.1526 13.9408 20.9111 68.9085 Constraint 242 375 11.0519 13.8148 20.7222 68.8772 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 96 190 11.4113 14.2641 21.3962 68.7852 Constraint 88 237 12.8760 16.0951 24.1426 68.7794 Constraint 88 201 13.3038 16.6297 24.9446 68.7794 Constraint 88 190 14.8554 18.5692 27.8539 68.7794 Constraint 136 330 12.2906 15.3633 23.0449 68.7223 Constraint 128 330 10.5075 13.1344 19.7016 68.7223 Constraint 96 250 12.6918 15.8648 23.7972 68.6067 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 88 161 13.1158 16.3948 24.5921 68.5258 Constraint 242 382 8.5418 10.6772 16.0158 68.4564 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 221 12.9491 16.1863 24.2795 68.4377 Constraint 210 391 9.3049 11.6311 17.4467 68.3856 Constraint 136 421 11.5668 14.4585 21.6878 68.3448 Constraint 104 350 11.4376 14.2971 21.4456 68.3399 Constraint 279 391 10.9033 13.6291 20.4437 68.3280 Constraint 279 382 14.1760 17.7201 26.5801 68.3280 Constraint 272 382 14.7051 18.3813 27.5720 68.3280 Constraint 267 391 9.6439 12.0548 18.0822 68.3280 Constraint 267 382 12.4450 15.5563 23.3344 68.3280 Constraint 144 322 11.4516 14.3145 21.4717 68.2719 Constraint 144 314 13.6659 17.0824 25.6236 68.2719 Constraint 128 404 13.0213 16.2766 24.4149 68.2385 Constraint 104 412 13.3598 16.6998 25.0496 68.2385 Constraint 104 404 14.4214 18.0267 27.0401 68.2385 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 322 382 13.6503 17.0629 25.5943 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 221 382 12.3923 15.4904 23.2355 68.1209 Constraint 297 449 11.9999 14.9999 22.4999 68.0790 Constraint 182 449 10.0088 12.5109 18.7664 68.0790 Constraint 259 449 10.5014 13.1268 19.6902 68.0607 Constraint 104 442 11.1812 13.9765 20.9647 67.9819 Constraint 88 242 11.2326 14.0407 21.0611 67.9211 Constraint 113 279 16.2818 20.3522 30.5283 67.8823 Constraint 122 429 8.3417 10.4271 15.6407 67.6735 Constraint 113 429 11.3022 14.1278 21.1917 67.6735 Constraint 226 442 7.7688 9.7110 14.5665 67.5751 Constraint 136 279 15.2704 19.0880 28.6320 67.4767 Constraint 242 391 6.0876 7.6095 11.4143 67.4400 Constraint 237 391 9.7520 12.1900 18.2850 67.3876 Constraint 237 382 11.6357 14.5447 21.8170 67.3876 Constraint 190 391 13.1307 16.4133 24.6200 67.3876 Constraint 144 226 14.2558 17.8197 26.7296 67.3651 Constraint 144 221 13.7347 17.1684 25.7526 67.3651 Constraint 161 442 10.8729 13.5911 20.3866 67.3388 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 297 368 12.8890 16.1113 24.1669 67.2518 Constraint 297 360 9.7917 12.2396 18.3594 67.2518 Constraint 292 368 10.8154 13.5192 20.2788 67.2518 Constraint 292 360 8.1736 10.2170 15.3256 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 259 368 9.3375 11.6718 17.5077 67.2518 Constraint 259 360 8.5248 10.6561 15.9841 67.2518 Constraint 96 435 10.6424 13.3030 19.9544 67.2404 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 421 5.9672 7.4590 11.1885 67.2404 Constraint 96 412 9.8431 12.3038 18.4557 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 161 250 15.8961 19.8701 29.8052 67.1874 Constraint 242 449 7.9537 9.9421 14.9132 67.1152 Constraint 113 330 11.9235 14.9043 22.3565 67.0804 Constraint 210 449 6.3314 7.9142 11.8713 67.0627 Constraint 176 449 10.5625 13.2031 19.8046 67.0627 Constraint 267 375 14.6461 18.3076 27.4614 67.0299 Constraint 250 375 12.5102 15.6378 23.4567 66.9860 Constraint 350 435 14.8468 18.5585 27.8377 66.9747 Constraint 341 449 14.6141 18.2677 27.4015 66.9156 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 161 412 15.2559 19.0699 28.6048 66.8791 Constraint 88 259 12.7193 15.8991 23.8487 66.8665 Constraint 190 350 14.4445 18.0556 27.0834 66.8571 Constraint 128 399 11.4464 14.3080 21.4619 66.8561 Constraint 104 399 11.6909 14.6136 21.9205 66.8561 Constraint 221 375 14.4295 18.0368 27.0552 66.8228 Constraint 96 355 10.7045 13.3806 20.0709 66.7853 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 88 330 10.9722 13.7153 20.5729 66.7387 Constraint 113 421 10.5312 13.1640 19.7459 66.6571 Constraint 136 435 14.4369 18.0462 27.0693 66.6259 Constraint 128 350 12.8493 16.0616 24.0924 66.6210 Constraint 272 391 11.2644 14.0805 21.1208 66.6091 Constraint 161 435 13.9801 17.4751 26.2127 66.5791 Constraint 221 391 9.1372 11.4215 17.1323 66.4020 Constraint 88 350 11.8560 14.8200 22.2299 66.3563 Constraint 242 368 9.8064 12.2580 18.3871 66.3063 Constraint 113 259 14.3258 17.9072 26.8608 66.2994 Constraint 128 442 7.9175 9.8969 14.8454 66.2630 Constraint 182 360 11.7182 14.6477 21.9716 66.2355 Constraint 201 391 12.8242 16.0302 24.0454 66.1731 Constraint 176 391 14.3083 17.8854 26.8281 66.1731 Constraint 314 449 9.3186 11.6482 17.4724 66.1652 Constraint 153 297 13.4446 16.8058 25.2087 66.1384 Constraint 153 292 11.1345 13.9181 20.8772 66.1384 Constraint 153 272 13.1853 16.4816 24.7224 66.1384 Constraint 153 237 9.0638 11.3297 16.9946 66.1384 Constraint 113 341 13.9180 17.3975 26.0962 66.1050 Constraint 122 330 12.6316 15.7895 23.6842 66.0641 Constraint 182 368 14.7583 18.4479 27.6718 66.0374 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 322 449 9.5242 11.9052 17.8578 65.7909 Constraint 96 226 12.1570 15.1963 22.7945 65.7852 Constraint 237 350 14.6432 18.3040 27.4560 65.6657 Constraint 122 404 11.9539 14.9423 22.4135 65.5802 Constraint 113 404 14.8842 18.6053 27.9080 65.5802 Constraint 250 382 8.9880 11.2350 16.8524 65.5671 Constraint 128 412 11.0519 13.8149 20.7224 65.5032 Constraint 226 382 13.8114 17.2642 25.8963 65.4039 Constraint 176 350 15.0639 18.8298 28.2448 65.3240 Constraint 136 442 11.4195 14.2744 21.4116 65.2924 Constraint 279 449 14.7010 18.3762 27.5643 65.2861 Constraint 272 449 12.6771 15.8464 23.7697 65.2861 Constraint 88 429 8.7777 10.9721 16.4582 65.2385 Constraint 88 421 8.6668 10.8336 16.2503 65.2385 Constraint 88 404 11.9222 14.9028 22.3542 65.2385 Constraint 153 242 10.9483 13.6854 20.5281 65.1928 Constraint 169 449 6.9142 8.6427 12.9641 65.1215 Constraint 104 355 13.0036 16.2545 24.3817 65.0664 Constraint 122 435 10.1550 12.6937 19.0405 64.9382 Constraint 122 421 7.5370 9.4212 14.1319 64.9382 Constraint 113 435 13.7028 17.1284 25.6927 64.9382 Constraint 242 360 8.6699 10.8374 16.2561 64.5874 Constraint 250 391 7.7323 9.6654 14.4981 64.5508 Constraint 136 412 14.8843 18.6054 27.9081 64.5326 Constraint 237 360 12.2075 15.2593 22.8890 64.5166 Constraint 210 368 12.8647 16.0809 24.1214 64.5166 Constraint 210 360 10.2468 12.8085 19.2127 64.5166 Constraint 190 360 14.2202 17.7753 26.6630 64.5166 Constraint 279 368 12.6496 15.8119 23.7179 64.4590 Constraint 279 360 10.8108 13.5135 20.2702 64.4590 Constraint 267 368 11.6605 14.5756 21.8634 64.4590 Constraint 267 360 10.7038 13.3798 20.0697 64.4590 Constraint 237 449 7.9383 9.9229 14.8843 64.4044 Constraint 201 449 9.1570 11.4463 17.1695 64.4044 Constraint 190 449 11.8773 14.8466 22.2699 64.4044 Constraint 226 391 11.3531 14.1913 21.2870 64.3876 Constraint 221 368 12.4653 15.5816 23.3724 64.2518 Constraint 350 449 13.2753 16.5941 24.8911 64.1986 Constraint 122 399 10.4540 13.0675 19.6013 64.1979 Constraint 113 399 12.5923 15.7404 23.6106 64.1979 Constraint 96 442 8.4835 10.6044 15.9066 64.1880 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 221 449 9.9454 12.4318 18.6476 64.0627 Constraint 153 322 11.1467 13.9334 20.9000 64.0452 Constraint 153 314 12.8736 16.0920 24.1380 64.0452 Constraint 153 259 13.3003 16.6254 24.9381 64.0452 Constraint 330 449 13.2472 16.5590 24.8385 64.0038 Constraint 122 350 13.9082 17.3852 26.0778 63.9628 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 122 442 8.3098 10.3872 15.5809 63.6048 Constraint 113 442 11.6826 14.6032 21.9049 63.6048 Constraint 88 435 12.0776 15.0970 22.6456 63.5196 Constraint 88 412 12.2405 15.3007 22.9510 63.5196 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 128 449 6.3122 7.8903 11.8354 63.3208 Constraint 104 449 8.8377 11.0472 16.5707 63.3208 Constraint 237 368 13.2565 16.5706 24.8560 63.3022 Constraint 201 360 14.2386 17.7982 26.6973 63.3022 Constraint 176 360 14.8742 18.5927 27.8891 63.3022 Constraint 88 267 15.3279 19.1599 28.7398 63.2937 Constraint 272 368 14.0294 17.5367 26.3050 63.2445 Constraint 88 226 15.0807 18.8509 28.2763 63.2085 Constraint 201 382 15.6258 19.5322 29.2984 63.1732 Constraint 153 226 11.1331 13.9164 20.8746 63.1384 Constraint 113 350 14.2253 17.7816 26.6724 63.1108 Constraint 128 461 8.9577 11.1971 16.7956 63.0253 Constraint 104 467 13.5523 16.9404 25.4105 63.0253 Constraint 104 461 10.6271 13.2839 19.9259 63.0253 Constraint 122 250 13.3817 16.7271 25.0907 62.8919 Constraint 122 412 11.0817 13.8522 20.7783 62.8450 Constraint 113 412 14.2790 17.8488 26.7732 62.8450 Constraint 201 350 15.3929 19.2412 28.8617 62.6657 Constraint 297 375 14.7727 18.4658 27.6987 62.6193 Constraint 267 449 13.7330 17.1662 25.7493 62.4826 Constraint 250 449 11.3922 14.2402 21.3603 62.4388 Constraint 104 250 14.7976 18.4970 27.7455 62.1308 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 360 435 10.9784 13.7230 20.5845 62.0836 Constraint 136 461 11.2644 14.0806 21.1208 62.0547 Constraint 404 467 8.6062 10.7577 16.1365 61.9484 Constraint 272 360 11.7253 14.6566 21.9849 61.7237 Constraint 250 368 10.4329 13.0411 19.5617 61.6799 Constraint 250 360 10.9151 13.6439 20.4658 61.6799 Constraint 355 449 14.0623 17.5779 26.3668 61.6277 Constraint 136 267 15.6685 19.5856 29.3784 61.6037 Constraint 226 360 13.5746 16.9683 25.4524 61.5166 Constraint 221 360 10.3388 12.9235 19.3853 61.5166 Constraint 153 330 14.9738 18.7172 28.0758 61.4742 Constraint 153 303 15.7430 19.6788 29.5182 61.4742 Constraint 153 285 14.8523 18.5653 27.8480 61.4742 Constraint 153 267 15.6052 19.5065 29.2597 61.4742 Constraint 144 421 11.4750 14.3438 21.5157 61.4307 Constraint 122 341 14.1667 17.7083 26.5625 61.3957 Constraint 161 449 9.9768 12.4710 18.7065 61.3580 Constraint 136 449 9.3528 11.6910 17.5365 61.3339 Constraint 292 467 14.9146 18.6432 27.9649 61.3064 Constraint 292 461 12.3744 15.4680 23.2020 61.3064 Constraint 259 461 13.6422 17.0528 25.5792 61.3064 Constraint 210 467 13.2030 16.5038 24.7556 61.3064 Constraint 210 461 10.1838 12.7297 19.0946 61.3064 Constraint 182 461 13.4550 16.8188 25.2281 61.3064 Constraint 176 461 14.1097 17.6372 26.4558 61.3064 Constraint 128 467 12.1673 15.2091 22.8136 61.3064 Constraint 169 391 13.1059 16.3823 24.5735 61.2781 Constraint 136 404 16.3098 20.3873 30.5809 61.2775 Constraint 88 442 10.9689 13.7112 20.5667 61.1698 Constraint 144 429 11.6521 14.5651 21.8477 61.1307 Constraint 314 461 11.7460 14.6825 22.0237 61.1298 Constraint 303 461 15.4169 19.2711 28.9066 61.1298 Constraint 297 461 14.8726 18.5907 27.8861 61.1298 Constraint 96 461 8.0356 10.0445 15.0667 60.9321 Constraint 88 355 11.7647 14.7059 22.0588 60.7967 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 360 442 10.5877 13.2346 19.8519 60.7501 Constraint 169 350 14.6237 18.2796 27.4194 60.4655 Constraint 88 250 14.6414 18.3018 27.4527 60.4569 Constraint 242 461 11.0461 13.8077 20.7115 60.3608 Constraint 136 467 14.6130 18.2662 27.3994 60.3358 Constraint 237 355 16.1300 20.1625 30.2437 60.3023 Constraint 226 368 14.8087 18.5109 27.7663 60.3022 Constraint 96 449 6.1214 7.6518 11.4777 60.2295 Constraint 399 467 8.9970 11.2463 16.8694 60.1612 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 136 341 14.4672 18.0840 27.1260 60.0834 Constraint 136 250 16.1195 20.1493 30.2240 59.9457 Constraint 279 375 15.3124 19.1406 28.7108 59.8265 Constraint 144 303 16.4694 20.5868 30.8801 59.7106 Constraint 122 449 5.1170 6.3962 9.5943 59.6462 Constraint 113 449 8.6070 10.7587 16.1380 59.6462 Constraint 182 375 16.1418 20.1772 30.2659 59.6194 Constraint 226 449 10.6783 13.3479 20.0218 59.6173 Constraint 259 467 15.5943 19.4929 29.2394 59.5192 Constraint 136 399 14.4957 18.1196 27.1794 59.4903 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 297 11.5214 14.4017 21.6026 59.4573 Constraint 80 292 11.3872 14.2340 21.3511 59.4573 Constraint 80 285 13.7436 17.1796 25.7693 59.4573 Constraint 80 279 15.3431 19.1788 28.7682 59.4573 Constraint 80 272 15.0930 18.8662 28.2993 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 80 182 11.9628 14.9535 22.4303 59.4573 Constraint 80 176 13.9781 17.4726 26.2090 59.4573 Constraint 80 169 12.2715 15.3394 23.0090 59.4573 Constraint 80 161 14.2582 17.8228 26.7341 59.4573 Constraint 190 382 16.1386 20.1732 30.2598 59.4149 Constraint 169 467 13.7110 17.1388 25.7082 59.3652 Constraint 169 461 10.1111 12.6389 18.9584 59.3652 Constraint 144 412 14.6061 18.2576 27.3864 59.3374 Constraint 144 404 15.5684 19.4605 29.1907 59.3374 Constraint 96 467 10.5020 13.1274 19.6912 59.2132 Constraint 144 435 12.8802 16.1003 24.1505 59.0374 Constraint 322 461 11.7030 14.6288 21.9432 59.0366 Constraint 153 421 9.4927 11.8659 17.7988 58.9412 Constraint 237 461 11.4038 14.2547 21.3821 58.6481 Constraint 201 461 12.9130 16.1413 24.2119 58.6481 Constraint 122 467 9.1790 11.4738 17.2107 58.6481 Constraint 122 461 6.0480 7.5600 11.3400 58.6481 Constraint 113 467 11.9009 14.8762 22.3143 58.6481 Constraint 113 461 9.2294 11.5368 17.3052 58.6481 Constraint 153 279 16.1477 20.1846 30.2769 58.6375 Constraint 153 250 14.1299 17.6624 26.4936 58.6375 Constraint 242 467 13.0293 16.2866 24.4299 58.5736 Constraint 113 267 16.5037 20.6297 30.9445 58.5239 Constraint 80 242 13.8726 17.3408 26.0111 58.5117 Constraint 136 350 15.2007 19.0009 28.5013 58.4456 Constraint 169 360 13.8575 17.3218 25.9827 58.4071 Constraint 314 467 13.6347 17.0434 25.5651 58.3946 Constraint 285 461 14.9267 18.6583 27.9875 58.3946 Constraint 161 467 15.8119 19.7648 29.6472 58.3946 Constraint 161 461 12.1350 15.1688 22.7532 58.3946 Constraint 182 467 16.2622 20.3278 30.4916 58.3064 Constraint 221 461 13.6578 17.0723 25.6084 58.3064 Constraint 80 330 8.8597 11.0746 16.6119 58.2658 Constraint 88 449 7.8606 9.8257 14.7386 58.2276 Constraint 80 350 11.4497 14.3122 21.4683 58.1658 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 144 399 14.4512 18.0640 27.0960 58.1460 Constraint 128 355 14.3515 17.9393 26.9090 58.0597 Constraint 153 429 10.0130 12.5163 18.7744 57.8460 Constraint 153 404 13.6982 17.1227 25.6841 57.8460 Constraint 153 399 13.3173 16.6466 24.9699 57.8460 Constraint 144 330 14.8543 18.5679 27.8519 57.5028 Constraint 80 259 14.5214 18.1517 27.2276 57.4571 Constraint 104 391 12.6815 15.8518 23.7778 57.1115 Constraint 144 442 10.6386 13.2982 19.9474 57.0059 Constraint 237 467 13.7524 17.1905 25.7858 56.8610 Constraint 153 435 10.0615 12.5769 18.8654 56.8479 Constraint 153 412 11.8498 14.8122 22.2183 56.8479 Constraint 80 201 15.0369 18.7961 28.1942 56.7990 Constraint 80 221 14.3677 17.9597 26.9395 56.4573 Constraint 382 449 11.9282 14.9103 22.3654 56.3613 Constraint 330 461 15.3455 19.1819 28.7728 56.2331 Constraint 88 467 9.3171 11.6464 17.4696 56.2132 Constraint 88 461 7.4148 9.2686 13.9028 56.2132 Constraint 96 391 9.1738 11.4673 17.2009 56.1134 Constraint 96 382 12.4647 15.5809 23.3713 56.1134 Constraint 80 429 12.0844 15.1055 22.6582 56.0639 Constraint 80 421 11.1311 13.9138 20.8708 56.0639 Constraint 80 412 15.0555 18.8194 28.2291 56.0639 Constraint 80 404 15.0448 18.8060 28.2090 56.0639 Constraint 322 467 14.4889 18.1112 27.1667 56.0366 Constraint 104 473 13.3682 16.7103 25.0654 55.9231 Constraint 96 375 11.9794 14.9742 22.4613 55.8134 Constraint 190 461 15.5953 19.4942 29.2413 55.7363 Constraint 201 467 15.8984 19.8730 29.8096 55.6482 Constraint 272 461 15.8944 19.8680 29.8020 55.5578 Constraint 350 461 14.7204 18.4005 27.6007 55.5305 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 122 355 14.4708 18.0885 27.1327 55.4015 Constraint 375 449 12.4316 15.5394 23.3092 55.3633 Constraint 421 480 10.4981 13.1226 19.6839 55.3408 Constraint 314 473 11.2618 14.0772 21.1158 55.2206 Constraint 80 355 12.0573 15.0716 22.6074 55.1772 Constraint 144 467 12.3981 15.4976 23.2465 55.1406 Constraint 144 461 8.9194 11.1493 16.7239 55.1406 Constraint 144 449 8.2009 10.2511 15.3766 55.1406 Constraint 80 435 15.4078 19.2597 28.8896 55.0475 Constraint 412 473 8.9148 11.1434 16.7152 55.0347 Constraint 226 350 14.8555 