# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 19.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 303 12.6414 15.8017 23.7026 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 237 303 13.3640 16.7051 25.0576 87.8820 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 303 13.3123 16.6403 24.9605 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 176 250 12.6418 15.8022 23.7034 87.7035 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 176 314 11.6621 14.5776 21.8664 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 303 13.4991 16.8738 25.3107 85.6452 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 285 12.3216 15.4020 23.1030 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 303 12.9819 16.2274 24.3411 84.8820 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 237 322 11.7486 14.6858 22.0286 82.8770 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 279 13.1785 16.4731 24.7096 82.8523 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 169 267 12.6140 15.7674 23.6512 82.8523 Constraint 169 250 12.3018 15.3772 23.0659 82.8085 Constraint 259 330 11.4443 14.3054 21.4581 82.7317 Constraint 210 330 10.9683 13.7104 20.5655 82.7317 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 176 330 12.3757 15.4696 23.2044 82.7317 Constraint 250 322 13.3027 16.6284 24.9426 82.6985 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 297 421 9.9428 12.4285 18.6427 82.3719 Constraint 292 429 10.4885 13.1107 19.6660 82.3719 Constraint 292 421 6.8174 8.5217 12.7826 82.3719 Constraint 285 421 8.4580 10.5724 15.8587 82.3719 Constraint 285 429 12.1123 15.1404 22.7106 82.0719 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 182 341 10.9744 13.7180 20.5770 81.3023 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 285 404 11.5874 14.4842 21.7264 81.2632 Constraint 242 341 12.8247 16.0308 24.0462 80.3567 Constraint 303 412 11.6876 14.6094 21.9142 80.2786 Constraint 297 412 12.4440 15.5550 23.3325 80.2786 Constraint 190 330 12.5317 15.6646 23.4969 80.0735 Constraint 285 350 7.4395 9.2994 13.9491 80.0270 Constraint 267 330 11.1639 13.9549 20.9323 79.9388 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 297 399 12.0253 15.0317 22.5475 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 226 322 12.2680 15.3350 23.0025 79.8770 Constraint 221 330 11.1382 13.9227 20.8841 79.7317 Constraint 210 404 11.1487 13.9359 20.9039 79.5443 Constraint 182 399 12.8240 16.0299 24.0449 79.4761 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 259 421 7.0821 8.8527 13.2790 79.3366 Constraint 210 429 9.2166 11.5207 17.2810 79.3366 Constraint 259 341 11.0268 13.7834 20.6752 79.3021 Constraint 285 412 9.1489 11.4361 17.1542 79.2806 Constraint 242 330 12.7833 15.9791 23.9687 79.2152 Constraint 285 355 9.6324 12.0404 18.0607 79.0758 Constraint 259 404 10.2098 12.7623 19.1434 78.9631 Constraint 161 297 13.9721 17.4651 26.1976 78.9048 Constraint 161 292 12.3803 15.4753 23.2130 78.9048 Constraint 161 272 13.2272 16.5340 24.8011 78.9048 Constraint 210 399 10.3534 12.9418 19.4127 78.8646 Constraint 210 341 12.3263 15.4078 23.1118 78.7314 Constraint 210 421 5.9785 7.4732 11.2097 78.6385 Constraint 182 421 9.1384 11.4230 17.1344 78.6385 Constraint 292 412 8.8172 11.0215 16.5323 78.5597 Constraint 279 341 8.7088 10.8860 16.3290 78.5094 Constraint 272 341 11.2548 14.0685 21.1027 78.5094 Constraint 267 341 11.0384 13.7980 20.6970 78.5094 Constraint 242 429 8.3095 10.3869 15.5804 78.3910 Constraint 242 421 5.1199 6.3998 9.5997 78.3910 Constraint 322 404 12.6266 15.7832 23.6749 78.3514 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 176 421 11.2097 14.0122 21.0183 78.3386 Constraint 259 350 10.0788 12.5985 18.8978 78.3081 Constraint 221 341 12.0222 15.0278 22.5416 78.3023 Constraint 242 404 8.2394 10.2992 15.4488 78.2988 Constraint 182 429 12.5624 15.7030 23.5545 78.0820 Constraint 292 355 11.0112 13.7640 20.6459 78.0595 Constraint 259 399 9.3808 11.7260 17.5890 77.8807 Constraint 201 330 14.0070 17.5087 26.2631 77.5025 Constraint 314 435 11.4413 14.3017 21.4525 77.4754 Constraint 292 435 11.3350 14.1688 21.2532 77.3703 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 259 429 10.6781 13.3476 20.0214 77.3364 Constraint 169 330 12.9885 16.2356 24.3535 77.2069 Constraint 303 442 12.9349 16.1686 24.2529 77.0890 Constraint 267 399 12.7295 15.9119 23.8678 77.0880 Constraint 330 399 11.8276 14.7845 22.1767 76.9691 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 272 399 13.7079 17.1348 25.7022 76.6832 Constraint 279 421 11.6264 14.5330 21.7996 76.5620 Constraint 210 412 8.0753 10.0941 15.1412 76.5453 Constraint 182 412 11.6663 14.5829 21.8743 76.5453 Constraint 128 297 9.2039 11.5049 17.2573 76.5309 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 272 10.0640 12.5799 18.8699 76.5309 Constraint 128 259 10.6591 13.3239 19.9858 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 303 10.4289 13.0361 19.5541 76.5309 Constraint 