18.5694 27.8540 55.0049 Constraint 80 399 11.6889 14.6111 21.9166 54.8724 Constraint 226 375 16.3568 20.4459 30.6689 54.8338 Constraint 122 375 14.5718 18.2148 27.3222 54.5990 Constraint 128 391 11.7710 14.7137 22.0705 54.3763 Constraint 122 391 12.0895 15.1118 22.6677 54.3763 Constraint 190 368 16.1957 20.2446 30.3669 54.3132 Constraint 292 473 13.0042 16.2552 24.3829 54.2042 Constraint 259 473 13.4035 16.7543 25.1315 54.2042 Constraint 210 473 12.2964 15.3705 23.0558 54.2042 Constraint 128 473 12.2989 15.3736 23.0604 54.2042 Constraint 122 382 14.7539 18.4424 27.6636 54.1782 Constraint 88 391 11.8314 14.7893 22.1839 54.1115 Constraint 153 467 11.9314 14.9143 22.3714 53.9491 Constraint 153 461 8.1479 10.1849 15.2774 53.9491 Constraint 153 449 6.0885 7.6106 11.4158 53.9491 Constraint 314 480 13.2582 16.5727 24.8591 53.8200 Constraint 292 480 15.6135 19.5169 29.2754 53.8200 Constraint 210 480 14.9194 18.6493 27.9739 53.8200 Constraint 128 480 13.9592 17.4490 26.1735 53.8200 Constraint 104 480 14.1122 17.6403 26.4604 53.8200 Constraint 80 190 15.7590 19.6988 29.5481 53.7991 Constraint 80 442 13.7477 17.1846 25.7769 53.7141 Constraint 169 473 13.7205 17.1506 25.7260 53.3946 Constraint 242 473 11.4534 14.3168 21.4752 53.2587 Constraint 412 480 12.4549 15.5686 23.3529 53.2475 Constraint 104 360 11.1395 13.9244 20.8866 53.2425 Constraint 96 368 11.6186 14.5232 21.7848 53.2425 Constraint 96 360 7.7682 9.7103 14.5654 53.2425 Constraint 113 391 14.3117 17.8896 26.8344 53.1618 Constraint 322 473 12.8737 16.0921 24.1382 53.1273 Constraint 96 473 9.9375 12.4218 18.6327 53.1273 Constraint 330 473 15.8812 19.8515 29.7772 53.0591 Constraint 88 382 14.3391 17.9238 26.8858 52.8971 Constraint 242 480 14.6633 18.3292 27.4938 52.8744 Constraint 355 461 14.7147 18.3934 27.5900 52.8714 Constraint 88 375 12.9312 16.1640 24.2460 52.8134 Constraint 368 449 12.9133 16.1416 24.2124 52.7923 Constraint 360 449 10.3388 12.9234 19.3852 52.7923 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 350 467 15.8378 19.7973 29.6959 52.6056 Constraint 113 355 14.7138 18.3922 27.5883 52.4129 Constraint 404 473 5.4961 6.8701 10.3051 52.3177 Constraint 161 399 16.8511 21.0638 31.5958 52.2499 Constraint 399 473 5.4092 6.7614 10.1422 52.2495 Constraint 128 360 11.7005 14.6257 21.9385 52.2261 Constraint 113 360 12.9810 16.2263 24.3394 52.2261 Constraint 144 259 14.8524 18.5655 27.8483 52.1373 Constraint 341 473 15.5726 19.4657 29.1986 52.0428 Constraint 250 461 13.9971 17.4964 26.2446 52.0183 Constraint 161 303 16.9269 21.1586 31.7379 51.9562 Constraint 399 480 8.5086 10.6358 15.9537 51.9334 Constraint 226 461 14.3207 17.9009 26.8514 51.7678 Constraint 350 480 14.9533 18.6916 28.0374 51.7450 Constraint 322 480 14.4492 18.0615 27.0922 51.7267 Constraint 237 473 13.3230 16.6537 24.9805 51.5460 Constraint 122 473 10.2048 12.7560 19.1341 51.5460 Constraint 113 473 12.7742 15.9677 23.9515 51.5460 Constraint 404 480 9.4119 11.7649 17.6474 51.5286 Constraint 350 473 12.8801 16.1002 24.1503 51.3402 Constraint 201 368 16.2128 20.2660 30.3990 51.3132 Constraint 221 473 14.6129 18.2662 27.3992 51.2042 Constraint 169 480 15.7414 19.6768 29.5152 51.1617 Constraint 122 480 11.0746 13.8433 20.7649 51.1617 Constraint 113 480 12.8245 16.0306 24.0459 51.1617 Constraint 80 267 16.2447 20.3059 30.4588 50.8842 Constraint 272 375 15.9986 19.9982 29.9973 50.8361 Constraint 96 480 11.1551 13.9439 20.9159 50.7287 Constraint 221 467 16.0231 20.0289 30.0433 50.5289 Constraint 122 360 11.4034 14.2542 21.3814 50.5072 Constraint 88 360 9.7651 12.2064 18.3096 50.2425 Constraint 169 382 15.6959 19.6199 29.4298 50.2135 Constraint 144 473 13.7831 17.2289 25.8433 50.1407 Constraint 144 285 16.0192 20.0240 30.0360 50.0864 Constraint 80 461 11.0165 13.7706 20.6560 49.9555 Constraint 153 391 14.1621 17.7026 26.5540 49.9500 Constraint 153 480 14.3391 17.9238 26.8857 49.9473 Constraint 144 480 14.1134 17.6417 26.4626 49.9473 Constraint 128 382 14.8015 18.5019 27.7528 49.9067 Constraint 355 467 14.9447 18.6809 28.0213 49.8714 Constraint 303 473 14.6888 18.3610 27.5416 49.6475 Constraint 297 473 15.4917 19.3647 29.0470 49.6475 Constraint 391 467 12.5117 15.6397 23.4595 49.6070 Constraint 391 461 11.5202 14.4002 21.6004 49.6070 Constraint 382 461 12.8336 16.0420 24.0629 49.6070 Constraint 375 461 12.3793 15.4741 23.2112 49.6070 Constraint 122 368 14.7823 18.4779 27.7169 49.2928 Constraint 355 480 13.4912 16.8640 25.2960 49.1740 Constraint 88 473 9.5432 11.9290 17.8935 49.1110 Constraint 88 368 13.3621 16.7027 25.0540 49.0280 Constraint 153 473 13.0481 16.3101 24.4651 48.9492 Constraint 355 473 11.8557 14.8197 22.2295 48.7692 Constraint 88 480 9.3489 11.6861 17.5292 48.7267 Constraint 285 473 14.0180 17.5226 26.2838 48.6312 Constraint 182 473 14.9239 18.6549 27.9823 48.6312 Constraint 128 375 15.2144 19.0180 28.5271 48.6086 Constraint 80 237 15.0082 18.7603 28.1404 48.3892 Constraint 80 467 13.2514 16.5642 24.8463 48.2366 Constraint 80 449 10.5703 13.2129 19.8194 48.2366 Constraint 382 467 12.6484 15.8105 23.7158 47.8881 Constraint 375 467 11.4448 14.3060 21.4590 47.8881 Constraint 153 382 16.4839 20.6048 30.9073 47.3791 Constraint 368 461 13.9886 17.4858 26.2286 47.0360 Constraint 80 391 13.6811 17.1013 25.6520 46.6210 Constraint 136 480 15.7945 19.7432 29.6147 46.6152 Constraint 80 360 10.9690 13.7112 20.5668 46.5210 Constraint 153 360 14.5047 18.1309 27.1964 46.3810 Constraint 169 355 16.5410 20.6762 31.0143 46.2364 Constraint 136 391 15.0981 18.8727 28.3090 46.2009 Constraint 104 368 14.8369 18.5462 27.8192 46.0377 Constraint 360 461 11.5224 14.4031 21.6046 46.0197 Constraint 201 473 15.4746 19.3433 29.0149 45.9730 Constraint 330 435 15.8071 19.7589 29.6383 45.8793 Constraint 80 473 13.2264 16.5329 24.7994 45.3604 Constraint 190 355 16.6610 20.8263 31.2395 45.3562 Constraint 368 467 14.0122 17.5152 26.2728 45.3171 Constraint 259 480 16.2638 20.3297 30.4946 44.9929 Constraint 341 461 16.3181 20.3976 30.5964 44.3963 Constraint 169 368 16.3245 20.4056 30.6084 44.3516 Constraint 104 382 15.5873 19.4841 29.2262 44.3337 Constraint 360 467 12.3427 15.4283 23.1425 44.3008 Constraint 144 391 15.8263 19.7829 29.6743 44.2597 Constraint 250 473 13.6295 17.0369 25.5553 44.0073 Constraint 285 467 16.4729 20.5911 30.8867 43.9063 Constraint 128 368 14.5833 18.2291 27.3437 43.3025 Constraint 153 350 16.1331 20.1663 30.2495 43.2752 Constraint 104 375 15.1397 18.9246 28.3869 43.0356 Constraint 169 375 16.8596 21.0745 31.6117 42.6982 Constraint 250 467 15.2497 19.0621 28.5932 42.5481 Constraint 80 480 12.7434 15.9293 23.8939 42.4500 Constraint 136 360 14.3396 17.9245 26.8867 42.3318 Constraint 226 467 16.7442 20.9302 31.3953 42.2997 Constraint 391 480 12.5036 15.6295 23.4443 42.1888 Constraint 161 473 16.1705 20.2131 30.3197 42.1634 Constraint 144 250 15.9809 19.9761 29.9642 42.0969 Constraint 136 473 14.5839 18.2299 27.3449 41.8312 Constraint 391 473 9.2276 11.5346 17.3018 41.7840 Constraint 136 355 16.4788 20.5986 30.8978 41.3018 Constraint 226 473 15.9477 19.9346 29.9019 41.1858 Constraint 382 480 12.6900 15.8625 23.7938 41.1725 Constraint 382 473 9.2058 11.5072 17.2608 40.7859 Constraint 375 473 7.3186 9.1482 13.7223 40.7859 Constraint 80 375 14.7104 18.3880 27.5820 40.5432 Constraint 80 368 14.6897 18.3622 27.5432 40.5432 Constraint 113 375 16.0396 20.0495 30.0742 40.4647 Constraint 144 360 15.2650 19.0813 28.6219 40.3906 Constraint 375 480 10.0903 12.6129 18.9194 40.1744 Constraint 113 250 15.3714 19.2143 28.8214 39.7999 Constraint 267 461 16.4475 20.5594 30.8391 39.2203 Constraint 237 480 15.8375 19.7968 29.6953 39.1829 Constraint 360 473 9.1894 11.4867 17.2301 38.9176 Constraint 421 489 9.0995 11.3744 17.0615 38.3582 Constraint 368 473 10.1112 12.6390 18.9585 38.2150 Constraint 113 368 16.1561 20.1951 30.2926 37.7294 Constraint 80 382 16.3329 20.4161 30.6242 37.6539 Constraint 368 480 13.0563 16.3204 24.4805 37.6035 Constraint 360 480 11.4857 14.3571 21.5357 37.6035 Constraint 341 435 15.6914 19.6143 29.4215 37.5112 Constraint 429 489 6.4851 8.1064 12.1596 37.3601 Constraint 161 391 16.6674 20.8343 31.2514 37.2630 Constraint 412 489 11.7543 14.6929 22.0393 36.2650 Constraint 435 497 9.0386 11.2982 16.9473 36.0872 Constraint 421 497 6.5914 8.2393 12.3589 36.0872 Constraint 314 489 11.7738 14.7172 22.0758 35.8393 Constraint 292 489 13.5271 16.9088 25.3633 35.8393 Constraint 259 489 15.0921 18.8651 28.2977 35.8393 Constraint 210 489 12.3674 15.4593 23.1889 35.8393 Constraint 182 489 14.8375 18.5469 27.8204 35.8393 Constraint 176 489 16.3222 20.4028 30.6041 35.8393 Constraint 169 489 12.7824 15.9780 23.9670 35.8393 Constraint 161 489 14.9901 18.7376 28.1064 35.8393 Constraint 136 489 12.8929 16.1161 24.1742 35.8393 Constraint 128 489 10.7683 13.4604 20.1905 35.8393 Constraint 104 489 11.2055 14.0069 21.0104 35.8393 Constraint 161 404 16.9807 21.2259 31.8389 35.7501 Constraint 399 489 8.8894 11.1118 16.6677 35.6717 Constraint 104 497 10.0227 12.5284 18.7926 35.2873 Constraint 404 489 10.1074 12.6342 18.9513 35.2669 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 242 489 13.1149 16.3937 24.5905 34.8937 Constraint 221 489 15.3423 19.1778 28.7668 34.8393 Constraint 350 489 14.4492 18.0615 27.0923 34.7624 Constraint 144 350 16.3852 20.4815 30.7222 34.7021 Constraint 314 497 9.0462 11.3077 16.9616 34.5847 Constraint 303 497 12.8601 16.0751 24.1127 34.5847 Constraint 297 497 13.2309 16.5386 24.8080 34.5847 Constraint 330 497 12.7120 15.8899 23.8349 34.2104 Constraint 322 497 10.0365 12.5456 18.8185 34.2104 Constraint 272 473 16.3405 20.4256 30.6384 34.1366 Constraint 412 497 9.3652 11.7065 17.5597 33.9940 Constraint 355 497 10.3835 12.9794 19.4690 33.9104 Constraint 350 497 11.5111 14.3889 21.5833 33.9104 Constraint 341 497 13.0055 16.2568 24.3853 33.9104 Constraint 322 489 12.0090 15.0112 22.5168 33.7461 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 226 355 16.4657 20.5822 30.8732 33.5748 Constraint 136 497 12.2765 15.3457 23.0185 33.5683 Constraint 128 497 9.6045 12.0057 18.0085 33.5683 Constraint 330 489 14.9784 18.7231 28.0846 33.4813 Constraint 399 497 5.7426 7.1782 10.7673 33.4007 Constraint 292 497 10.7892 13.4866 20.2298 33.2683 Constraint 285 497 12.8699 16.0874 24.1311 33.2683 Constraint 272 497 15.1360 18.9201 28.3801 33.2683 Constraint 267 497 15.5077 19.3846 29.0769 33.2683 Constraint 259 497 12.1749 15.2186 22.8279 33.2683 Constraint 210 497 10.3590 12.9488 19.4232 33.2683 Constraint 182 497 12.8840 16.1050 24.1574 33.2683 Constraint 176 497 14.8894 18.6117 27.9176 33.2683 Constraint 169 497 11.7828 14.7286 22.0928 33.2683 Constraint 201 489 15.5721 19.4651 29.1976 33.1810 Constraint 153 489 11.4660 14.3325 21.4987 33.1810 Constraint 144 489 10.9881 13.7351 20.6027 33.1810 Constraint 122 489 7.9151 9.8939 14.8408 33.1810 Constraint 113 489 9.9260 12.4075 18.6113 33.1810 Constraint 404 497 7.8585 9.8232 14.7347 32.9959 Constraint 341 480 15.7574 19.6968 29.5452 32.8997 Constraint 96 497 6.5994 8.2493 12.3739 32.4914 Constraint 242 497 10.4719 13.0898 19.6348 32.3228 Constraint 221 497 12.8175 16.0219 24.0328 32.2683 Constraint 161 497 14.6867 18.3584 27.5375 32.0539 Constraint 267 473 15.9902 19.9878 29.9817 32.0279 Constraint 88 497 5.7830 7.2287 10.8431 31.4751 Constraint 279 497 15.8147 19.7684 29.6526 31.4479 Constraint 176 382 16.9077 21.1346 31.7019 31.1382 Constraint 122 497 7.5491 9.4364 14.1546 30.9101 Constraint 113 497 9.5027 11.8783 17.8175 30.9101 Constraint 237 497 12.6556 15.8195 23.7293 30.6101 Constraint 201 497 14.0095 17.5119 26.2679 30.6101 Constraint 190 497 15.7600 19.7001 29.5501 30.6101 Constraint 153 497 11.1774 13.9718 20.9577 30.6101 Constraint 144 497 11.2893 14.1116 21.1675 30.6101 Constraint 237 489 14.3311 17.9139 26.8708 30.3443 Constraint 80 497 9.7929 12.2411 18.3617 30.2864 Constraint 303 489 15.0508 18.8135 28.2203 30.0025 Constraint 297 489 15.0968 18.8710 28.3064 30.0025 Constraint 285 489 15.3559 19.1949 28.7923 30.0025 Constraint 341 489 15.3959 19.2449 28.8674 29.6282 Constraint 226 497 14.9919 18.7399 28.1098 29.6101 Constraint 355 489 12.7526 15.9408 23.9112 29.1914 Constraint 176 473 15.9115 19.8894 29.8341 29.1745 Constraint 399 511 7.5655 9.4569 14.1853 28.8394 Constraint 176 355 16.9696 21.2120 31.8180 28.7361 Constraint 80 489 10.3060 12.8825 19.3238 28.4674 Constraint 435 511 11.3719 14.2149 21.3224 28.4346 Constraint 429 511 8.1092 10.1365 15.2047 28.4346 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 412 511 11.6291 14.5364 21.8046 28.4346 Constraint 250 497 13.4760 16.8450 25.2675 28.3384 Constraint 285 480 16.1661 20.2076 30.3115 27.4308 Constraint 144 267 17.0664 21.3330 31.9995 27.1905 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 113 382 16.3731 20.4663 30.6995 27.0385 Constraint 341 511 13.9920 17.4901 26.2351 27.0175 Constraint 330 511 14.4908 18.1135 27.1702 26.9321 Constraint 322 511 12.4951 15.6189 23.4283 26.9321 Constraint 303 511 14.7398 18.4248 27.6372 26.9321 Constraint 391 489 12.2902 15.3627 23.0441 26.9251 Constraint 404 511 9.2414 11.5517 17.3276 26.7157 Constraint 355 511 9.9140 12.3925 18.5888 26.6321 Constraint 350 511 12.1816 15.2270 22.8404 26.6321 Constraint 250 489 15.6953 19.6191 29.4287 26.3416 Constraint 303 480 15.7529 19.6911 29.5366 26.0040 Constraint 314 511 10.7940 13.4924 20.2387 25.9157 Constraint 128 511 13.3782 16.7228 25.0842 25.9157 Constraint 104 511 12.9952 16.2440 24.3659 25.9157 Constraint 96 511 9.5650 11.9562 17.9343 25.9157 Constraint 297 511 15.9742 19.9677 29.9515 25.6157 Constraint 292 511 13.6966 17.1208 25.6812 25.6157 Constraint 285 511 14.8297 18.5371 27.8057 25.6157 Constraint 259 511 14.4652 18.0815 27.1223 25.6157 Constraint 221 511 15.6642 19.5803 29.3704 25.6157 Constraint 210 511 13.7717 17.2146 25.8218 25.6157 Constraint 182 511 16.3372 20.4215 30.6323 25.6157 Constraint 169 511 15.6165 19.5206 29.2809 25.6157 Constraint 88 511 8.2671 10.3339 15.5008 25.6157 Constraint 80 226 16.3981 20.4976 30.7464 25.2470 Constraint 382 489 13.4154 16.7692 25.1538 25.2062 Constraint 144 341 15.9882 19.9853 29.9780 25.0148 Constraint 330 480 15.6321 19.5401 29.3101 24.9195 Constraint 80 511 11.4172 14.2715 21.4073 24.8061 Constraint 250 480 16.2621 20.3276 30.4914 24.7685 Constraint 153 341 15.7915 19.7393 29.6090 24.7513 Constraint 242 511 12.7588 15.9485 23.9228 24.6701 Constraint 391 497 9.4664 11.8330 17.7496 24.6542 Constraint 201 355 16.8739 21.0924 31.6385 24.6075 Constraint 279 461 16.5560 20.6949 31.0424 24.0240 Constraint 391 511 11.1040 13.8800 20.8201 23.9909 Constraint 382 497 10.8993 13.6242 20.4362 23.6561 Constraint 303 467 16.0073 20.0091 30.0137 23.5088 Constraint 375 497 9.4339 11.7923 17.6885 23.3561 Constraint 368 497 10.7808 13.4760 20.2141 23.3561 Constraint 360 497 8.1803 10.2254 15.3380 23.3561 Constraint 375 489 11.4736 14.3421 21.5131 23.1918 Constraint 153 511 14.6527 18.3159 27.4739 22.9575 Constraint 122 511 10.6044 13.2554 19.8832 22.9575 Constraint 113 511 12.3843 15.4803 23.2205 22.9575 Constraint 153 375 16.9380 21.1725 31.7588 22.8284 Constraint 250 511 15.7306 19.6632 29.4948 22.7790 Constraint 360 511 9.7306 12.1633 18.2449 22.6928 Constraint 360 489 11.1761 13.9701 20.9552 22.3398 Constraint 382 511 11.6699 14.5873 21.8810 22.2720 Constraint 585 651 12.2057 15.2572 22.8858 22.1681 Constraint 341 467 16.6520 20.8151 31.2226 21.9428 Constraint 303 604 13.4639 16.8298 25.2447 21.6864 Constraint 368 489 13.5660 16.9575 25.4363 21.6372 Constraint 176 368 16.7762 20.9702 31.4554 21.5994 Constraint 201 375 16.7477 20.9347 31.4020 21.5914 Constraint 303 599 13.2521 16.5652 24.8478 21.5191 Constraint 375 511 8.7219 10.9024 16.3536 20.9739 Constraint 368 511 10.7660 13.4574 20.1862 20.9739 Constraint 303 590 14.9799 18.7249 28.0874 20.7095 Constraint 341 604 13.3596 16.6995 25.0493 20.6018 Constraint 599 668 11.6152 14.5190 21.7785 20.5939 Constraint 297 599 13.6442 17.0552 25.5828 20.5191 Constraint 279 599 14.5847 18.2308 27.3463 20.5191 Constraint 285 599 13.7783 17.2229 25.8343 20.5028 Constraint 221 480 16.4508 20.5635 30.8453 20.1827 Constraint 399 519 10.2772 12.8466 19.2698 20.1813 Constraint 237 511 15.0815 18.8519 28.2779 20.1207 Constraint 176 467 15.7752 19.7190 29.5785 20.0979 Constraint 136 511 15.1005 18.8756 28.3135 20.0427 Constraint 341 599 13.6998 17.1247 25.6871 19.8779 Constraint 435 519 12.5598 15.6997 23.5496 19.7765 Constraint 429 519 9.6616 12.0770 18.1156 19.7765 Constraint 421 519 10.8762 13.5952 20.3928 19.7765 Constraint 412 519 13.3494 16.6868 25.0302 19.7765 Constraint 350 604 15.2307 19.0384 28.5575 19.6220 Constraint 590 657 11.6598 14.5748 21.8621 19.6092 Constraint 267 599 15.2017 19.0022 28.5032 19.5028 Constraint 585 657 11.9140 14.8925 22.3388 19.2044 Constraint 144 279 17.2126 21.5158 32.2737 19.1986 Constraint 449 519 10.8548 13.5686 20.3528 19.1430 Constraint 557 629 11.8700 14.8374 22.2562 19.1335 Constraint 341 590 14.8450 18.5563 27.8344 19.0519 Constraint 153 519 14.5802 18.2252 27.3378 18.9575 Constraint 144 519 13.7391 17.1738 25.7607 18.9575 Constraint 122 519 10.8755 13.5944 20.3915 18.9575 Constraint 113 519 11.9668 14.9585 22.4377 18.9575 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 314 622 12.9849 16.2311 24.3467 18.8945 Constraint 330 604 13.3929 16.7411 25.1117 18.8829 Constraint 330 599 13.9510 17.4388 26.1582 18.7319 Constraint 590 668 13.1606 16.4507 24.6760 18.6092 Constraint 604 676 11.7978 14.7473 22.1209 18.5958 Constraint 314 604 10.8980 13.6225 20.4338 18.5897 Constraint 297 604 13.1022 16.3778 24.5666 18.5057 Constraint 442 519 12.9829 16.2286 24.3429 18.4430 Constraint 585 668 13.5009 16.8762 25.3143 18.2044 Constraint 552 629 12.7584 15.9480 23.9220 18.1354 Constraint 544 613 13.0857 16.3572 24.5357 18.1064 Constraint 314 613 12.7266 15.9083 23.8624 18.0848 Constraint 404 519 11.6816 14.6020 21.9030 18.0576 Constraint 190 473 15.8735 19.8419 29.7628 17.9938 Constraint 391 519 12.9546 16.1932 24.2898 17.9910 Constraint 303 585 14.1814 17.7268 26.5902 17.9868 Constraint 350 519 13.7814 17.2267 25.8401 17.9739 Constraint 136 519 15.2177 19.0221 28.5332 17.9576 Constraint 88 519 8.5041 10.6301 15.9452 17.9576 Constraint 322 622 13.4254 16.7817 25.1726 17.8945 Constraint 322 613 12.9203 16.1504 24.2256 17.8945 Constraint 297 467 14.7623 18.4528 27.6793 17.8506 Constraint 242 629 12.0311 15.0389 22.5584 17.7638 Constraint 330 467 16.1631 20.2039 30.3059 17.7513 Constraint 429 604 9.0214 11.2768 16.9152 17.6163 Constraint 322 604 10.3153 12.8941 19.3412 17.5897 Constraint 242 604 11.5155 14.3944 21.5915 17.5734 Constraint 303 622 15.5749 19.4686 29.2029 17.4897 Constraint 285 622 15.3995 19.2494 28.8741 17.4897 Constraint 421 604 10.0793 12.5991 18.8986 17.4288 Constraint 144 511 13.5775 16.9719 25.4578 17.3844 Constraint 279 604 14.2416 17.8020 26.7030 17.2913 Constraint 429 613 10.2439 12.8048 19.2073 17.2828 Constraint 322 519 12.4521 15.5651 23.3477 17.2576 Constraint 314 519 11.8751 14.8438 22.2658 17.2576 Constraint 128 519 13.1830 16.4788 24.7182 17.2576 Constraint 104 519 12.6896 15.8620 23.7930 17.2576 Constraint 96 519 9.8146 12.2683 18.4025 17.2576 Constraint 429 599 10.3830 12.9787 19.4681 17.2123 Constraint 449 527 9.4057 11.7571 17.6356 17.1430 Constraint 412 604 11.9048 14.8809 22.3214 17.1288 Constraint 599 676 12.4718 15.5898 23.3847 17.0305 Constraint 391 527 10.6418 13.3023 19.9534 16.9929 Constraint 382 527 12.9357 16.1696 24.2544 16.9929 Constraint 153 368 16.8003 21.0004 31.5006 16.9919 Constraint 429 629 10.5261 13.1576 19.7364 16.9828 Constraint 429 622 10.9241 13.6551 20.4826 16.9828 Constraint 153 355 16.9271 21.1588 31.7383 16.9805 Constraint 404 604 10.2659 12.8324 19.2486 16.9674 Constraint 544 622 12.7554 15.9442 23.9163 16.9604 Constraint 210 519 14.0399 17.5499 26.3249 16.9576 Constraint 577 644 12.4144 15.5180 23.2770 16.9280 Constraint 285 604 13.7486 17.1857 25.7786 16.9230 Constraint 330 590 14.8658 18.5822 27.8734 16.9060 Constraint 88 552 13.5461 16.9326 25.3989 16.8692 Constraint 161 360 16.8172 21.0215 31.5322 16.8287 Constraint 435 527 10.8445 13.5556 20.3334 16.7766 Constraint 421 527 8.6354 10.7942 16.1914 16.7766 Constraint 412 527 11.1519 13.9399 20.9099 16.7766 Constraint 399 604 10.3751 12.9689 19.4533 16.7310 Constraint 303 629 14.9058 18.6322 27.9483 16.7086 Constraint 375 527 11.7721 14.7151 22.0726 16.6929 Constraint 368 527 12.4069 15.5087 23.2630 16.6929 Constraint 360 527 9.4450 11.8062 17.7093 16.6929 Constraint 355 527 11.9050 14.8813 22.3219 16.6929 Constraint 360 613 13.3496 16.6870 25.0305 16.6872 Constraint 341 585 13.2803 16.6004 24.9006 16.6788 Constraint 242 622 11.8891 14.8614 22.2921 16.5772 Constraint 292 604 11.2664 14.0830 21.1245 16.5734 Constraint 237 604 11.8464 14.8080 22.2119 16.5734 Constraint 210 604 10.0841 12.6051 18.9076 16.5734 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 435 535 12.5675 15.7094 23.5640 16.4600 Constraint 429 535 10.2766 12.8457 19.2685 16.4600 Constraint 421 535 10.2130 12.7662 19.1493 16.4600 Constraint 80 250 15.0433 18.8041 28.2062 16.4199 Constraint 350 585 15.5829 19.4787 29.2180 16.3494 Constraint 435 613 12.7803 15.9753 23.9630 16.3317 Constraint 421 585 13.1838 16.4797 24.7196 16.3209 Constraint 382 519 13.9942 17.4928 26.2392 16.2721 Constraint 399 527 8.1919 10.2399 15.3599 16.1833 Constraint 399 629 11.7678 14.7098 22.0647 16.1803 Constraint 544 629 13.5073 16.8842 25.3263 16.1508 Constraint 80 519 10.9430 13.6788 20.5182 16.1480 Constraint 322 629 12.4130 15.5163 23.2744 16.0970 Constraint 571 636 12.5948 15.7434 23.6152 16.0630 Constraint 590 676 14.3743 17.9679 26.9518 16.0459 Constraint 421 622 11.0053 13.7566 20.6349 15.9707 Constraint 421 613 11.3603 14.2004 21.3006 15.9707 Constraint 153 527 12.2527 15.3158 22.9738 15.9576 Constraint 144 527 11.6628 14.5785 21.8678 15.9576 Constraint 122 527 8.9644 11.2055 16.8083 15.9576 Constraint 113 527 10.2985 12.8731 19.3097 15.9576 Constraint 88 527 8.1900 10.2375 15.3562 15.9576 Constraint 259 604 12.9092 16.1365 24.2047 15.9067 Constraint 292 622 13.3670 16.7087 25.0631 15.8983 Constraint 104 577 13.7923 17.2404 25.8606 15.8926 Constraint 429 527 7.8000 9.7499 14.6249 15.7785 Constraint 404 527 10.4794 13.0993 19.6490 15.7785 Constraint 391 604 11.4652 14.3315 21.4973 15.7157 Constraint 360 604 11.4758 14.3447 21.5171 15.7157 Constraint 314 629 11.9118 14.8897 22.3346 15.6922 Constraint 292 629 12.5058 15.6322 23.4483 15.6922 Constraint 285 629 14.3497 17.9371 26.9056 15.6922 Constraint 259 629 13.3282 16.6603 24.9904 15.6922 Constraint 330 527 12.3164 15.3955 23.0933 15.6594 Constraint 322 599 10.6166 13.2708 19.9061 15.5965 Constraint 322 590 12.4341 15.5426 23.3139 15.5965 Constraint 314 599 9.9243 12.4054 18.6081 15.5965 Constraint 314 590 11.7599 14.6999 22.0499 15.5965 Constraint 292 599 11.0910 13.8638 20.7957 15.5965 Constraint 292 590 13.7944 17.2430 25.8646 15.5965 Constraint 242 599 10.1332 12.6665 18.9998 15.5965 Constraint 210 599 10.3591 12.9489 19.4234 15.5965 Constraint 210 590 13.5040 16.8800 25.3199 15.5965 Constraint 391 622 12.4465 15.5581 23.3371 15.5698 Constraint 391 613 12.8971 16.1214 24.1821 15.5698 Constraint 210 622 11.5608 14.4510 21.6765 15.5650 Constraint 442 604 11.8251 14.7814 22.1720 15.4441 Constraint 442 527 10.3979 12.9974 19.4961 15.4431 Constraint 404 622 10.5186 13.1482 19.7223 15.3945 Constraint 404 613 10.4816 13.1020 19.6530 15.3945 Constraint 341 527 12.5255 15.6569 23.4854 15.3594 Constraint 435 604 11.4375 14.2969 21.4453 15.3317 Constraint 604 687 12.1060 15.1325 22.6988 15.3198 Constraint 330 519 14.0367 17.5458 26.3188 15.2739 Constraint 136 527 12.8518 16.0647 24.0970 15.2576 Constraint 128 527 10.9511 13.6888 20.5333 15.2576 Constraint 104 527 10.9682 13.7102 20.5653 15.2576 Constraint 297 577 11.9583 14.9479 22.4218 15.2447 Constraint 153 535 13.8519 17.3149 25.9723 15.2141 Constraint 122 535 11.9823 14.9779 22.4668 15.2141 Constraint 113 535 13.3596 16.6995 25.0492 15.2141 Constraint 421 599 9.6833 12.1041 18.1561 15.2124 Constraint 330 585 13.3970 16.7463 25.1194 15.1833 Constraint 429 585 11.5599 14.4498 21.6748 15.1750 Constraint 391 629 12.2370 15.2963 22.9444 15.1649 Constraint 80 552 13.3818 16.7273 25.0909 15.1480 Constraint 442 535 12.6513 15.8142 23.7213 15.1266 Constraint 113 552 13.4036 16.7545 25.1318 15.1093 Constraint 104 552 12.8625 16.0781 24.1172 15.1093 Constraint 355 604 13.6949 17.1187 25.6780 15.0490 Constraint 375 604 11.5152 14.3941 21.5911 15.0089 Constraint 382 622 12.5912 15.7390 23.6086 14.9968 Constraint 382 613 13.1432 16.4290 24.6435 14.9968 Constraint 375 613 11.8812 14.8515 22.2773 14.9968 Constraint 122 599 13.2609 16.5761 24.8642 14.9882 Constraint 442 585 14.5147 18.1434 27.2151 14.9875 Constraint 421 629 10.0693 12.5866 18.8799 14.9829 Constraint 412 629 11.1615 13.9518 20.9277 14.9829 Constraint 412 622 11.2623 14.0778 21.1168 14.9829 Constraint 412 613 12.2149 15.2686 22.9029 14.9829 Constraint 429 636 12.6606 15.8258 23.7386 14.9819 Constraint 404 629 10.2833 12.8541 19.2812 14.9797 Constraint 375 535 10.5819 13.2273 19.8410 14.9740 Constraint 368 519 13.3926 16.7407 25.1110 14.9740 Constraint 360 519 11.0387 13.7983 20.6975 14.9740 Constraint 355 519 10.9704 13.7130 20.5695 14.9739 Constraint 161 527 15.2900 19.1125 28.6688 14.9576 Constraint 285 590 14.9905 18.7382 28.1072 14.9297 Constraint 259 599 11.7348 14.6685 22.0027 14.9297 Constraint 435 599 12.4545 15.5681 23.3522 14.9277 Constraint 259 622 13.7836 17.2296 25.8443 14.8983 Constraint 442 599 12.4961 15.6201 23.4302 14.8923 Constraint 360 622 13.0366 16.2957 24.4436 14.8745 Constraint 461 535 10.1930 12.7413 19.1119 14.8285 Constraint 449 535 10.9344 13.6680 20.5020 14.8266 Constraint 113 544 14.2472 17.8090 26.7135 14.8093 Constraint 210 552 15.5127 19.3908 29.0862 14.7939 Constraint 355 535 10.1675 12.7094 19.0641 14.7865 Constraint 314 552 13.9817 17.4772 26.2158 14.7768 Constraint 237 629 10.6528 13.3160 19.9740 14.7676 Constraint 210 629 10.3327 12.9159 19.3739 14.7676 Constraint 368 604 12.7528 15.9410 23.9115 14.7279 Constraint 314 636 14.5991 18.2489 27.3733 14.7076 Constraint 473 599 9.9161 12.3952 18.5927 14.6947 Constraint 585 676 15.2079 19.0099 28.5148 14.6411 Constraint 250 599 13.2062 16.5077 24.7616 14.6087 Constraint 242 590 12.6551 15.8189 23.7283 14.6087 Constraint 399 622 11.2420 14.0525 21.0788 14.5851 Constraint 242 613 12.6144 15.7680 23.6520 14.5830 Constraint 404 599 9.8305 12.2881 18.4322 14.5757 Constraint 577 668 14.1741 17.7177 26.5765 14.5473 Constraint 577 657 11.5537 14.4421 21.6631 14.5473 Constraint 604 698 12.4866 15.6083 23.4124 14.5241 Constraint 128 535 12.7940 15.9925 23.9887 14.5141 Constraint 473 613 11.0211 13.7764 20.6645 14.4580 Constraint 449 604 12.4094 15.5118 23.2676 14.4477 Constraint 297 480 14.9939 18.7424 28.1136 14.3478 Constraint 571 651 13.7982 17.2477 25.8716 14.3312 Constraint 571 644 14.2158 17.7697 26.6545 14.3312 Constraint 480 599 10.1010 12.6262 18.9394 14.3104 Constraint 480 590 11.1818 13.9772 20.9659 14.3104 Constraint 322 527 9.5978 11.9972 17.9958 14.2577 Constraint 96 527 7.7305 9.6632 14.4947 14.2577 Constraint 314 535 11.0537 13.8171 20.7257 14.2305 Constraint 169 535 14.1115 17.6394 26.4591 14.2141 Constraint 104 535 13.0636 16.3294 24.4942 14.2141 Constraint 421 590 11.4769 14.3461 21.5192 14.2124 Constraint 399 599 9.8978 12.3723 18.5584 14.1811 Constraint 322 577 11.5281 14.4101 21.6151 14.1515 Constraint 314 577 11.5079 14.3848 21.5772 14.1515 Constraint 292 577 12.5597 15.6996 23.5494 14.1515 Constraint 285 577 12.7572 15.9465 23.9198 14.1515 Constraint 80 527 10.5801 13.2251 19.8377 14.1480 Constraint 292 519 13.9312 17.4139 26.1209 14.1209 Constraint 242 519 13.5507 16.9384 25.4076 14.1209 Constraint 136 552 14.0038 17.5048 26.2572 14.1093 Constraint 136 544 14.1634 17.7043 26.5564 14.1093 Constraint 128 552 13.6929 17.1161 25.6742 14.1093 Constraint 429 590 10.4169 13.0212 19.5318 14.0786 Constraint 480 613 10.5029 13.1287 19.6930 14.0738 Constraint 480 604 8.9979 11.2474 16.8711 14.0737 Constraint 96 552 13.7187 17.1484 25.7225 14.0324 Constraint 473 585 10.1053 12.6317 18.9475 14.0310 Constraint 449 585 13.1079 16.3849 24.5773 14.0207 Constraint 399 613 10.5055 13.1318 19.6977 14.0122 Constraint 297 585 13.9150 17.3938 26.0907 13.9964 Constraint 285 585 15.6288 19.5359 29.3039 13.9964 Constraint 442 629 11.1233 13.9041 20.8562 13.9964 Constraint 442 622 11.6092 14.5115 21.7672 13.9964 Constraint 144 355 16.8659 21.0824 31.6236 13.9919 Constraint 122 604 12.5650 15.7062 23.5594 13.9882 Constraint 113 604 13.3003 16.6254 24.9380 13.9882 Constraint 577 676 15.5490 19.4362 29.1543 13.9744 Constraint 375 519 11.3528 14.1910 21.2866 13.9577 Constraint 314 527 9.2842 11.6053 17.4079 13.9577 Constraint 292 527 11.4891 14.3614 21.5421 13.9577 Constraint 221 527 13.2632 16.5790 24.8685 13.9577 Constraint 210 527 10.9866 13.7332 20.5999 13.9577 Constraint 201 527 14.3869 17.9837 26.9755 13.9577 Constraint 169 527 12.3848 15.4810 23.2214 13.9577 Constraint 169 519 14.7851 18.4814 27.7221 13.9577 Constraint 480 585 9.8420 12.3025 18.4537 13.9347 Constraint 449 599 11.7593 14.6992 22.0488 13.9256 Constraint 368 622 12.7579 15.9474 23.9211 13.9252 Constraint 368 613 13.2888 16.6110 24.9166 13.9252 Constraint 292 613 13.0675 16.3344 24.5015 13.9041 Constraint 473 552 12.5845 15.7306 23.5959 13.8999 Constraint 480 577 12.3402 15.4253 23.1379 13.8979 Constraint 449 590 14.1146 17.6433 26.4649 13.8748 Constraint 169 552 15.7289 19.6611 29.4917 13.8093 Constraint 190 375 17.0340 21.2925 31.9387 13.7911 Constraint 242 636 14.9354 18.6693 28.0039 13.7830 Constraint 272 489 15.6256 19.5320 29.2980 13.7787 Constraint 314 651 14.8365 18.5457 27.8185 13.7230 Constraint 303 613 14.9206 18.6508 27.9762 13.7060 Constraint 113 585 13.5616 16.9520 25.4279 13.6767 Constraint 88 599 12.1273 15.1592 22.7388 13.6547 Constraint 350 527 11.2153 14.0191 21.0287 13.6405 Constraint 303 527 12.8328 16.0410 24.0615 13.6405 Constraint 341 519 13.6197 17.0246 25.5369 13.6405 Constraint 237 599 10.3269 12.9087 19.3630 13.6003 Constraint 221 599 11.8887 14.8608 22.2913 13.5965 Constraint 88 585 12.8968 16.1210 24.1816 13.5834 Constraint 122 585 13.3605 16.7006 25.0509 13.5834 Constraint 391 535 10.0147 12.5184 18.7776 13.5832 Constraint 382 535 11.7946 14.7432 22.1148 13.5832 Constraint 272 599 13.3789 16.7236 25.0854 13.5163 Constraint 382 629 12.3306 15.4132 23.1198 13.5104 Constraint 368 629 13.0998 16.3748 24.5622 13.5104 Constraint 341 577 11.2426 14.0533 21.0799 13.5103 Constraint 341 571 13.1781 16.4727 24.7090 13.5103 Constraint 279 629 15.1944 18.9930 28.4895 13.4916 Constraint 355 613 14.8134 18.5167 27.7751 13.4868 Constraint 360 629 12.3884 15.4855 23.2282 13.4819 Constraint 467 613 11.4909 14.3636 21.5454 13.4600 Constraint 461 613 12.6853 15.8566 23.7849 13.4600 Constraint 467 604 9.3586 11.6982 17.5473 13.4599 Constraint 461 604 10.2357 12.7947 19.1920 13.4599 Constraint 473 604 8.6232 10.7790 16.1685 13.4581 Constraint 182 571 15.1962 18.9953 28.4929 13.4412 Constraint 96 535 11.1259 13.9073 20.8610 13.4372 Constraint 314 585 12.0301 15.0377 22.5565 13.4137 Constraint 412 535 11.3299 14.1624 21.2436 13.3668 Constraint 449 629 12.6115 15.7643 23.6465 13.3526 Constraint 613 687 12.0902 15.1128 22.6692 13.3429 Constraint 303 577 10.6284 13.2855 19.9282 13.3419 Constraint 557 651 14.6769 18.3462 27.5193 13.3331 Constraint 279 585 15.0996 18.8746 28.3118 13.3297 Constraint 375 622 11.0707 13.8383 20.7575 13.3137 Constraint 368 535 10.4227 13.0284 19.5426 13.2832 Constraint 360 535 8.5833 10.7291 16.0937 13.2832 Constraint 412 585 14.1580 17.6975 26.5462 13.2399 Constraint 292 535 12.3500 15.4375 23.1562 13.2141 Constraint 242 535 12.2994 15.3742 23.0613 13.2141 Constraint 237 535 14.3481 17.9351 26.9026 13.2141 Constraint 221 535 14.3985 17.9981 26.9972 13.2141 Constraint 210 535 12.6666 15.8332 23.7498 13.2141 Constraint 201 535 15.8396 19.7995 29.6993 13.2141 Constraint 182 535 14.5433 18.1791 27.2686 13.2141 Constraint 322 585 11.8246 14.7808 22.1712 13.2070 Constraint 391 599 9.5962 11.9953 17.9929 13.1658 Constraint 360 599 9.8853 12.3566 18.5349 13.1658 Constraint 267 577 13.9321 17.4152 26.1227 13.1515 Constraint 421 651 14.3281 17.9101 26.8652 13.1279 Constraint 629 706 11.9142 14.8927 22.3391 13.1270 Constraint 250 622 13.0961 16.3702 24.5553 13.1233 Constraint 604 706 13.3902 16.7378 25.1067 13.1193 Constraint 128 544 13.4276 16.7844 25.1767 13.1093 Constraint 104 544 12.8053 16.0066 24.0099 13.1093 Constraint 341 636 16.0173 20.0216 30.0324 13.1069 Constraint 552 636 13.8233 17.2791 25.9186 13.0822 Constraint 557 636 12.5667 15.7083 23.5625 13.0803 Constraint 404 585 11.6116 14.5145 21.7717 13.0786 Constraint 341 613 14.7289 18.4111 27.6166 13.0262 Constraint 242 527 11.3240 14.1550 21.2325 13.0121 Constraint 382 604 11.8662 14.8328 22.2492 13.0090 Constraint 435 622 11.0190 13.7737 20.6606 12.9983 Constraint 169 599 12.5840 15.7300 23.5950 12.9645 Constraint 259 590 14.1812 17.7265 26.5897 12.9419 Constraint 535 604 12.1569 15.1962 22.7943 12.9381 Constraint 412 590 11.9534 14.9418 22.4127 12.9246 Constraint 341 622 15.6816 19.6020 29.4031 12.9168 Constraint 303 535 13.4766 16.8458 25.2687 12.8970 Constraint 297 535 13.9230 17.4037 26.1056 12.8970 Constraint 467 599 9.9686 12.4608 18.6912 12.8870 Constraint 467 590 11.2274 14.0342 21.0513 12.8870 Constraint 461 599 10.2161 12.7702 19.1553 12.8870 Constraint 461 590 11.8877 14.8596 22.2894 12.8870 Constraint 461 585 10.8029 13.5037 20.2555 12.8870 Constraint 473 590 10.4974 13.1218 19.6827 12.8851 Constraint 314 544 15.5234 19.4043 29.1065 12.8093 Constraint 292 544 15.8778 19.8472 29.7708 12.8093 Constraint 210 544 15.3880 19.2350 28.8525 12.8093 Constraint 169 544 14.9661 18.7076 28.0615 12.8093 Constraint 480 622 10.8808 13.6010 20.4015 12.7902 Constraint 399 535 7.5685 9.4606 14.1909 12.7736 Constraint 250 629 13.4126 16.7658 25.1487 12.7083 Constraint 330 552 12.7040 15.8800 23.8200 12.6836 Constraint 322 552 13.2774 16.5968 24.8952 12.6836 Constraint 88 604 11.7289 14.6612 21.9917 12.6548 Constraint 113 599 13.5755 16.9694 25.4541 12.6547 Constraint 297 571 14.2275 17.7844 26.6767 12.6316 Constraint 297 527 12.7305 15.9131 23.8697 12.6242 Constraint 285 527 13.3323 16.6653 24.9980 12.6242 Constraint 259 527 12.6624 15.8281 23.7421 12.6242 Constraint 182 527 12.9617 16.2021 24.3032 12.6242 Constraint 176 527 15.0466 18.8082 28.2123 12.6242 Constraint 182 599 11.4746 14.3432 21.5148 12.6003 Constraint 221 604 11.4500 14.3125 21.4688 12.5830 Constraint 182 604 10.5071 13.1339 19.7009 12.5830 Constraint 412 599 9.6438 12.0547 18.0820 12.5790 Constraint 210 613 10.6641 13.3301 19.9952 12.5747 Constraint 622 698 11.9334 14.9168 22.3751 12.5471 Constraint 613 698 13.2624 16.5780 24.8671 12.5471 Constraint 355 599 11.8922 14.8652 22.2979 12.4991 Constraint 350 599 13.4405 16.8007 25.2010 12.4991 Constraint 404 535 10.0825 12.6031 18.9046 12.3688 Constraint 473 629 8.4392 10.5490 15.8235 12.3648 Constraint 473 622 10.2115 12.7644 19.1466 12.3648 Constraint 330 577 11.7607 14.7009 22.0513 12.3643 Constraint 279 577 11.5019 14.3773 21.5660 12.3419 Constraint 557 644 14.0732 17.5914 26.3872 12.3332 Constraint 442 613 12.0610 15.0763 22.6144 12.2983 Constraint 153 599 14.8017 18.5021 27.7531 12.2981 Constraint 242 585 14.2102 17.7628 26.6441 12.2192 Constraint 292 585 13.7643 17.2054 25.8081 12.2070 Constraint 210 585 13.3285 16.6606 24.9909 12.2070 Constraint 153 604 14.9114 18.6392 27.9588 12.2010 Constraint 391 590 10.7053 13.3816 20.0724 12.1780 Constraint 382 599 10.4291 13.0363 19.5545 12.1780 Constraint 375 599 9.9034 12.3793 18.5689 12.1780 Constraint 368 599 10.2977 12.8721 19.3082 12.1780 Constraint 360 590 10.8139 13.5174 20.2761 12.1780 Constraint 355 590 12.7703 15.9629 23.9443 12.1780 Constraint 279 473 15.3851 19.2313 28.8470 12.1570 Constraint 421 644 14.7599 18.4498 27.6748 12.1401 Constraint 322 535 11.6208 14.5260 21.7891 12.1373 Constraint 272 577 12.8029 16.0036 24.0054 12.1352 Constraint 221 577 13.5495 16.9369 25.4053 12.1352 Constraint 190 577 14.5171 18.1464 27.2196 12.1352 Constraint 182 577 11.8656 14.8320 22.2480 12.1352 Constraint 176 577 14.3836 17.9795 26.9692 12.1352 Constraint 360 552 13.7461 17.1826 25.7740 12.1267 Constraint 88 535 10.1420 12.6775 19.0163 12.1209 Constraint 303 657 16.0598 20.0748 30.1122 12.1056 Constraint 435 590 13.1630 16.4538 24.6807 12.0940 Constraint 435 585 12.5941 15.7426 23.6140 12.0940 Constraint 350 613 16.4660 20.5825 30.8738 12.0820 Constraint 435 629 10.3485 12.9356 19.4034 12.0105 Constraint 421 636 12.7747 15.9684 23.9526 11.9820 Constraint 350 535 10.5558 13.1948 19.7922 11.9497 Constraint 341 535 11.8770 14.8463 22.2694 11.9497 Constraint 535 613 12.7344 15.9180 23.8771 11.9382 Constraint 250 604 13.6254 17.0317 25.5476 11.9285 Constraint 267 604 14.1829 17.7286 26.5929 11.9163 Constraint 467 585 9.3127 11.6409 17.4613 11.8870 Constraint 435 552 14.0785 17.5982 26.3973 11.8870 Constraint 429 552 12.5124 15.6405 23.4608 11.8870 Constraint 421 552 12.8120 16.0151 24.0226 11.8870 Constraint 122 629 14.4259 18.0324 27.0486 11.8451 Constraint 88 629 12.9870 16.2337 24.3506 11.8451 Constraint 535 622 12.5399 15.6749 23.5124 11.7922 Constraint 599 687 10.8009 13.5011 20.2516 11.7699 Constraint 590 687 13.7404 17.1755 25.7632 11.7699 Constraint 571 657 13.3738 16.7172 25.0758 11.7602 Constraint 226 489 15.4885 19.3606 29.0409 11.6855 Constraint 341 657 14.9495 18.6869 28.0304 11.6786 Constraint 429 577 11.8011 14.7514 22.1271 11.6741 Constraint 88 590 13.4800 16.8500 25.2749 11.6548 Constraint 169 604 11.2700 14.0876 21.1313 11.6234 Constraint 480 629 8.9723 11.2154 16.8231 11.5757 Constraint 201 613 11.9032 14.8790 22.3184 11.5747 Constraint 421 657 14.3475 17.9344 26.9016 11.5671 Constraint 330 571 13.0732 16.3414 24.5122 11.5547 Constraint 303 571 12.8709 16.0886 24.1329 11.5547 Constraint 599 706 13.7904 17.2380 25.8569 11.5540 Constraint 341 557 13.2351 16.5439 24.8159 11.5276 Constraint 391 636 14.8123 18.5154 27.7730 11.5050 Constraint 297 622 14.3810 17.9762 26.9643 11.5032 Constraint 144 604 12.8759 16.0949 24.1424 11.4953 Constraint 144 599 13.2146 16.5183 24.7775 11.4953 Constraint 303 552 12.3416 15.4270 23.1405 11.4768 Constraint 292 552 14.6432 18.3039 27.4559 11.4768 Constraint 104 571 14.8589 18.5736 27.8605 11.4720 Constraint 297 557 15.2886 19.1108 28.6662 11.4586 Constraint 404 590 9.2115 11.5144 17.2717 11.4298 Constraint 519 604 14.1009 17.6261 26.4392 11.4179 Constraint 404 636 12.1612 15.2014 22.8022 11.4135 Constraint 467 629 9.5932 11.9915 17.9872 11.3667 Constraint 467 622 11.1944 13.9930 20.9896 11.3667 Constraint 461 629 10.8956 13.6195 20.4292 11.3667 Constraint 461 622 12.4185 15.5232 23.2848 11.3667 Constraint 585 687 14.9472 18.6840 28.0260 11.3651 Constraint 104 585 12.7104 15.8880 23.8319 11.3432 Constraint 449 622 12.2443 15.3054 22.9580 11.3424 Constraint 80 535 13.0471 16.3088 24.4632 11.3113 Constraint 136 375 17.1470 21.4338 32.1507 11.2979 Constraint 267 511 16.3261 20.4076 30.6115 11.2060 Constraint 552 651 15.5142 19.3927 29.0891 11.1891 Constraint 552 644 15.5515 19.4393 29.1590 11.1891 Constraint 399 636 12.5968 15.7460 23.6190 11.1871 Constraint 622 706 12.9742 16.2177 24.3266 11.1424 Constraint 613 706 14.2652 17.8316 26.7473 11.1424 Constraint 314 644 15.0589 18.8236 28.2354 11.1375 Constraint 237 527 12.8257 16.0321 24.0482 11.1209 Constraint 237 519 15.1822 18.9777 28.4666 11.1209 Constraint 303 519 13.7524 17.1905 25.7858 11.1209 Constraint 285 519 14.5772 18.2215 27.3323 11.1209 Constraint 330 535 12.4622 15.5778 23.3667 11.1038 Constraint 144 585 12.7485 15.9356 23.9033 11.0905 Constraint 449 577 12.0752 15.0939 22.6409 11.0406 Constraint 382 590 10.7665 13.4581 20.1871 11.0321 Constraint 375 590 9.7444 12.1805 18.2708 11.0321 Constraint 368 590 10.7074 13.3842 20.0763 11.0321 Constraint 322 544 14.2978 17.8722 26.8083 11.0161 Constraint 96 544 13.4018 16.7523 25.1284 11.0161 Constraint 412 636 14.2415 17.8019 26.7029 11.0019 Constraint 375 552 14.0229 17.5286 26.2929 10.9808 Constraint 599 698 11.7775 14.7219 22.0828 10.9742 Constraint 590 698 14.9253 18.6566 27.9849 10.9742 Constraint 399 585 10.8147 13.5184 20.2776 10.9457 Constraint 297 590 14.0622 17.5778 26.3667 10.9394 Constraint 221 622 11.9720 14.9650 22.4475 10.9080 Constraint 201 622 9.8642 12.3302 18.4954 10.9080 Constraint 182 622 12.0167 15.0209 22.5314 10.9080 Constraint 182 613 12.4237 15.5297 23.2945 10.9080 Constraint 176 622 11.7230 14.6537 21.9806 10.9080 Constraint 176 613 12.6980 15.8726 23.8088 10.9080 Constraint 330 622 15.1631 18.9538 28.4308 10.9025 Constraint 330 613 13.6887 17.1109 25.6664 10.9025 Constraint 604 713 14.1320 17.6650 26.4974 10.8873 Constraint 69 497 6.1934 7.7418 11.6126 10.8517 Constraint 69 449 9.7738 12.2173 18.3259 10.8517 Constraint 69 442 12.0721 15.0901 22.6352 10.8517 Constraint 69 435 12.5818 15.7272 23.5908 10.8517 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 279 13.6813 17.1016 25.6524 10.8517 Constraint 69 272 14.2551 17.8189 26.7283 10.8517 Constraint 69 267 14.0334 17.5418 26.3127 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 237 14.6819 18.3523 27.5285 10.8517 Constraint 69 226 16.0908 20.1136 30.1703 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 201 15.2752 19.0940 28.6410 10.8517 Constraint 69 190 15.7492 19.6865 29.5297 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 69 176 15.4693 19.3367 29.0050 10.8517 Constraint 69 169 13.2793 16.5991 24.8987 10.8517 Constraint 69 144 12.7629 15.9536 23.9305 10.8517 Constraint 69 136 12.2217 15.2771 22.9157 10.8517 Constraint 519 599 13.1226 16.4033 24.6049 10.8449 Constraint 519 590 14.1568 17.6960 26.5440 10.8449 Constraint 182 585 13.8154 17.2692 25.9038 10.7899 Constraint 190 489 16.1056 20.1320 30.1979 10.7787 Constraint 360 585 11.1294 13.9118 20.8677 10.7764 Constraint 497 599 11.8179 14.7724 22.1586 10.7647 Constraint 571 668 15.7450 19.6812 29.5218 10.7602 Constraint 297 629 12.6585 15.8231 23.7347 10.7221 Constraint 350 577 13.2797 16.5997 24.8995 10.7045 Constraint 330 544 13.3399 16.6748 25.0122 10.6990 Constraint 577 687 13.8556 17.3195 25.9792 10.6983 Constraint 421 577 11.6676 14.5845 21.8767 10.6742 Constraint 88 622 14.2080 17.7600 26.6399 10.6548 Constraint 88 613 13.6514 17.0643 25.5964 10.6548 Constraint 128 599 13.0435 16.3044 24.4566 10.6548 Constraint 113 590 14.7104 18.3880 27.5820 10.6548 Constraint 104 599 12.5979 15.7474 23.6211 10.6548 Constraint 375 585 11.1902 13.9877 20.9816 10.6426 Constraint 399 552 13.7135 17.1419 25.7128 10.6325 Constraint 651 729 12.3755 15.4694 23.2041 10.6254 Constraint 644 729 13.4846 16.8558 25.2837 10.6254 Constraint 644 720 12.1090 15.1362 22.7044 10.6254 Constraint 237 622 7.9559 9.9449 14.9173 10.5869 Constraint 237 613 10.1720 12.7150 19.0724 10.5869 Constraint 226 604 11.9320 14.9150 22.3724 10.5869 Constraint 201 604 9.4531 11.8164 17.7246 10.5869 Constraint 190 604 11.5937 14.4921 21.7382 10.5869 Constraint 176 604 9.9726 12.4657 18.6986 10.5869 Constraint 442 657 15.1056 18.8820 28.3229 10.5806 Constraint 585 698 15.2753 19.0942 28.6413 10.5694 Constraint 242 651 15.6669 19.5836 29.3754 10.5679 Constraint 442 552 13.7594 17.1993 25.7989 10.5535 Constraint 279 571 13.8849 17.3562 26.0343 10.5384 Constraint 122 552 12.2182 15.2727 22.9091 10.5362 Constraint 375 629 9.9544 12.4430 18.6645 10.5335 Constraint 341 552 12.0725 15.0906 22.6360 10.5295 Constraint 279 590 15.6102 19.5127 29.2690 10.5147 Constraint 190 613 14.0925 17.6157 26.4235 10.5032 Constraint 341 629 14.9107 18.6384 27.9576 10.4877 Constraint 297 552 12.1297 15.1621 22.7431 10.4768 Constraint 272 552 14.8382 18.5477 27.8216 10.4768 Constraint 104 557 14.0280 17.5350 26.3025 10.4740 Constraint 489 599 11.2926 14.1158 21.1737 10.4647 Constraint 182 557 15.8129 19.7661 29.6492 10.4586 Constraint 511 585 14.2535 17.8168 26.7252 10.4401 Constraint 557 657 13.4895 16.8619 25.2928 10.4267 Constraint 144 577 11.4683 14.3354 21.5031 10.4238 Constraint 429 644 13.7460 17.1824 25.7737 10.4212 Constraint 350 544 15.4952 19.3690 29.0536 10.3990 Constraint 303 557 14.2620 17.8275 26.7413 10.3817 Constraint 350 590 14.3998 17.9998 26.9997 10.3653 Constraint 473 636 9.9436 12.4295 18.6442 10.3504 Constraint 467 636 11.0078 13.7597 20.6396 10.3504 Constraint 473 657 11.6282 14.5352 21.8028 10.3485 Constraint 449 613 12.2942 15.3677 23.0516 10.3424 Constraint 442 577 12.8597 16.0747 24.1120 10.3407 Constraint 136 577 12.4964 15.6205 23.4308 10.3196 Constraint 128 577 11.9946 14.9933 22.4899 10.3196 Constraint 80 544 13.1099 16.3874 24.5811 10.3113 Constraint 467 552 11.5326 14.4157 21.6236 10.2554 Constraint 461 552 11.0427 13.8034 20.7051 10.2554 Constraint 449 552 12.0051 15.0064 22.5096 10.2535 Constraint 449 544 12.7584 15.9480 23.9220 10.2535 Constraint 153 577 13.5861 16.9827 25.4740 10.2323 Constraint 153 571 14.2845 17.8557 26.7835 10.2323 Constraint 122 577 11.3487 14.1858 21.2788 10.2263 Constraint 226 535 15.6658 19.5822 29.3733 10.2142 Constraint 190 535 16.8576 21.0720 31.6080 10.2142 Constraint 657 735 11.5405 14.4257 21.6385 10.2003 Constraint 651 735 12.9045 16.1307 24.1960 10.2003 Constraint 497 622 13.0018 16.2522 24.3783 10.1917 Constraint 242 657 15.1519 18.9398 28.4097 10.1573 Constraint 360 544 15.2010 19.0012 28.5019 10.1421 Constraint 182 629 10.3290 12.9112 19.3668 10.1105 Constraint 544 636 15.4689 19.3362 29.0043 10.0976 Constraint 391 585 11.6316 14.5395 21.8092 10.0886 Constraint 480 571 11.2686 14.0857 21.1286 10.0612 Constraint 399 590 8.6471 10.8089 16.2133 10.0475 Constraint 467 577 10.5406 13.1758 19.7637 10.0426 Constraint 461 577 10.4489 13.0611 19.5916 10.0426 Constraint 473 577 10.5561 13.1952 19.7928 10.0407 Constraint 169 577 13.7404 17.1755 25.7632 10.0196 Constraint 435 636 14.1749 17.7186 26.5779 10.0095 Constraint 161 544 14.3639 17.9548 26.9322 9.9997 Constraint 442 636 14.7681 18.4602 27.6902 9.9973 Constraint 429 668 15.5319 19.4149 29.1223 9.9942 Constraint 480 636 9.4307 11.7884 17.6826 9.9661 Constraint 480 644 12.4266 15.5332 23.2998 9.9642 Constraint 136 368 16.6364 20.7955 31.1932 9.9332 Constraint 113 577 12.2292 15.2865 22.9297 9.9263 Constraint 88 577 12.0731 15.0914 22.6371 9.9263 Constraint 272 604 11.5970 14.4963 21.7444 9.9202 Constraint 330 629 13.6364 17.0454 25.5682 9.9147 Constraint 442 590 13.4214 16.7767 25.1651 9.9065 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 571 687 15.0470 18.8087 28.2131 9.9026 Constraint 285 613 14.1108 17.6385 26.4577 9.9025 Constraint 153 585 14.5001 18.1251 27.1877 9.8991 Constraint 242 577 11.6527 14.5658 21.8487 9.8956 Constraint 237 577 12.9713 16.2142 24.3212 9.8956 Constraint 210 577 11.4236 14.2795 21.4192 9.8956 Constraint 489 622 12.3559 15.4449 23.1673 9.8917 Constraint 489 613 12.2312 15.2890 22.9335 9.8917 Constraint 489 604 10.8314 13.5393 20.3089 9.8917 Constraint 435 544 14.2162 17.7702 26.6554 9.8870 Constraint 429 544 12.3476 15.4345 23.1517 9.8870 Constraint 421 544 12.1256 15.1570 22.7355 9.8870 Constraint 552 657 14.2653 17.8316 26.7475 9.8557 Constraint 88 636 14.3463 17.9329 26.8993 9.8452 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 467 10.9775 13.7219 20.5829 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 161 16.2209 20.2761 30.4141 9.8353 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 201 544 16.1569 20.1961 30.2942 9.8093 Constraint 190 544 15.6047 19.5058 29.2587 9.8093 Constraint 182 544 12.8434 16.0542 24.0813 9.8093 Constraint 176 544 14.4352 18.0440 27.0660 9.8093 Constraint 644 735 13.4277 16.7847 25.1770 9.7954 Constraint 210 636 11.4229 14.2786 21.4179 9.7927 Constraint 355 585 12.5478 15.6847 23.5271 9.7886 Constraint 285 535 12.8552 16.0691 24.1036 9.7875 Constraint 259 535 12.3103 15.3879 23.0819 9.7875 Constraint 259 519 14.2992 17.8740 26.8110 9.7874 Constraint 226 629 10.8573 13.5716 20.3574 9.7773 Constraint 201 629 8.0953 10.1191 15.1787 9.7773 Constraint 176 629 9.6169 12.0211 18.0317 9.7773 Constraint 497 590 12.7077 15.8847 23.8270 9.7647 Constraint 297 613 13.4515 16.8144 25.2216 9.6935 Constraint 330 557 13.3503 16.6879 25.0319 9.6653 Constraint 341 651 14.9791 18.7238 28.0857 9.6644 Constraint 96 599 11.8386 14.7982 22.1973 9.6586 Constraint 96 604 12.9243 16.1554 24.2331 9.6586 Constraint 104 604 12.1437 15.1796 22.7694 9.6548 Constraint 144 535 10.5031 13.1289 19.6934 9.6410 Constraint 429 657 13.1658 16.4572 24.6859 9.5825 Constraint 435 577 11.9291 14.9113 22.3670 9.5809 Constraint 404 577 11.7074 14.6343 21.9514 9.5655 Constraint 480 651 12.8248 16.0310 24.0465 9.5594 Constraint 272 571 15.0563 18.8203 28.2305 9.5384 Constraint 144 552 11.3269 14.1587 21.2380 9.5362 Constraint 122 544 12.5527 15.6908 23.5362 9.5362 Constraint 279 657 15.1970 18.9963 28.4944 9.5346 Constraint 497 604 10.8918 13.6147 20.4221 9.5281 Constraint 360 636 13.7177 17.1471 25.7207 9.5203 Constraint 144 590 13.4786 16.8483 25.2724 9.4954 Constraint 182 552 13.1051 16.3814 24.5720 9.4605 Constraint 176 552 15.7684 19.7105 29.5658 9.4605 Constraint 557 668 16.0111 20.0139 30.0208 9.4421 Constraint 429 651 13.0287 16.2859 24.4288 9.4289 Constraint 350 552 13.5152 16.8940 25.3410 9.3836 Constraint 497 613 12.0207 15.0258 22.5388 9.3821 Constraint 322 557 14.7913 18.4891 27.7336 9.3653 Constraint 497 577 11.5811 14.4763 21.7145 9.3631 Constraint 497 585 11.7663 14.7079 22.0618 9.3599 Constraint 467 657 13.0858 16.3573 24.5360 9.3504 Constraint 461 657 14.6215 18.2769 27.4153 9.3504 Constraint 461 636 12.6923 15.8654 23.7981 9.3504 Constraint 489 590 12.4537 15.5671 23.3507 9.3187 Constraint 467 544 11.1910 13.9888 20.9832 9.2554 Constraint 461 544 11.7190 14.6487 21.9730 9.2554 Constraint 153 552 13.1733 16.4666 24.7000 9.2362 Constraint 153 544 13.1784 16.4730 24.7095 9.2362 Constraint 144 544 11.7394 14.6743 22.0114 9.2362 Constraint 122 571 14.3579 17.9473 26.9210 9.2324 Constraint 113 571 14.5739 18.2174 27.3261 9.2324 Constraint 144 571 12.6123 15.7653 23.6480 9.2323 Constraint 80 577 16.1952 20.2440 30.3659 9.1693 Constraint 412 651 13.7568 17.1960 25.7940 9.1632 Constraint 322 636 11.6029 14.5036 21.7554 9.1259 Constraint 292 636 13.0221 16.2776 24.4164 9.1259 Constraint 221 613 12.2538 15.3173 22.9759 9.1208 Constraint 190 622 11.7804 14.7255 22.0883 9.1208 Constraint 221 629 10.3561 12.9451 19.4177 9.1105 Constraint 360 668 15.4471 19.3089 28.9634 9.0978 Constraint 161 599 12.8183 16.0229 24.0344 9.0828 Constraint 161 480 15.0652 18.8315 28.2473 9.0823 Constraint 341 644 15.3099 19.1374 28.7061 9.0692 Constraint 489 577 10.8886 13.6108 20.4161 9.0631 Constraint 489 571 11.7170 14.6463 21.9694 9.0631 Constraint 489 585 12.0194 15.0242 22.5363 9.0618 Constraint 442 651 14.9755 18.7194 28.0791 9.0095 Constraint 511 599 13.3351 16.6689 25.0034 9.0081 Constraint 375 544 15.2233 19.0291 28.5437 8.9962 Constraint 136 585 12.1501 15.1877 22.7815 8.9864 Constraint 161 350 15.5882 19.4853 29.2279 8.9776 Constraint 480 657 11.0162 13.7703 20.6554 8.9661 Constraint 279 613 15.8700 19.8375 29.7563 8.9227 Constraint 629 729 13.3940 16.7425 25.1138 8.9027 Constraint 629 720 11.7344 14.6680 22.0020 8.9027 Constraint 629 713 10.9956 13.7445 20.6167 8.9027 Constraint 622 720 14.3975 17.9969 26.9954 8.9027 Constraint 622 713 13.0104 16.2631 24.3946 8.9027 Constraint 613 720 16.3442 20.4303 30.6454 8.9027 Constraint 613 713 15.1208 18.9010 28.3515 8.9027 Constraint 604 720 14.3674 17.9592 26.9389 8.9027 Constraint 599 713 13.6396 17.0495 25.5743 8.9027 Constraint 577 698 13.4519 16.8148 25.2222 8.9027 Constraint 571 698 15.4808 19.3510 29.0265 8.9027 Constraint 535 629 12.8773 16.0967 24.1450 8.8893 Constraint 421 571 13.4611 16.8264 25.2395 8.8870 Constraint 279 489 15.5655 19.4569 29.1854 8.8807 Constraint 272 535 15.2838 19.1047 28.6570 8.8807 Constraint 267 489 16.1078 20.1347 30.2020 8.8807 Constraint 136 382 16.2830 20.3537 30.5305 8.8610 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 237 636 12.2251 15.2814 22.9221 8.8049 Constraint 201 636 11.4162 14.2703 21.4054 8.7927 Constraint 467 651 13.6235 17.0294 25.5441 8.7775 Constraint 467 644 13.2790 16.5988 24.8982 8.7775 Constraint 461 651 14.7608 18.4510 27.6765 8.7775 Constraint 322 571 13.1299 16.4124 24.6186 8.7748 Constraint 182 480 13.6846 17.1058 25.6586 8.7747 Constraint 104 590 13.3379 16.6724 25.0086 8.7577 Constraint 169 590 13.3281 16.6602 24.9902 8.7340 Constraint 314 657 14.2188 17.7735 26.6602 8.7246 Constraint 279 622 15.7804 19.7255 29.5883 8.7160 Constraint 272 622 13.1157 16.3946 24.5919 8.7160 Constraint 272 613 14.0478 17.5597 26.3396 8.7160 Constraint 267 622 14.5125 18.1406 27.2110 8.7160 Constraint 267 613 15.4508 19.3135 28.9703 8.7160 Constraint 272 629 11.6978 14.6222 21.9333 8.7057 Constraint 190 629 10.1938 12.7422 19.1134 8.7057 Constraint 272 467 14.9243 18.6554 27.9830 8.6903 Constraint 190 467 15.2728 19.0909 28.6364 8.6903 Constraint 391 651 13.0923 16.3654 24.5481 8.6817 Constraint 360 651 12.5156 15.6445 23.4667 8.6817 Constraint 360 644 13.4252 16.7815 25.1722 8.6817 Constraint 355 644 14.1807 17.7259 26.5889 8.6817 Constraint 96 622 14.4539 18.0674 27.1011 8.6587 Constraint 96 590 13.7216 17.1519 25.7279 8.6587 Constraint 382 585 11.7329 14.6662 21.9993 8.6426 Constraint 368 585 11.3496 14.1870 21.2805 8.6426 Constraint 136 535 12.3045 15.3807 23.0710 8.6411 Constraint 169 622 10.4486 13.0608 19.5912 8.6209 Constraint 169 613 11.0064 13.7580 20.6370 8.6209 Constraint 226 599 10.2322 12.7902 19.1854 8.6100 Constraint 221 590 12.7889 15.9862 23.9793 8.6100 Constraint 201 599 8.8273 11.0341 16.5512 8.6100 Constraint 201 590 12.4086 15.5108 23.2661 8.6100 Constraint 190 599 10.7000 13.3750 20.0625 8.6100 Constraint 176 599 9.9135 12.3918 18.5877 8.6100 Constraint 391 544 14.8740 18.5925 27.8887 8.6034 Constraint 412 644 15.5837 19.4797 29.2195 8.5902 Constraint 527 604 11.6895 14.6118 21.9177 8.5811 Constraint 412 577 12.1085 15.1356 22.7034 8.5809 Constraint 279 557 15.5732 19.4665 29.1997 8.5721 Constraint 355 629 12.6680 15.8350 23.7525 8.5675 Constraint 96 585 13.5490 16.9363 25.4044 8.5539 Constraint 442 544 13.7781 17.2227 25.8340 8.5536 Constraint 292 651 14.2627 17.8283 26.7425 8.5461 Constraint 210 651 13.7316 17.1645 25.7468 8.5461 Constraint 341 544 13.6595 17.0744 25.6116 8.5449 Constraint 161 552 14.7972 18.4965 27.7448 8.5363 Constraint 128 571 14.2911 17.8639 26.7958 8.5324 Constraint 144 613 14.2178 17.7723 26.6584 8.4954 Constraint 303 544 13.8544 17.3181 25.9771 8.4759 Constraint 297 544 12.4001 15.5001 23.2501 8.4759 Constraint 272 544 14.4209 18.0261 27.0392 8.4759 Constraint 285 552 13.6703 17.0879 25.6318 8.3836 Constraint 279 552 12.3216 15.4021 23.1031 8.3836 Constraint 267 552 15.1083 18.8854 28.3281 8.3836 Constraint 473 651 11.0550 13.8187 20.7281 8.3486 Constraint 473 644 10.7641 13.4551 20.1827 8.3486 Constraint 169 585 13.6203 17.0254 25.5381 8.3407 Constraint 449 636 13.5106 16.8883 25.3325 8.3383 Constraint 636 720 13.2358 16.5448 24.8172 8.3094 Constraint 467 571 12.9123 16.1404 24.2106 8.2554 Constraint 461 571 12.9598 16.1998 24.2997 8.2554 Constraint 449 571 13.5533 16.9416 25.4124 8.2535 Constraint 449 557 13.5343 16.9179 25.3768 8.2535 Constraint 80 599 13.8494 17.3117 25.9676 8.2533 Constraint 622 729 15.7040 19.6300 29.4450 8.2359 Constraint 604 729 14.6646 18.3307 27.4961 8.2359 Constraint 599 729 14.8721 18.5901 27.8851 8.2359 Constraint 599 720 13.8590 17.3237 25.9855 8.2359 Constraint 113 557 14.0369 17.5462 26.3193 8.2343 Constraint 136 571 14.2464 17.8081 26.7121 8.2324 Constraint 221 585 14.0675 17.5844 26.3766 8.2167 Constraint 322 657 12.4606 15.5757 23.3636 8.1516 Constraint 292 657 13.7971 17.2464 25.8695 8.1516 Constraint 210 657 13.0841 16.3551 24.5326 8.1516 Constraint 322 651 12.0387 15.0484 22.5726 8.1413 Constraint 322 644 11.8053 14.7566 22.1349 8.1413 Constraint 259 613 12.0423 15.0529 22.5794 8.1330 Constraint 250 613 12.3852 15.4815 23.2223 8.1330 Constraint 226 622 9.3212 11.6516 17.4773 8.1330 Constraint 226 613 12.0437 15.0547 22.5820 8.1330 Constraint 221 636 13.7133 17.1416 25.7124 8.1259 Constraint 190 636 13.3648 16.7060 25.0590 8.1259 Constraint 182 636 11.6570 14.5713 21.8569 8.1259 Constraint 176 636 10.9667 13.7084 20.5625 8.1259 Constraint 297 519 13.6816 17.1020 25.6530 8.1209 Constraint 250 535 13.4075 16.7593 25.1390 8.1209 Constraint 250 519 15.3925 19.2406 28.8609 8.1209 Constraint 226 527 13.4934 16.8667 25.3001 8.1209 Constraint 226 519 15.9251 19.9064 29.8596 8.1209 Constraint 221 519 13.7402 17.1753 25.7630 8.1209 Constraint 201 519 15.6449 19.5562 29.3342 8.1209 Constraint 182 519 14.3932 17.9915 26.9873 8.1209 Constraint 360 657 13.1282 16.4103 24.6154 8.1132 Constraint 355 657 14.9327 18.6659 27.9989 8.1132 Constraint 350 651 15.1194 18.8992 28.3488 8.1087 Constraint 473 571 11.9796 14.9745 22.4617 8.0631 Constraint 473 557 12.2833 15.3541 23.0311 8.0631 Constraint 480 557 11.8178 14.7723 22.1585 8.0468 Constraint 161 577 12.3535 15.4418 23.1627 8.0234 Constraint 435 651 13.8061 17.2577 25.8865 8.0172 Constraint 69 250 14.5595 18.1993 27.2990 8.0149 Constraint 527 599 9.8904 12.3630 18.5445 8.0082 Constraint 511 590 14.1073 17.6341 26.4512 8.0082 Constraint 136 604 11.4263 14.2829 21.4243 7.9979 Constraint 136 599 12.5476 15.6845 23.5267 7.9979 Constraint 122 590 13.3138 16.6422 24.9634 7.9979 Constraint 355 622 11.8728 14.8409 22.2614 7.9945 Constraint 350 622 14.7026 18.3782 27.5673 7.9945 Constraint 285 571 13.3677 16.7097 25.0645 7.9652 Constraint 382 636 13.2393 16.5491 24.8237 7.9596 Constraint 176 644 11.5155 14.3944 21.5917 7.9509 Constraint 399 668 14.8037 18.5047 27.7570 7.9451 Constraint 272 590 14.2031 17.7539 26.6308 7.9432 Constraint 190 590 13.8850 17.3562 26.0343 7.9432 Constraint 182 590 12.2717 15.3396 23.0094 7.9432 Constraint 176 590 13.0327 16.2909 24.4364 7.9432 Constraint 412 657 13.6848 17.1059 25.6589 7.9235 Constraint 267 629 13.4078 16.7597 25.1395 7.9186 Constraint 636 713 12.3648 15.4559 23.1839 7.9046 Constraint 201 577 12.6611 15.8264 23.7396 7.8956 Constraint 429 571 13.7438 17.1797 25.7695 7.8889 Constraint 429 557 13.4221 16.7776 25.1664 7.8889 Constraint 96 629 13.1402 16.4253 24.6379 7.8491 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 169 636 10.8416 13.5520 20.3279 7.8235 Constraint 169 629 9.3478 11.6848 17.5272 7.8235 Constraint 629 735 14.4396 18.0495 27.0742 7.8108 Constraint 412 544 14.4981 18.1226 27.1839 7.7938 Constraint 511 604 12.3893 15.4866 23.2299 7.7715 Constraint 136 590 13.3095 16.6369 24.9553 7.7577 Constraint 128 590 12.9024 16.1280 24.1920 7.7577 Constraint 297 636 13.3979 16.7474 25.1211 7.7211 Constraint 221 544 15.7502 19.6878 29.5317 7.7161 Constraint 355 651 12.2728 15.3410 23.0115 7.6971 Constraint 391 644 13.8563 17.3204 25.9806 7.6939 Constraint 161 590 13.7306 17.1633 25.7449 7.6780 Constraint 161 585 12.6938 15.8673 23.8009 7.6780 Constraint 279 535 15.6262 19.5327 29.2991 7.6663 Constraint 355 544 15.6568 19.5710 29.3565 7.6627 Constraint 128 585 11.1570 13.9463 20.9194 7.6529 Constraint 404 552 13.9594 17.4492 26.1739 7.6479 Constraint 636 729 13.7464 17.1830 25.7745 7.6427 Constraint 176 535 15.5252 19.4065 29.1098 7.6411 Constraint 237 590 9.8615 12.3269 18.4903 7.6222 Constraint 391 552 12.0704 15.0880 22.6320 7.5880 Constraint 527 613 12.4320 15.5400 23.3100 7.5812 Constraint 391 571 10.8657 13.5821 20.3731 7.5746 Constraint 544 657 15.2832 19.1040 28.6560 7.5711 Constraint 350 629 14.4148 18.0185 27.0278 7.5675 Constraint 259 577 11.0939 13.8674 20.8011 7.5622 Constraint 250 577 13.6618 17.0772 25.6158 7.5622 Constraint 442 557 13.8387 17.2984 25.9476 7.5535 Constraint 272 585 14.9532 18.6915 28.0372 7.5500 Constraint 259 585 14.2119 17.7648 26.6472 7.5500 Constraint 182 651 12.4286 15.5357 23.3036 7.5461 Constraint 176 651 12.4862 15.6077 23.4116 7.5461 Constraint 382 544 16.3563 20.4453 30.6680 7.4575 Constraint 435 644 15.1593 18.9492 28.4237 7.4443 Constraint 404 644 12.9080 16.1350 24.2025 7.4443 Constraint 527 622 10.9543 13.6929 20.5394 7.4352 Constraint 511 622 14.2981 17.8726 26.8089 7.4352 Constraint 161 535 12.8143 16.0179 24.0269 7.4267 Constraint 480 668 12.3536 15.4420 23.1630 7.3932 Constraint 221 552 15.0256 18.7819 28.1729 7.3673 Constraint 190 552 15.6505 19.5632 29.3447 7.3673 Constraint 449 657 14.5236 18.1545 27.2317 7.3505 Constraint 449 651 14.2839 17.8548 26.7822 7.3505 Constraint 473 668 12.5844 15.7305 23.5957 7.3486 Constraint 259 636 14.7311 18.4139 27.6208 7.3388 Constraint 497 629 10.1731 12.7164 19.0746 7.2889 Constraint 467 557 12.8085 16.0106 24.0159 7.2554 Constraint 461 557 12.5643 15.7054 23.5581 7.2554 Constraint 80 590 14.5128 18.1410 27.2115 7.2533 Constraint 80 585 13.2519 16.5649 24.8474 7.2533 Constraint 96 577 13.1804 16.4755 24.7133 7.2465 Constraint 577 720 16.1204 20.1505 30.2258 7.2378 Constraint 153 557 12.7454 15.9317 23.8976 7.2343 Constraint 144 557 11.1781 13.9727 20.9590 7.2343 Constraint 122 557 13.2321 16.5401 24.8101 7.2343 Constraint 237 585 12.9075 16.1344 24.2016 7.2289 Constraint 210 557 14.7610 18.4512 27.6768 7.2190 Constraint 571 676 16.3397 20.4246 30.6369 7.2028 Constraint 604 735 15.8547 19.8184 29.7276 7.1441 Constraint 88 571 13.1277 16.4097 24.6145 7.1392 Constraint 519 622 11.9643 14.9554 22.4330 7.1352 Constraint 399 657 11.8348 14.7935 22.1903 7.1286 Constraint 391 657 12.8339 16.0424 24.0636 7.1209 Constraint 382 657 11.9155 14.8944 22.3416 7.1209 Constraint 382 644 13.0148 16.2685 24.4027 7.1209 Constraint 375 657 10.1171 12.6464 18.9696 7.1209 Constraint 375 644 10.5577 13.1971 19.7957 7.1209 Constraint 368 657 12.4757 15.5947 23.3920 7.1209 Constraint 368 644 12.2930 15.3663 23.0494 7.1209 Constraint 242 571 11.0999 13.8749 20.8124 7.1084 Constraint 210 571 12.8411 16.0514 24.0771 7.1084 Constraint 161 604 11.1603 13.9504 20.9256 6.9896 Constraint 489 629 9.5886 11.9857 17.9786 6.9889 Constraint 80 557 15.7877 19.7347 29.6020 6.9778 Constraint 210 644 11.6889 14.6112 21.9168 6.9631 Constraint 330 636 13.0008 16.2510 24.3764 6.9340 Constraint 303 636 15.0363 18.7954 28.1931 6.9340 Constraint 285 636 15.2438 19.0548 28.5822 6.9340 Constraint 421 668 14.4489 18.0611 27.0917 6.9101 Constraint 421 557 12.1352 15.1690 22.7535 6.8890 Constraint 279 511 17.0131 21.2663 31.8995 6.8726 Constraint 58 429 12.6492 15.8114 23.7172 6.8531 Constraint 58 421 11.7793 14.7242 22.0863 6.8531 Constraint 58 412 15.1547 18.9434 28.4151 6.8531 Constraint 58 404 14.2257 17.7821 26.6732 6.8531 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 382 15.3881 19.2352 28.8527 6.8531 Constraint 58 375 12.8779 16.0974 24.1461 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 297 12.4181 15.5226 23.2839 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 58 285 13.3458 16.6823 25.0234 6.8531 Constraint 58 279 15.5587 19.4483 29.1725 6.8531 Constraint 58 272 16.4236 20.5295 30.7942 6.8531 Constraint 58 259 14.3583 17.9478 26.9217 6.8531 Constraint 58 221 15.0813 18.8516 28.2775 6.8531 Constraint 58 210 13.4081 16.7601 25.1401 6.8531 Constraint 58 182 14.0495 17.5618 26.3427 6.8531 Constraint 58 169 14.9643 18.7054 28.0581 6.8531 Constraint 58 144 13.1979 16.4974 24.7461 6.8531 Constraint 58 136 12.4233 15.5292 23.2938 6.8531 Constraint 58 128 11.5778 14.4722 21.7083 6.8531 Constraint 80 613 15.0377 18.7971 28.1956 6.8485 Constraint 636 735 14.6342 18.2928 27.4392 6.8127 Constraint 435 571 13.1372 16.4215 24.6323 6.7938 Constraint 435 557 13.2854 16.6067 24.9101 6.7938 Constraint 279 527 12.9570 16.1963 24.2944 6.7875 Constraint 279 519 15.9330 19.9163 29.8744 6.7875 Constraint 272 527 12.5725 15.7157 23.5735 6.7875 Constraint 272 519 15.9400 19.9250 29.8875 6.7875 Constraint 267 535 14.6961 18.3701 27.5552 6.7875 Constraint 267 527 12.8076 16.0095 24.0142 6.7875 Constraint 267 519 16.0399 20.0499 30.0749 6.7875 Constraint 250 527 12.0037 15.0046 22.5069 6.7875 Constraint 190 527 13.9598 17.4498 26.1747 6.7875 Constraint 250 651 17.0404 21.3005 31.9508 6.7846 Constraint 399 577 11.2915 14.1144 21.1716 6.7803 Constraint 461 644 14.1015 17.6269 26.4403 6.7775 Constraint 404 651 10.4614 13.0767 19.6151 6.7775 Constraint 259 651 16.6291 20.7864 31.1796 6.7647 Constraint 399 651 11.2341 14.0427 21.0640 6.7093 Constraint 368 651 10.2193 12.7741 19.1612 6.7093 Constraint 122 613 12.6362 15.7952 23.6928 6.6645 Constraint 113 622 13.6308 17.0385 25.5578 6.6645 Constraint 113 613 12.3577 15.4471 23.1706 6.6645 Constraint 104 613 12.2942 15.3678 23.0517 6.6645 Constraint 404 544 14.2319 17.7899 26.6848 6.6479 Constraint 399 544 12.8272 16.0340 24.0511 6.6479 Constraint 355 552 13.0578 16.3223 24.4834 6.6473 Constraint 527 629 11.1066 13.8833 20.8249 6.6256 Constraint 511 613 13.9595 17.4494 26.1741 6.6256 Constraint 442 668 16.2307 20.2884 30.4326 6.5902 Constraint 391 557 11.7748 14.7185 22.0777 6.5900 Constraint 226 577 12.9231 16.1538 24.2307 6.5622 Constraint 201 651 13.3735 16.7169 25.0754 6.5583 Constraint 355 636 14.4219 18.0274 27.0411 6.5511 Constraint 341 668 13.0861 16.3576 24.5365 6.5104 Constraint 285 544 15.7137 19.6422 29.4633 6.3827 Constraint 267 544 16.1908 20.2385 30.3577 6.3827 Constraint 314 676 14.2818 17.8523 26.7784 6.3644 Constraint 314 668 13.6286 17.0358 25.5537 6.3644 Constraint 242 668 14.8993 18.6241 27.9361 6.3644 Constraint 519 629 12.0864 15.1080 22.6620 6.3256 Constraint 153 590 14.0008 17.5010 26.2515 6.3078 Constraint 144 382 15.7943 19.7429 29.6144 6.2901 Constraint 382 557 12.9285 16.1607 24.2410 6.2900 Constraint 80 604 13.2792 16.5990 24.8985 6.2533 Constraint 169 571 14.6129 18.2662 27.3993 6.2363 Constraint 136 557 12.6543 15.8179 23.7268 6.2343 Constraint 435 657 12.6534 15.8168 23.7252 6.2301 Constraint 435 668 16.2366 20.2958 30.4437 6.2224 Constraint 201 585 12.5119 15.6398 23.4597 6.2205 Constraint 190 585 14.2907 17.8633 26.7950 6.2205 Constraint 176 585 12.3706 15.4633 23.1949 6.2205 Constraint 176 571 16.2487 20.3108 30.4662 6.2055 Constraint 80 629 14.2118 17.7647 26.6471 6.1818 Constraint 80 622 15.2021 19.0027 28.5040 6.1818 Constraint 250 590 10.3414 12.9268 19.3902 6.1683 Constraint 237 657 14.0763 17.5954 26.3930 6.1670 Constraint 272 644 12.8514 16.0642 24.0964 6.1638 Constraint 221 644 13.5233 16.9042 25.3562 6.1638 Constraint 190 644 12.0527 15.0659 22.5989 6.1638 Constraint 182 644 10.2550 12.8188 19.2282 6.1638 Constraint 368 544 15.6300 19.5375 29.3063 6.1594 Constraint 267 590 14.0344 17.5430 26.3144 6.1561 Constraint 201 657 12.7717 15.9647 23.9470 6.1535 Constraint 182 657 11.4101 14.2627 21.3940 6.1535 Constraint 176 657 11.3112 14.1390 21.2085 6.1535 Constraint 201 480 15.1551 18.9439 28.4159 6.1444 Constraint 88 544 10.2331 12.7914 19.1871 6.1430 Constraint 404 657 9.6982 12.1228 18.1841 6.1363 Constraint 399 644 12.0226 15.0282 22.5423 6.1363 Constraint 382 651 9.8333 12.2916 18.4375 6.1363 Constraint 375 651 7.4588 9.3235 13.9852 6.1363 Constraint 519 613 13.0943 16.3679 24.5518 6.1352 Constraint 375 577 11.3803 14.2254 21.3381 6.1314 Constraint 391 668 15.6185 19.5231 29.2846 6.1286 Constraint 104 622 12.0146 15.0183 22.5275 5.9977 Constraint 375 636 8.4615 10.5769 15.8654 5.9904 Constraint 368 636 12.1881 15.2351 22.8526 5.9904 Constraint 467 668 14.3160 17.8950 26.8425 5.9903 Constraint 161 341 14.7548 18.4435 27.6652 5.9828 Constraint 169 644 10.7507 13.4383 20.1575 5.9785 Constraint 497 657 12.8255 16.0319 24.0478 5.9726 Constraint 489 668 14.2132 17.7665 26.6497 5.9726 Constraint 489 657 12.1785 15.2231 22.8347 5.9726 Constraint 489 651 13.9627 17.4534 26.1801 5.9726 Constraint 489 644 13.9167 17.3959 26.0938 5.9726 Constraint 267 585 15.5954 19.4943 29.2414 5.9695 Constraint 128 604 9.0918 11.3648 17.0472 5.9645 Constraint 303 651 14.7121 18.3901 27.5852 5.9494 Constraint 360 571 10.3361 12.9201 19.3802 5.9411 Constraint 355 571 12.1758 15.2198 22.8296 5.9411 Constraint 303 668 14.1417 17.6771 26.5157 5.9374 Constraint 279 636 15.4519 19.3149 28.9724 5.9340 Constraint 272 636 13.0596 16.3245 24.4868 5.9340 Constraint 267 636 15.8518 19.8147 29.7221 5.9340 Constraint 58 242 14.3988 17.9985 26.9977 5.9075 Constraint 292 557 14.4764 18.0955 27.1432 5.8855 Constraint 128 629 12.5536 15.6920 23.5381 5.8549 Constraint 122 636 13.1868 16.4836 24.7253 5.8549 Constraint 113 636 12.2704 15.3380 23.0069 5.8549 Constraint 113 629 11.4599 14.3249 21.4873 5.8549 Constraint 104 636 12.7901 15.9876 23.9815 5.8549 Constraint 104 629 11.0342 13.7927 20.6891 5.8549 Constraint 88 644 14.5653 18.2066 27.3099 5.8549 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 480 12.6846 15.8557 23.7836 5.8367 Constraint 58 473 12.4000 15.5000 23.2500 5.8367 Constraint 58 467 14.1825 17.7281 26.5921 5.8367 Constraint 58 461 12.3920 15.4900 23.2350 5.8367 Constraint 58 449 11.9904 14.9880 22.4819 5.8367 Constraint 58 442 14.8358 18.5447 27.8171 5.8367 Constraint 58 435 16.0901 20.1127 30.1690 5.8367 Constraint 58 201 17.1887 21.4859 32.2289 5.8367 Constraint 58 176 16.7892 20.9865 31.4797 5.8367 Constraint 58 161 16.8931 21.1164 31.6746 5.8367 Constraint 58 153 14.3962 17.9953 26.9929 5.8367 Constraint 169 657 11.9634 14.9542 22.4313 5.8357 Constraint 226 590 11.2871 14.1088 21.1633 5.8350 Constraint 412 571 12.9807 16.2259 24.3388 5.7938 Constraint 412 557 12.8891 16.1114 24.1671 5.7938 Constraint 412 552 12.0799 15.0999 22.6499 5.7938 Constraint 399 571 11.4183 14.2729 21.4093 5.7803 Constraint 314 571 9.0778 11.3472 17.0208 5.7750 Constraint 292 571 11.4780 14.3475 21.5212 5.7750 Constraint 259 571 11.5009 14.3761 21.5642 5.7750 Constraint 272 651 13.4946 16.8683 25.3024 5.7590 Constraint 221 651 14.6200 18.2750 27.4126 5.7590 Constraint 190 651 13.2452 16.5565 24.8348 5.7590 Constraint 96 613 13.3230 16.6538 24.9807 5.6683 Constraint 136 622 13.3841 16.7302 25.0953 5.6645 Constraint 136 613 11.9623 14.9528 22.4293 5.6645 Constraint 128 622 12.6515 15.8144 23.7217 5.6645 Constraint 128 613 11.9172 14.8965 22.3447 5.6645 Constraint 122 644 14.4678 18.0848 27.1272 5.6645 Constraint 122 622 13.0529 16.3161 24.4742 5.6645 Constraint 161 622 12.6896 15.8620 23.7931 5.6439 Constraint 161 613 12.1807 15.2258 22.8387 5.6439 Constraint 144 629 13.8775 17.3469 26.0203 5.5964 Constraint 169 651 11.7107 14.6383 21.9575 5.5737 Constraint 279 544 12.2520 15.3150 22.9725 5.5730 Constraint 237 651 14.8750 18.5937 27.8906 5.5660 Constraint 161 519 15.6126 19.5157 29.2736 5.5479 Constraint 128 557 12.3619 15.4523 23.1785 5.5344 Constraint 341 676 13.3211 16.6514 24.9771 5.5326 Constraint 668 742 9.9540 12.4425 18.6637 5.5002 Constraint 442 571 12.2457 15.3071 22.9607 5.4603 Constraint 382 552 11.6688 14.5860 21.8790 5.4440 Constraint 250 585 14.5675 18.2094 27.3141 5.4417 Constraint 391 577 8.1130 10.1412 15.2118 5.4315 Constraint 201 511 14.7137 18.3921 27.5881 5.3846 Constraint 322 668 10.6668 13.3335 20.0002 5.3644 Constraint 297 657 11.8728 14.8410 22.2615 5.3644 Constraint 292 676 13.1055 16.3819 24.5728 5.3644 Constraint 292 668 11.5774 14.4717 21.7076 5.3644 Constraint 285 668 14.2945 17.8681 26.8022 5.3644 Constraint 259 668 14.3279 17.9099 26.8649 5.3644 Constraint 237 668 14.4149 18.0186 27.0278 5.3644 Constraint 221 657 13.8546 17.3182 25.9773 5.3644 Constraint 210 668 11.5142 14.3928 21.5891 5.3644 Constraint 250 636 15.1316 18.9144 28.3717 5.3586 Constraint 330 644 10.5433 13.1792 19.7688 5.3542 Constraint 297 651 11.4034 14.2543 21.3814 5.3542 Constraint 297 644 10.6676 13.3345 20.0017 5.3542 Constraint 292 644 11.6069 14.5086 21.7629 5.3542 Constraint 285 644 15.1106 18.8882 28.3323 5.3542 Constraint 267 644 15.5326 19.4158 29.1237 5.3542 Constraint 226 636 12.3225 15.4032 23.1048 5.3510 Constraint 421 676 14.5724 18.2156 27.3233 5.3448 Constraint 176 375 16.9222 21.1527 31.7290 5.3062 Constraint 122 651 14.3119 17.8898 26.8347 5.2597 Constraint 161 571 13.1062 16.3828 24.5742 5.2363 Constraint 161 557 13.7538 17.1922 25.7883 5.2363 Constraint 169 557 14.0628 17.5785 26.3677 5.2344 Constraint 226 585 14.4128 18.0160 27.0240 5.2327 Constraint 88 651 13.2778 16.5973 24.8959 5.1881 Constraint 535 644 14.8067 18.5084 27.7625 5.1823 Constraint 237 644 12.9983 16.2479 24.3719 5.1760 Constraint 226 644 13.6641 17.0801 25.6202 5.1760 Constraint 201 644 10.0204 12.5255 18.7882 5.1760 Constraint 169 668 11.6652 14.5815 21.8723 5.1689 Constraint 144 622 14.3506 17.9383 26.9074 5.1658 Constraint 88 557 12.8187 16.0233 24.0350 5.1411 Constraint 412 668 15.9594 19.9492 29.9238 5.1363 Constraint 382 577 10.1831 12.7289 19.0933 5.1315 Constraint 368 577 9.8527 12.3159 18.4739 5.1315 Constraint 360 577 8.7455 10.9319 16.3978 5.1315 Constraint 355 577 10.5520 13.1901 19.7851 5.1315 Constraint 350 571 12.9387 16.1734 24.2601 5.1315 Constraint 242 557 13.1501 16.4376 24.6564 5.1258 Constraint 355 668 14.8856 18.6070 27.9105 5.1229 Constraint 237 571 11.2505 14.0631 21.0947 5.1123 Constraint 350 668 15.1751 18.9689 28.4533 5.1075 Constraint 657 742 11.4732 14.3415 21.5123 5.0954 Constraint 651 742 13.2348 16.5435 24.8153 5.0954 Constraint 629 742 14.4266 18.0333 27.0499 5.0954 Constraint 442 644 14.5177 18.1471 27.2206 5.0192 Constraint 511 629 11.0937 13.8672 20.8007 4.9921 Constraint 144 375 16.2661 20.3327 30.4990 4.9920 Constraint 144 368 16.2416 20.3020 30.4530 4.9920 Constraint 322 687 14.0353 17.5441 26.3162 4.9756 Constraint 314 687 15.4076 19.2595 28.8893 4.9750 Constraint 497 636 12.7941 15.9926 23.9889 4.9745 Constraint 489 636 11.4076 14.2595 21.3892 4.9745 Constraint 267 571 13.6224 17.0280 25.5420 4.9654 Constraint 330 657 10.7961 13.4952 20.2428 4.9596 Constraint 303 676 13.8682 17.3353 26.0029 4.9596 Constraint 285 651 15.8002 19.7503 29.6254 4.9570 Constraint 375 557 11.8953 14.8691 22.3036 4.9565 Constraint 368 557 11.5977 14.4971 21.7457 4.9565 Constraint 360 557 10.8354 13.5443 20.3164 4.9565 Constraint 355 557 11.9757 14.9696 22.4544 4.9565 Constraint 350 557 14.0908 17.6135 26.4202 4.9565 Constraint 330 651 10.0868 12.6085 18.9128 4.9494 Constraint 303 644 13.8535 17.3168 25.9753 4.9494 Constraint 279 651 14.4113 18.0141 27.0211 4.9494 Constraint 279 644 13.7781 17.2227 25.8340 4.9494 Constraint 535 636 16.3014 20.3767 30.5651 4.9294 Constraint 122 657 12.9558 16.1947 24.2920 4.8568 Constraint 136 636 12.0580 15.0725 22.6088 4.8549 Constraint 136 629 11.5420 14.4275 21.6412 4.8549 Constraint 113 644 13.0426 16.3033 24.4549 4.8549 Constraint 69 535 16.1602 20.2003 30.3004 4.8530 Constraint 404 557 13.1589 16.4487 24.6730 4.7957 Constraint 399 557 12.5868 15.7335 23.6002 4.7957 Constraint 382 571 8.9887 11.2358 16.8537 4.7952 Constraint 375 571 9.5412 11.9265 17.8898 4.7952 Constraint 221 571 12.5772 15.7215 23.5823 4.7750 Constraint 429 676 14.9281 18.6602 27.9902 4.7718 Constraint 226 651 15.7812 19.7265 29.5898 4.7712 Constraint 404 571 10.4017 13.0022 19.5033 4.6344 Constraint 544 651 14.6408 18.3010 27.4515 4.6315 Constraint 404 668 12.2559 15.3198 22.9797 4.5633 Constraint 382 668 13.1645 16.4556 24.6834 4.5633 Constraint 375 668 10.5819 13.2273 19.8410 4.5633 Constraint 368 668 13.4308 16.7885 25.1828 4.5633 Constraint 360 706 15.9324 19.9155 29.8732 4.5499 Constraint 341 706 12.1232 15.1540 22.7310 4.5480 Constraint 341 698 13.4198 16.7748 25.1622 4.5480 Constraint 341 687 13.9644 17.4555 26.1832 4.5480 Constraint 360 676 15.3528 19.1910 28.7864 4.5422 Constraint 350 676 15.8311 19.7888 29.6833 4.5345 Constraint 644 742 11.8598 14.8247 22.2371 4.5224 Constraint 322 698 12.9511 16.1889 24.2833 4.3798 Constraint 314 698 14.4865 18.1082 27.1623 4.3798 Constraint 303 698 14.2571 17.8213 26.7320 4.3798 Constraint 297 698 11.8512 14.8140 22.2210 4.3798 Constraint 292 698 13.2226 16.5283 24.7925 4.3798 Constraint 292 687 14.9226 18.6532 27.9799 4.3798 Constraint 285 698 14.7277 18.4096 27.6144 4.3798 Constraint 279 698 13.4424 16.8030 25.2045 4.3798 Constraint 272 698 12.8976 16.1220 24.1830 4.3798 Constraint 267 698 14.8314 18.5392 27.8088 4.3798 Constraint 221 698 14.3185 17.8982 26.8473 4.3798 Constraint 210 698 14.3704 17.9631 26.9446 4.3798 Constraint 182 698 12.0858 15.1073 22.6609 4.3798 Constraint 285 657 14.4481 18.0602 27.0903 4.3798 Constraint 259 657 14.1304 17.6630 26.4945 4.3798 Constraint 242 644 13.9565 17.4457 26.1685 4.3740 Constraint 285 676 14.9928 18.7410 28.1116 4.3721 Constraint 259 676 15.3677 19.2096 28.8144 4.3721 Constraint 242 676 15.5375 19.4219 29.1329 4.3721 Constraint 330 668 9.1691 11.4614 17.1921 4.3664 Constraint 322 676 9.7726 12.2157 18.3236 4.3664 Constraint 297 676 9.9632 12.4540 18.6810 4.3664 Constraint 297 668 8.9684 11.2105 16.8158 4.3664 Constraint 279 668 12.3396 15.4245 23.1367 4.3664 Constraint 272 676 12.5646 15.7057 23.5586 4.3664 Constraint 272 668 10.3027 12.8783 19.3175 4.3664 Constraint 272 657 12.0233 15.0291 22.5437 4.3664 Constraint 267 668 14.0080 17.5100 26.2650 4.3664 Constraint 259 644 14.3856 17.9820 26.9731 4.3664 Constraint 226 668 13.6343 17.0429 25.5644 4.3664 Constraint 226 657 14.8244 18.5304 27.7957 4.3664 Constraint 221 676 14.0981 17.6226 26.4339 4.3664 Constraint 221 668 11.6433 14.5541 21.8312 4.3664 Constraint 210 676 12.4326 15.5408 23.3111 4.3664 Constraint 201 676 13.2119 16.5148 24.7723 4.3664 Constraint 201 668 10.4398 13.0498 19.5746 4.3664 Constraint 190 676 12.7959 15.9949 23.9923 4.3664 Constraint 190 668 9.8535 12.3169 18.4754 4.3664 Constraint 190 657 11.4202 14.2752 21.4128 4.3664 Constraint 182 676 9.7358 12.1698 18.2547 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 176 676 10.6182 13.2728 19.9092 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 267 651 16.2031 20.2539 30.3808 4.3618 Constraint 161 511 15.1907 18.9884 28.4825 4.3335 Constraint 169 706 14.5525 18.1907 27.2860 4.3104 Constraint 279 480 14.0013 17.5016 26.2525 4.3057 Constraint 272 480 13.0185 16.2732 24.4098 4.3057 Constraint 267 480 14.4563 18.0703 27.1055 4.3057 Constraint 88 668 14.0031 17.5038 26.2557 4.1901 Constraint 88 657 11.7365 14.6706 22.0059 4.1901 Constraint 113 651 12.1829 15.2286 22.8428 4.1881 Constraint 104 651 11.1556 13.9445 20.9168 4.1881 Constraint 104 644 12.1683 15.2104 22.8156 4.1881 Constraint 242 552 11.9575 14.9468 22.4202 4.1277 Constraint 350 657 13.6570 17.0713 25.6069 4.1229 Constraint 350 644 14.8363 18.5454 27.8182 4.1183 Constraint 201 571 13.3051 16.6313 24.9470 4.1123 Constraint 636 742 14.4324 18.0405 27.0608 4.0973 Constraint 58 267 16.1835 20.2294 30.3441 4.0163 Constraint 58 237 16.2849 20.3561 30.5342 4.0163 Constraint 51 429 13.0177 16.2722 24.4082 4.0163 Constraint 51 404 14.7570 18.4462 27.6694 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 391 15.0745 18.8432 28.2648 4.0163 Constraint 51 382 16.4733 20.5916 30.8874 4.0163 Constraint 51 375 13.9085 17.3857 26.0785 4.0163 Constraint 51 368 14.4564 18.0705 27.1057 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 355 11.8633 14.8291 22.2437 4.0163 Constraint 51 350 14.6555 18.3194 27.4791 4.0163 Constraint 51 341 13.7194 17.1492 25.7238 4.0163 Constraint 51 330 12.6862 15.8578 23.7866 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 303 13.5882 16.9853 25.4779 4.0163 Constraint 51 297 14.8148 18.5186 27.7778 4.0163 Constraint 51 292 13.4736 16.8420 25.2630 4.0163 Constraint 51 285 14.5831 18.2289 27.3433 4.0163 Constraint 51 259 14.9575 18.6969 28.0454 4.0163 Constraint 51 242 13.8008 17.2510 25.8766 4.0163 Constraint 51 237 15.9982 19.9978 29.9967 4.0163 Constraint 51 210 13.9320 17.4150 26.1226 4.0163 Constraint 51 182 15.2071 19.0089 28.5133 4.0163 Constraint 51 169 14.9992 18.7489 28.1234 4.0163 Constraint 51 144 12.2532 15.3165 22.9747 4.0163 Constraint 51 136 12.6908 15.8635 23.7952 4.0163 Constraint 51 128 12.1092 15.1365 22.7047 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 41 399 14.2035 17.7544 26.6316 4.0163 Constraint 41 375 15.1260 18.9075 28.3612 4.0163 Constraint 41 368 15.6107 19.5134 29.2701 4.0163 Constraint 41 360 14.0288 17.5361 26.3041 4.0163 Constraint 41 341 15.2699 19.0874 28.6310 4.0163 Constraint 41 330 15.4145 19.2682 28.9022 4.0163 Constraint 41 322 14.4620 18.0775 27.1162 4.0163 Constraint 41 314 13.6431 17.0538 25.5807 4.0163 Constraint 41 303 16.2894 20.3618 30.5426 4.0163 Constraint 41 128 16.3916 20.4895 30.7342 4.0163 Constraint 41 122 13.6300 17.0375 25.5562 4.0163 Constraint 41 113 12.3966 15.4958 23.2437 4.0163 Constraint 480 676 14.7770 18.4712 27.7068 3.9980 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 527 651 11.5533 14.4416 21.6625 3.9758 Constraint 519 651 13.0045 16.2557 24.3835 3.9758 Constraint 511 657 12.6569 15.8211 23.7316 3.9758 Constraint 330 706 9.2476 11.5595 17.3392 3.9750 Constraint 330 698 11.2860 14.1075 21.1613 3.9750 Constraint 330 687 11.6327 14.5408 21.8113 3.9750 Constraint 322 706 11.3874 14.2342 21.3514 3.9750 Constraint 314 706 12.9270 16.1588 24.2381 3.9750 Constraint 303 706 11.9031 14.8788 22.3183 3.9750 Constraint 303 687 15.2480 19.0601 28.5901 3.9750 Constraint 297 706 9.9401 12.4251 18.6376 3.9750 Constraint 297 687 13.0450 16.3062 24.4593 3.9750 Constraint 292 706 12.3381 15.4227 23.1340 3.9750 Constraint 285 706 13.4088 16.7610 25.1415 3.9750 Constraint 279 706 11.6634 14.5792 21.8688 3.9750 Constraint 272 706 12.1725 15.2156 22.8234 3.9750 Constraint 267 706 13.9092 17.3865 26.0798 3.9750 Constraint 259 706 14.8927 18.6159 27.9238 3.9750 Constraint 221 706 14.2220 17.7775 26.6663 3.9750 Constraint 497 651 12.1489 15.1862 22.7792 3.9726 Constraint 497 644 11.6219 14.5274 21.7911 3.9726 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 279 676 13.3365 16.6706 25.0058 3.9616 Constraint 176 557 16.2465 20.3081 30.4622 3.8874 Constraint 279 467 13.3750 16.7187 25.0780 3.8804 Constraint 96 636 12.4818 15.6023 23.4034 3.8587 Constraint 136 668 13.2060 16.5075 24.7613 3.8568 Constraint 136 657 11.4022 14.2527 21.3791 3.8568 Constraint 122 668 13.6376 17.0470 25.5704 3.8568 Constraint 113 668 12.7807 15.9759 23.9639 3.8568 Constraint 604 742 14.0423 17.5528 26.3293 3.8557 Constraint 69 585 17.2487 21.5608 32.3412 3.8531 Constraint 69 557 16.4748 20.5935 30.8903 3.8531 Constraint 69 552 13.5063 16.8829 25.3244 3.8531 Constraint 58 577 16.9802 21.2253 31.8379 3.8531 Constraint 58 552 13.5060 16.8825 25.3238 3.8531 Constraint 161 636 11.9377 14.9221 22.3831 3.8465 Constraint 161 629 11.3242 14.1552 21.2328 3.8465 Constraint 368 552 9.4873 11.8591 17.7886 3.8105 Constraint 314 557 9.9164 12.3955 18.5933 3.7923 Constraint 285 557 14.0297 17.5371 26.3057 3.7923 Constraint 259 557 13.8916 17.3645 26.0468 3.7923 Constraint 473 676 13.2414 16.5518 24.8276 3.7852 Constraint 250 571 10.0982 12.6228 18.9341 3.7788 Constraint 535 651 12.9181 16.1476 24.2214 3.7028 Constraint 161 644 12.7915 15.9894 23.9841 3.6683 Constraint 136 644 12.4309 15.5386 23.3079 3.6683 Constraint 544 644 14.7702 18.4627 27.6941 3.6315 Constraint 442 698 16.5544 20.6930 31.0396 3.5634 Constraint 391 676 16.1747 20.2183 30.3275 3.5576 Constraint 355 676 15.2372 19.0464 28.5697 3.5576 Constraint 350 687 16.5753 20.7191 31.0786 3.5576 Constraint 355 706 14.9485 18.6857 28.0285 3.5499 Constraint 350 706 14.5668 18.2084 27.3127 3.5499 Constraint 96 557 13.6492 17.0615 25.5922 3.4431 Constraint 480 698 12.4617 15.5772 23.3658 3.4028 Constraint 242 698 14.7576 18.4469 27.6704 3.3952 Constraint 250 657 15.1634 18.9543 28.4314 3.3875 Constraint 272 687 14.1573 17.6967 26.5450 3.3818 Constraint 221 687 15.9888 19.9860 29.9790 3.3818 Constraint 210 687 14.9224 18.6530 27.9795 3.3818 Constraint 201 698 13.6251 17.0314 25.5471 3.3818 Constraint 201 687 15.0344 18.7930 28.1896 3.3818 Constraint 190 698 12.0980 15.1225 22.6838 3.3818 Constraint 190 687 14.1709 17.7136 26.5704 3.3818 Constraint 182 687 11.9522 14.9402 22.4103 3.3818 Constraint 176 698 10.9787 13.7234 20.5851 3.3818 Constraint 176 687 12.3863 15.4829 23.2244 3.3818 Constraint 169 698 13.2887 16.6109 24.9163 3.3818 Constraint 169 687 13.7257 17.1572 25.7358 3.3818 Constraint 169 676 11.2641 14.0801 21.1202 3.3818 Constraint 267 676 15.4477 19.3096 28.9644 3.3740 Constraint 237 676 15.4270 19.2838 28.9257 3.3740 Constraint 449 668 14.9498 18.6872 28.0308 3.3601 Constraint 449 644 12.3425 15.4281 23.1421 3.3601 Constraint 33 399 14.7826 18.4783 27.7174 3.3388 Constraint 33 391 17.3302 21.6628 32.4942 3.3388 Constraint 33 368 16.1762 20.2202 30.3303 3.3388 Constraint 33 360 14.1610 17.7012 26.5518 3.3388 Constraint 33 355 11.9953 14.9941 22.4912 3.3388 Constraint 33 341 13.1862 16.4828 24.7242 3.3388 Constraint 33 330 12.7842 15.9803 23.9704 3.3388 Constraint 33 322 12.3424 15.4280 23.1419 3.3388 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 33 303 14.7631 18.4538 27.6807 3.3388 Constraint 33 297 16.2600 20.3250 30.4875 3.3388 Constraint 33 292 16.2492 20.3114 30.4672 3.3388 Constraint 33 122 13.6116 17.0144 25.5217 3.3388 Constraint 33 113 11.4267 14.2834 21.4251 3.3388 Constraint 33 104 11.6713 14.5891 21.8837 3.3388 Constraint 552 687 14.5420 18.1775 27.2663 3.3315 Constraint 544 687 14.1563 17.6953 26.5430 3.3315 Constraint 571 706 11.4124 14.2655 21.3982 3.3296 Constraint 557 706 13.3322 16.6653 24.9979 3.3296 Constraint 557 698 14.1556 17.6945 26.5417 3.3296 Constraint 557 687 12.7531 15.9414 23.9120 3.3296 Constraint 527 636 13.9002 17.3752 26.0628 3.3112 Constraint 226 480 14.2207 17.7758 26.6638 3.3076 Constraint 190 480 13.2781 16.5977 24.8965 3.3076 Constraint 176 480 13.3378 16.6722 25.0084 3.3076 Constraint 161 651 13.4456 16.8070 25.2105 3.2635 Constraint 144 668 13.7118 17.1397 25.7096 3.2611 Constraint 144 657 12.3557 15.4447 23.1670 3.2611 Constraint 153 613 13.4709 16.8386 25.2580 3.2146 Constraint 96 657 12.0609 15.0761 22.6142 3.1920 Constraint 96 651 11.9019 14.8774 22.3161 3.1920 Constraint 96 644 12.9965 16.2456 24.3685 3.1920 Constraint 128 668 12.5965 15.7457 23.6185 3.1901 Constraint 128 657 10.6896 13.3621 20.0431 3.1901 Constraint 122 676 14.5747 18.2183 27.3275 3.1901 Constraint 113 676 13.5649 16.9561 25.4342 3.1901 Constraint 113 657 9.4139 11.7674 17.6511 3.1901 Constraint 104 676 12.3897 15.4871 23.2307 3.1901 Constraint 104 668 11.4116 14.2645 21.3968 3.1901 Constraint 104 657 8.9961 11.2451 16.8676 3.1901 Constraint 88 676 14.3002 17.8753 26.8129 3.1901 Constraint 96 571 13.6132 17.0164 25.5247 3.1431 Constraint 237 557 12.7965 15.9956 23.9934 3.1277 Constraint 237 552 12.1488 15.1860 22.7790 3.1277 Constraint 201 552 14.1975 17.7469 26.6204 3.1277 Constraint 144 644 12.6119 15.7649 23.6474 3.0726 Constraint 210 720 17.0101 21.2627 31.8940 3.0562 Constraint 176 720 15.1955 18.9944 28.4915 3.0562 Constraint 442 676 15.4666 19.3332 28.9998 3.0269 Constraint 128 644 10.7289 13.4112 20.1168 3.0016 Constraint 58 190 17.3058 21.6322 32.4483 3.0000 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 467 12.1656 15.2071 22.8106 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 449 11.4549 14.3187 21.4780 3.0000 Constraint 51 442 14.9773 18.7216 28.0823 3.0000 Constraint 51 435 15.6866 19.6083 29.4124 3.0000 Constraint 51 421 11.7813 14.7266 22.0899 3.0000 Constraint 51 412 15.9369 19.9212 29.8817 3.0000 Constraint 51 161 16.3981 20.4976 30.7464 3.0000 Constraint 51 153 13.6447 17.0559 25.5838 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 473 12.5906 15.7383 23.6075 3.0000 Constraint 41 467 14.1381 17.6726 26.5089 3.0000 Constraint 41 461 13.9501 17.4376 26.1565 3.0000 Constraint 41 449 15.2094 19.0117 28.5176 3.0000 Constraint 41 429 14.3138 17.8923 26.8384 3.0000 Constraint 41 421 14.7267 18.4084 27.6126 3.0000 Constraint 41 404 16.6531 20.8163 31.2245 3.0000 Constraint 41 391 16.8182 21.0228 31.5342 3.0000 Constraint 41 355 11.5988 14.4986 21.7478 3.0000 Constraint 41 350 15.2976 19.1220 28.6831 3.0000 Constraint 41 144 15.8400 19.8000 29.7000 3.0000 Constraint 41 136 16.7218 20.9023 31.3534 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 489 13.0759 16.3449 24.5173 3.0000 Constraint 33 480 14.5110 18.1388 27.2081 3.0000 Constraint 33 473 15.0623 18.8278 28.2417 3.0000 Constraint 33 467 16.7675 20.9594 31.4390 3.0000 Constraint 33 461 15.5970 19.4962 29.2444 3.0000 Constraint 33 449 15.7955 19.7444 29.6166 3.0000 Constraint 33 429 15.9870 19.9838 29.9757 3.0000 Constraint 33 421 15.3922 19.2402 28.8603 3.0000 Constraint 33 350 14.2217 17.7772 26.6657 3.0000 Constraint 33 144 15.5803 19.4753 29.2130 3.0000 Constraint 33 136 15.3693 19.2117 28.8175 3.0000 Constraint 33 128 15.1971 18.9963 28.4945 3.0000 Constraint 590 706 11.7072 14.6340 21.9510 2.9983 Constraint 480 687 13.5274 16.9093 25.3639 2.9980 Constraint 557 676 14.7203 18.4004 27.6006 2.9961 Constraint 161 355 16.3345 20.4181 30.6272 2.9886 Constraint 399 676 14.2036 17.7545 26.6318 2.9846 Constraint 341 729 15.5947 19.4934 29.2401 2.9827 Constraint 341 720 12.4049 15.5062 23.2593 2.9827 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 729 14.5333 18.1666 27.2499 2.9827 Constraint 330 720 11.4433 14.3042 21.4563 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 322 720 14.3617 17.9522 26.9283 2.9827 Constraint 322 713 11.3366 14.1708 21.2561 2.9827 Constraint 314 720 14.9429 18.6787 28.0180 2.9827 Constraint 314 713 12.6796 15.8496 23.7743 2.9827 Constraint 303 729 16.9354 21.1692 31.7538 2.9827 Constraint 303 720 13.2566 16.5707 24.8561 2.9827 Constraint 303 713 12.0239 15.0298 22.5447 2.9827 Constraint 297 713 10.9330 13.6663 20.4994 2.9827 Constraint 292 713 13.4471 16.8089 25.2134 2.9827 Constraint 285 720 15.6198 19.5248 29.2872 2.9827 Constraint 285 713 14.5005 18.1257 27.1885 2.9827 Constraint 279 713 13.3615 16.7019 25.0529 2.9827 Constraint 267 713 15.7684 19.7105 29.5658 2.9827 Constraint 259 713 16.2343 20.2928 30.4392 2.9827 Constraint 242 706 16.2743 20.3429 30.5143 2.9827 Constraint 511 636 13.3774 16.7217 25.0825 2.9777 Constraint 421 706 15.3202 19.1503 28.7254 2.9769 Constraint 279 687 14.7735 18.4669 27.7004 2.9769 Constraint 210 706 13.5422 16.9278 25.3917 2.9769 Constraint 201 706 14.3364 17.9204 26.8807 2.9769 Constraint 190 706 11.9135 14.8919 22.3378 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 176 706 10.9944 13.7431 20.6146 2.9769 Constraint 497 698 12.0553 15.0691 22.6037 2.9759 Constraint 497 668 10.1778 12.7222 19.0834 2.9759 Constraint 489 687 13.5379 16.9224 25.3836 2.9759 Constraint 535 657 11.8102 14.7627 22.1441 2.9758 Constraint 527 676 12.5910 15.7388 23.6082 2.9758 Constraint 527 668 11.7932 14.7415 22.1122 2.9758 Constraint 527 657 9.2490 11.5613 17.3419 2.9758 Constraint 527 644 11.3009 14.1261 21.1892 2.9758 Constraint 519 687 13.2521 16.5651 24.8477 2.9758 Constraint 519 676 14.5920 18.2400 27.3600 2.9758 Constraint 519 657 10.9086 13.6358 20.4536 2.9758 Constraint 519 644 13.2772 16.5964 24.8947 2.9758 Constraint 527 706 14.4638 18.0798 27.1197 2.9045 Constraint 161 668 14.0387 17.5484 26.3226 2.8587 Constraint 161 657 12.5642 15.7052 23.5578 2.8587 Constraint 128 636 9.4497 11.8121 17.7182 2.8587 Constraint 69 544 15.7886 19.7358 29.6037 2.8367 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 58 585 15.1166 18.8958 28.3437 2.8367 Constraint 58 557 14.1313 17.6641 26.4962 2.8367 Constraint 58 544 15.4290 19.2863 28.9294 2.8367 Constraint 58 535 14.8581 18.5726 27.8589 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 442 687 15.7942 19.7427 29.6141 2.8354 Constraint 259 552 11.7990 14.7488 22.1231 2.8105 Constraint 272 557 15.3874 19.2342 28.8514 2.7923 Constraint 267 557 15.6167 19.5208 29.2813 2.7923 Constraint 221 557 13.3360 16.6700 25.0050 2.7923 Constraint 467 676 15.8119 19.7649 29.6473 2.7872 Constraint 461 676 14.4516 18.0645 27.0967 2.7872 Constraint 461 668 14.2481 17.8101 26.7152 2.7872 Constraint 226 571 11.2859 14.1074 21.1611 2.7788 Constraint 535 687 14.0756 17.5945 26.3918 2.7363 Constraint 144 651 12.7778 15.9723 23.9584 2.6678 Constraint 590 713 11.4115 14.2643 21.3965 2.6629 Constraint 585 729 16.0649 20.0812 30.1218 2.6629 Constraint 585 713 13.3346 16.6683 25.0025 2.6629 Constraint 577 713 11.7593 14.6991 22.0486 2.6629 Constraint 571 713 10.2855 12.8568 19.2852 2.6629 Constraint 557 729 15.3287 19.1608 28.7412 2.6629 Constraint 557 720 15.4981 19.3727 29.0590 2.6629 Constraint 557 713 12.0803 15.1004 22.6505 2.6629 Constraint 201 713 16.2008 20.2510 30.3766 2.6514 Constraint 169 713 15.0411 18.8013 28.2020 2.6514 Constraint 136 651 10.5463 13.1828 19.7743 2.5968 Constraint 128 651 9.8717 12.3396 18.5094 2.5968 Constraint 497 687 11.9138 14.8922 22.3384 2.5710 Constraint 497 676 12.3074 15.3843 23.0764 2.5710 Constraint 421 698 15.0363 18.7953 28.1930 2.5653 Constraint 360 698 14.5322 18.1652 27.2478 2.5653 Constraint 355 698 15.0225 18.7782 28.1672 2.5653 Constraint 350 636 14.2043 17.7554 26.6331 2.5608 Constraint 350 735 16.3599 20.4499 30.6748 2.5576 Constraint 341 735 15.7339 19.6673 29.5010 2.5576 Constraint 272 511 15.6371 19.5463 29.3195 2.5479 Constraint 226 511 12.5971 15.7464 23.6196 2.5479 Constraint 190 519 14.5956 18.2444 27.3667 2.5479 Constraint 190 511 14.7287 18.4109 27.6164 2.5479 Constraint 176 519 14.6154 18.2693 27.4039 2.5479 Constraint 489 698 10.4019 13.0024 19.5036 2.4029 Constraint 489 676 13.2379 16.5474 24.8211 2.4029 Constraint 250 687 16.2284 20.2855 30.4283 2.4029 Constraint 242 687 14.9586 18.6982 28.0474 2.4029 Constraint 267 687 17.0703 21.3379 32.0069 2.3952 Constraint 259 698 12.7611 15.9514 23.9270 2.3952 Constraint 237 698 14.5651 18.2064 27.3096 2.3952 Constraint 226 698 14.7830 18.4788 27.7182 2.3952 Constraint 297 729 15.0811 18.8513 28.2770 2.3894 Constraint 272 729 16.4865 20.6082 30.9123 2.3894 Constraint 272 720 14.2413 17.8016 26.7024 2.3894 Constraint 226 676 14.8095 18.5118 27.7677 2.3894 Constraint 221 720 16.8021 21.0026 31.5039 2.3894 Constraint 190 720 15.8548 19.8185 29.7277 2.3894 Constraint 182 729 16.0045 20.0056 30.0084 2.3894 Constraint 182 720 13.6141 17.0177 25.5265 2.3894 Constraint 250 668 15.4600 19.3250 28.9876 2.3875 Constraint 267 657 13.7898 17.2373 25.8559 2.3817 Constraint 449 676 13.5607 16.9509 25.4264 2.3601 Constraint 585 706 12.0782 15.0977 22.6465 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 552 706 14.1486 17.6857 26.5286 2.3315 Constraint 544 706 13.4756 16.8445 25.2668 2.3315 Constraint 544 698 14.2455 17.8068 26.7102 2.3315 Constraint 535 706 13.1382 16.4227 24.6341 2.3315 Constraint 519 706 14.5798 18.2248 27.3372 2.3315 Constraint 511 706 14.3576 17.9470 26.9204 2.3315 Constraint 144 676 14.5035 18.1293 27.1940 2.2630 Constraint 144 636 9.3843 11.7304 17.5955 2.2630 Constraint 161 676 14.8864 18.6080 27.9120 2.1920 Constraint 136 676 12.0285 15.0356 22.5534 2.1920 Constraint 128 676 11.9492 14.9365 22.4048 2.1920 Constraint 96 676 13.2223 16.5278 24.7917 2.1920 Constraint 96 668 12.7114 15.8892 23.8338 2.1920 Constraint 80 657 12.3257 15.4072 23.1107 2.1914 Constraint 80 651 11.8351 14.7939 22.1908 2.1914 Constraint 80 644 13.5716 16.9645 25.4468 2.1914 Constraint 80 636 11.9829 14.9787 22.4680 2.1914 Constraint 449 687 15.5191 19.3989 29.0983 2.1687 Constraint 429 687 14.6480 18.3100 27.4650 2.1687 Constraint 421 687 13.8678 17.3348 26.0021 2.1687 Constraint 242 544 10.3918 12.9898 19.4847 2.1431 Constraint 237 544 11.3781 14.2227 21.3340 2.1431 Constraint 226 544 14.6284 18.2854 27.4282 2.1431 Constraint 267 467 12.8439 16.0548 24.0823 2.0932 Constraint 153 636 13.4109 16.7636 25.1454 2.0715 Constraint 153 629 13.3786 16.7233 25.0849 2.0715 Constraint 69 604 16.8183 21.0229 31.5344 2.0163 Constraint 69 577 15.0449 18.8062 28.2093 2.0163 Constraint 136 687 15.1047 18.8809 28.3213 1.9986 Constraint 128 687 15.0480 18.8100 28.2149 1.9986 Constraint 122 687 14.7956 18.4945 27.7417 1.9986 Constraint 113 687 13.4836 16.8545 25.2818 1.9986 Constraint 104 687 12.5599 15.6999 23.5498 1.9986 Constraint 88 687 13.4491 16.8114 25.2171 1.9986 Constraint 497 706 12.9394 16.1742 24.2613 1.9981 Constraint 489 706 12.5661 15.7076 23.5614 1.9981 Constraint 480 706 12.2829 15.3536 23.0304 1.9981 Constraint 473 706 11.2505 14.0631 21.0947 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 687 10.3057 12.8821 19.3231 1.9981 Constraint 552 676 15.3990 19.2487 28.8731 1.9980 Constraint 544 676 14.8393 18.5491 27.8237 1.9980 Constraint 544 668 14.2638 17.8297 26.7445 1.9980 Constraint 613 729 13.4003 16.7504 25.1256 1.9962 Constraint 429 706 16.2412 20.3015 30.4523 1.9923 Constraint 399 706 15.4215 19.2768 28.9153 1.9923 Constraint 285 687 15.8008 19.7510 29.6265 1.9904 Constraint 421 713 16.0155 20.0194 30.0291 1.9846 Constraint 360 720 16.0899 20.1124 30.1686 1.9846 Constraint 360 713 16.2367 20.2959 30.4438 1.9846 Constraint 355 720 13.9462 17.4327 26.1491 1.9846 Constraint 355 713 15.3147 19.1433 28.7150 1.9846 Constraint 350 729 16.9564 21.1955 31.7932 1.9846 Constraint 350 720 12.5830 15.7287 23.5931 1.9846 Constraint 350 713 13.7189 17.1486 25.7229 1.9846 Constraint 330 735 14.3219 17.9024 26.8536 1.9846 Constraint 322 729 17.0883 21.3603 32.0405 1.9846 Constraint 297 735 16.1911 20.2388 30.3583 1.9846 Constraint 297 720 10.5132 13.1415 19.7122 1.9846 Constraint 292 720 14.5620 18.2026 27.3038 1.9846 Constraint 279 729 15.9892 19.9865 29.9798 1.9846 Constraint 279 720 12.1029 15.1287 22.6930 1.9846 Constraint 272 713 12.4496 15.5619 23.3429 1.9846 Constraint 267 720 15.8089 19.7612 29.6418 1.9846 Constraint 237 706 17.3473 21.6841 32.5262 1.9846 Constraint 226 706 15.5984 19.4980 29.2471 1.9846 Constraint 221 713 15.1487 18.9358 28.4038 1.9846 Constraint 210 713 14.7464 18.4330 27.6494 1.9846 Constraint 190 713 14.0991 17.6239 26.4358 1.9846 Constraint 182 713 10.7340 13.4174 20.1262 1.9846 Constraint 176 713 12.8130 16.0163 24.0244 1.9846 Constraint 552 668 14.4525 18.0656 27.0983 1.9827 Constraint 519 636 12.7619 15.9524 23.9286 1.9777 Constraint 527 698 10.0694 12.5867 18.8801 1.9759 Constraint 527 687 9.9418 12.4272 18.6409 1.9759 Constraint 519 698 11.6965 14.6206 21.9309 1.9759 Constraint 519 668 11.0903 13.8628 20.7942 1.9759 Constraint 511 698 12.5451 15.6814 23.5221 1.9759 Constraint 511 668 10.9288 13.6611 20.4916 1.9759 Constraint 511 651 12.8090 16.0112 24.0168 1.9759 Constraint 511 644 11.8123 14.7654 22.1481 1.9759 Constraint 190 571 12.3536 15.4420 23.1630 1.9692 Constraint 153 644 11.1258 13.9072 20.8608 1.8812 Constraint 153 622 10.9588 13.6985 20.5478 1.8812 Constraint 250 557 11.5779 14.4724 21.7086 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 226 557 13.5689 16.9611 25.4416 1.7942 Constraint 226 552 12.0298 15.0373 22.5559 1.7942 Constraint 201 557 13.4240 16.7800 25.1700 1.7942 Constraint 190 557 15.1329 18.9161 28.3741 1.7942 Constraint 161 698 15.3634 19.2042 28.8063 1.7383 Constraint 435 676 16.0205 20.0256 30.0384 1.6667 Constraint 599 742 13.7410 17.1763 25.7644 1.6648 Constraint 599 735 12.9076 16.1346 24.2018 1.6648 Constraint 590 729 12.0658 15.0822 22.6233 1.6648 Constraint 590 720 12.4041 15.5051 23.2577 1.6648 Constraint 585 720 14.5610 18.2012 27.3018 1.6648 Constraint 577 735 16.0973 20.1217 30.1825 1.6648 Constraint 577 729 12.8341 16.0426 24.0639 1.6648 Constraint 571 742 15.4740 19.3425 29.0137 1.6648 Constraint 571 735 14.1857 17.7321 26.5982 1.6648 Constraint 571 729 10.5821 13.2276 19.8414 1.6648 Constraint 571 720 10.6241 13.2801 19.9202 1.6648 Constraint 552 713 14.5985 18.2482 27.3723 1.6648 Constraint 544 742 15.4875 19.3594 29.0391 1.6648 Constraint 544 735 13.6270 17.0337 25.5506 1.6648 Constraint 544 729 15.0709 18.8386 28.2579 1.6648 Constraint 544 713 13.2374 16.5468 24.8201 1.6648 Constraint 535 742 13.6170 17.0213 25.5319 1.6648 Constraint 535 735 12.1361 15.1701 22.7552 1.6648 Constraint 535 729 13.5030 16.8787 25.3181 1.6648 Constraint 535 720 14.3249 17.9061 26.8591 1.6648 Constraint 535 713 11.7108 14.6385 21.9577 1.6648 Constraint 519 729 15.3292 19.1614 28.7422 1.6648 Constraint 519 720 15.8337 19.7921 29.6882 1.6648 Constraint 511 742 13.3306 16.6633 24.9950 1.6648 Constraint 511 735 11.7321 14.6651 21.9977 1.6648 Constraint 511 729 12.9557 16.1946 24.2919 1.6648 Constraint 511 720 14.4537 18.0671 27.1007 1.6648 Constraint 511 713 11.9799 14.9749 22.4623 1.6648 Constraint 136 713 16.8177 21.0221 31.5332 1.6648 Constraint 461 687 15.2919 19.1149 28.6724 1.5957 Constraint 435 687 14.8332 18.5415 27.8123 1.5730 Constraint 412 698 14.7725 18.4657 27.6985 1.5730 Constraint 412 687 13.2828 16.6035 24.9053 1.5730 Constraint 412 676 15.9680 19.9601 29.9401 1.5730 Constraint 404 687 11.9088 14.8860 22.3291 1.5730 Constraint 399 698 13.4315 16.7893 25.1840 1.5730 Constraint 399 687 12.0256 15.0320 22.5480 1.5730 Constraint 391 698 14.1791 17.7239 26.5859 1.5730 Constraint 391 687 12.1075 15.1344 22.7015 1.5730 Constraint 382 687 11.5300 14.4125 21.6188 1.5730 Constraint 375 687 10.1228 12.6535 18.9802 1.5730 Constraint 368 698 13.8551 17.3189 25.9783 1.5730 Constraint 368 687 11.2921 14.1152 21.1727 1.5730 Constraint 360 687 12.0772 15.0966 22.6448 1.5730 Constraint 355 687 12.7945 15.9931 23.9897 1.5730 Constraint 511 687 12.7749 15.9686 23.9528 1.5710 Constraint 511 676 13.4560 16.8200 25.2300 1.5710 Constraint 350 698 14.0713 17.5891 26.3837 1.5653 Constraint 153 651 12.1423 15.1779 22.7668 1.4763 Constraint 80 571 12.8119 16.0149 24.0224 1.4048 Constraint 535 698 10.8250 13.5313 20.2969 1.4029 Constraint 535 676 12.0714 15.0893 22.6339 1.4029 Constraint 535 668 9.0224 11.2780 16.9169 1.4029 Constraint 259 687 14.7326 18.4158 27.6236 1.4029 Constraint 250 698 12.3882 15.4852 23.2279 1.4029 Constraint 250 676 15.3597 19.1996 28.7994 1.4029 Constraint 136 698 16.1051 20.1313 30.1970 1.4029 Constraint 128 698 14.0799 17.5998 26.3998 1.4029 Constraint 122 698 13.8632 17.3289 25.9934 1.4029 Constraint 113 698 14.4626 18.0782 27.1173 1.4029 Constraint 104 698 12.6273 15.7841 23.6762 1.4029 Constraint 88 698 12.1490 15.1862 22.7793 1.4029 Constraint 250 644 12.9560 16.1950 24.2925 1.3894 Constraint 176 511 12.4200 15.5250 23.2875 1.3335 Constraint 161 706 12.9910 16.2388 24.3582 1.3335 Constraint 153 706 13.9148 17.3935 26.0902 1.3335 Constraint 144 706 14.3802 17.9752 26.9628 1.3335 Constraint 136 706 16.8477 21.0596 31.5894 1.3335 Constraint 80 676 11.5458 14.4323 21.6484 1.1914 Constraint 80 668 12.2359 15.2948 22.9423 1.1914 Constraint 242 729 16.5389 20.6737 31.0105 1.0715 Constraint 237 735 14.9357 18.6696 28.0044 1.0715 Constraint 237 729 12.8077 16.0096 24.0145 1.0715 Constraint 237 720 15.1226 18.9032 28.3548 1.0715 Constraint 226 735 15.3750 19.2187 28.8281 1.0715 Constraint 226 729 14.0097 17.5122 26.2682 1.0715 Constraint 210 735 16.2407 20.3009 30.4513 1.0715 Constraint 210 729 14.8616 18.5770 27.8655 1.0715 Constraint 201 742 11.9025 14.8781 22.3172 1.0715 Constraint 201 735 12.3761 15.4701 23.2051 1.0715 Constraint 201 729 11.2525 14.0656 21.0984 1.0715 Constraint 201 720 13.4999 16.8749 25.3123 1.0715 Constraint 190 742 13.7931 17.2414 25.8620 1.0715 Constraint 190 735 14.5357 18.1696 27.2544 1.0715 Constraint 190 729 14.1905 17.7382 26.6073 1.0715 Constraint 182 742 16.2008 20.2510 30.3766 1.0715 Constraint 182 735 16.6665 20.8332 31.2498 1.0715 Constraint 176 742 11.9922 14.9902 22.4853 1.0715 Constraint 176 735 12.4912 15.6140 23.4210 1.0715 Constraint 176 729 12.3370 15.4212 23.1319 1.0715 Constraint 169 742 12.8056 16.0070 24.0105 1.0715 Constraint 169 735 13.0624 16.3280 24.4920 1.0715 Constraint 169 729 11.8301 14.7876 22.1815 1.0715 Constraint 169 720 12.9801 16.2251 24.3377 1.0715 Constraint 161 742 11.0485 13.8107 20.7160 1.0715 Constraint 161 735 10.8157 13.5196 20.2794 1.0715 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 161 720 10.3047 12.8809 19.3214 1.0715 Constraint 153 742 13.8053 17.2567 25.8850 1.0715 Constraint 153 735 13.7215 17.1519 25.7278 1.0715 Constraint 153 729 11.8672 14.8340 22.2509 1.0715 Constraint 153 720 12.0457 15.0571 22.5857 1.0715 Constraint 153 668 11.8279 14.7849 22.1773 1.0715 Constraint 153 657 12.1059 15.1323 22.6985 1.0715 Constraint 144 729 14.6919 18.3649 27.5474 1.0715 Constraint 144 720 13.9889 17.4862 26.2292 1.0715 Constraint 144 698 15.6897 19.6121 29.4181 1.0715 Constraint 136 729 15.2965 19.1207 28.6810 1.0715 Constraint 136 720 15.0417 18.8021 28.2032 1.0715 Constraint 128 729 14.9336 18.6670 28.0005 1.0715 Constraint 128 720 15.5805 19.4757 29.2135 1.0715 Constraint 122 729 16.5569 20.6962 31.0442 1.0715 Constraint 122 720 16.5915 20.7394 31.1091 1.0715 Constraint 69 571 16.5476 20.6845 31.0268 1.0163 Constraint 58 250 13.9829 17.4786 26.2179 1.0163 Constraint 58 226 17.3705 21.7131 32.5697 1.0163 Constraint 51 279 13.9507 17.4384 26.1576 1.0163 Constraint 51 272 14.7981 18.4977 27.7465 1.0163 Constraint 51 267 12.8363 16.0454 24.0681 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 226 14.0355 17.5444 26.3166 1.0163 Constraint 51 221 12.1783 15.2229 22.8343 1.0163 Constraint 51 201 15.2557 19.0696 28.6044 1.0163 Constraint 51 190 16.2042 20.2552 30.3828 1.0163 Constraint 51 176 16.9078 21.1348 31.7022 1.0163 Constraint 41 382 16.7583 20.9479 31.4218 1.0163 Constraint 41 292 15.0292 18.7865 28.1798 1.0163 Constraint 41 285 12.9875 16.2344 24.3516 1.0163 Constraint 41 279 17.2091 21.5114 32.2671 1.0163 Constraint 41 267 15.5634 19.4542 29.1813 1.0163 Constraint 41 259 11.8259 14.7823 22.1735 1.0163 Constraint 41 250 11.3244 14.1556 21.2333 1.0163 Constraint 41 242 10.4645 13.0807 19.6210 1.0163 Constraint 41 237 13.6592 17.0740 25.6110 1.0163 Constraint 41 226 16.2514 20.3142 30.4713 1.0163 Constraint 41 221 15.1614 18.9518 28.4277 1.0163 Constraint 41 210 14.4949 18.1186 27.1780 1.0163 Constraint 41 169 17.3304 21.6630 32.4946 1.0163 Constraint 161 687 15.4175 19.2718 28.9077 1.0005 Constraint 144 687 14.5262 18.1577 27.2366 1.0005 Constraint 96 687 14.0483 17.5604 26.3406 1.0005 Constraint 467 706 14.4293 18.0366 27.0550 1.0000 Constraint 467 698 11.4986 14.3733 21.5599 1.0000 Constraint 467 687 13.2135 16.5168 24.7752 1.0000 Constraint 461 698 14.6299 18.2874 27.4310 1.0000 Constraint 449 698 16.3307 20.4134 30.6201 1.0000 Constraint 435 706 16.7253 20.9066 31.3599 1.0000 Constraint 435 698 12.6245 15.7806 23.6709 1.0000 Constraint 429 698 11.7026 14.6283 21.9424 1.0000 Constraint 412 706 16.9343 21.1678 31.7517 1.0000 Constraint 404 706 12.6616 15.8270 23.7404 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 676 10.9343 13.6678 20.5017 1.0000 Constraint 391 706 16.7050 20.8813 31.3219 1.0000 Constraint 382 706 13.8797 17.3496 26.0244 1.0000 Constraint 382 698 10.8883 13.6103 20.4155 1.0000 Constraint 382 676 11.7533 14.6916 22.0374 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 368 706 14.5687 18.2109 27.3164 1.0000 Constraint 368 676 11.3301 14.1626 21.2439 1.0000 Constraint 69 629 17.2713 21.5891 32.3836 1.0000 Constraint 69 599 17.5584 21.9481 32.9221 1.0000 Constraint 622 742 11.4098 14.2622 21.3933 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 590 742 13.6744 17.0930 25.6395 0.9981 Constraint 590 735 13.3750 16.7187 25.0781 0.9981 Constraint 585 742 12.4589 15.5736 23.3604 0.9981 Constraint 585 735 13.6112 17.0140 25.5210 0.9981 Constraint 557 742 15.0244 18.7805 28.1708 0.9981 Constraint 557 735 12.2675 15.3343 23.0015 0.9981 Constraint 552 742 17.2116 21.5144 32.2717 0.9981 Constraint 552 735 13.8193 17.2741 25.9111 0.9981 Constraint 552 698 10.9559 13.6949 20.5423 0.9981 Constraint 527 742 13.5141 16.8926 25.3389 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 729 13.5009 16.8761 25.3142 0.9981 Constraint 527 720 13.3832 16.7289 25.0934 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 519 742 14.9527 18.6909 28.0363 0.9981 Constraint 519 735 11.1465 13.9331 20.8997 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 489 742 12.8183 16.0229 24.0343 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 720 11.4156 14.2695 21.4043 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 480 742 12.9188 16.1485 24.2228 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 720 13.4710 16.8388 25.2581 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 442 735 17.3484 21.6855 32.5282 0.9981 Constraint 442 713 17.4127 21.7659 32.6489 0.9981 Constraint 314 729 15.9634 19.9543 29.9314 0.9981 Constraint 259 720 16.9259 21.1574 31.7361 0.9981 Constraint 250 706 16.0610 20.0762 30.1143 0.9981 Constraint 242 713 15.9624 19.9529 29.9294 0.9981 Constraint 128 713 16.0383 20.0479 30.0718 0.9981 Constraint 128 706 16.9764 21.2205 31.8307 0.9981 Constraint 122 713 16.6068 20.7585 31.1377 0.9981 Constraint 122 706 16.9661 21.2076 31.8114 0.9981 Constraint 113 713 14.6851 18.3564 27.5346 0.9981 Constraint 113 706 15.9373 19.9216 29.8823 0.9981 Constraint 104 729 17.4709 21.8386 32.7579 0.9981 Constraint 104 720 16.0405 20.0506 30.0759 0.9981 Constraint 104 713 11.7284 14.6605 21.9907 0.9981 Constraint 104 706 13.1073 16.3842 24.5762 0.9981 Constraint 88 720 16.2117 20.2646 30.3970 0.9981 Constraint 88 713 12.7865 15.9832 23.9747 0.9981 Constraint 88 706 12.6872 15.8590 23.7885 0.9981 Constraint 442 706 17.1107 21.3883 32.0825 0.9923 Constraint 259 544 12.5763 15.7204 23.5806 0.8096 Constraint 250 544 11.6904 14.6130 21.9195 0.8096 Constraint 552 729 16.4542 20.5678 30.8517 0.6667 Constraint 552 720 15.6599 19.5749 29.3623 0.6667 Constraint 544 720 12.6604 15.8255 23.7383 0.6667 Constraint 259 742 17.1478 21.4348 32.1522 0.6667 Constraint 242 742 15.5200 19.4000 29.1000 0.6667 Constraint 242 735 16.9622 21.2027 31.8041 0.6667 Constraint 237 742 12.1392 15.1740 22.7609 0.6667 Constraint 237 713 16.9470 21.1838 31.7756 0.6667 Constraint 226 742 12.6866 15.8582 23.7873 0.6667 Constraint 221 742 15.9447 19.9309 29.8963 0.6667 Constraint 210 742 14.4409 18.0512 27.0768 0.6667 Constraint 161 713 12.5922 15.7403 23.6104 0.6667 Constraint 153 713 14.0784 17.5981 26.3971 0.6667 Constraint 144 742 15.0435 18.8044 28.2066 0.6667 Constraint 144 735 13.9828 17.4785 26.2178 0.6667 Constraint 144 713 15.5813 19.4767 29.2150 0.6667 Constraint 136 742 14.8526 18.5657 27.8486 0.6667 Constraint 136 735 13.6536 17.0670 25.6005 0.6667 Constraint 128 742 14.8056 18.5070 27.7605 0.6667 Constraint 128 735 14.6901 18.3626 27.5439 0.6667 Constraint 122 742 17.0505 21.3131 31.9697 0.6667 Constraint 122 735 16.7861 20.9826 31.4739 0.6667 Constraint 113 720 17.4025 21.7531 32.6296 0.6667 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 421 742 15.9400 19.9250 29.8875 0.5730 Constraint 421 735 15.9848 19.9810 29.9715 0.5730 Constraint 412 742 16.5349 20.6686 31.0029 0.5730 Constraint 412 735 16.5245 20.6556 30.9835 0.5730 Constraint 399 742 15.8754 19.8442 29.7664 0.5730 Constraint 399 735 16.9120 21.1400 31.7101 0.5730 Constraint 391 742 12.6700 15.8375 23.7562 0.5730 Constraint 391 735 13.3728 16.7159 25.0739 0.5730 Constraint 382 742 14.9153 18.6442 27.9663 0.5730 Constraint 382 735 16.1946 20.2433 30.3650 0.5730 Constraint 375 742 15.5064 19.3830 29.0745 0.5730 Constraint 375 735 17.3667 21.7084 32.5626 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 735 13.3124 16.6405 24.9608 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 360 735 12.5408 15.6760 23.5140 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 341 742 12.2541 15.3177 22.9765 0.5730 Constraint 292 729 16.2773 20.3466 30.5199 0.4048 Constraint 272 742 17.5449 21.9311 32.8967 0.4048 Constraint 272 735 17.0512 21.3140 31.9710 0.4048 Constraint 267 729 16.8206 21.0257 31.5386 0.4048 Constraint 259 729 17.1782 21.4727 32.2090 0.4048 Constraint 250 729 17.5885 21.9856 32.9783 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 226 720 14.7331 18.4163 27.6245 0.4048 Constraint 226 687 10.6659 13.3324 19.9986 0.4048 Constraint 221 729 14.6076 18.2596 27.3893 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 96 698 12.6741 15.8426 23.7640 0.4048 Constraint 33 552 17.5171 21.8964 32.8446 0.3388 Constraint 33 404 15.5970 19.4962 29.2443 0.3388 Constraint 33 382 13.4922 16.8653 25.2979 0.3388 Constraint 33 375 11.0191 13.7738 20.6608 0.3388 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 279 13.8904 17.3630 26.0445 0.3388 Constraint 33 272 15.2930 19.1162 28.6744 0.3388 Constraint 33 267 12.1135 15.1419 22.7129 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 33 237 13.1593 16.4492 24.6737 0.3388 Constraint 33 226 14.5041 18.1302 27.1952 0.3388 Constraint 33 221 13.0255 16.2819 24.4228 0.3388 Constraint 33 210 13.7334 17.1667 25.7501 0.3388 Constraint 33 201 17.1114 21.3892 32.0838 0.3388 Constraint 33 190 17.4908 21.8635 32.7952 0.3388 Constraint 33 182 16.5668 20.7085 31.0627 0.3388 Constraint 33 169 17.3564 21.6955 32.5433 0.3388 Constraint 161 382 16.5297 20.6621 30.9931 0.3000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: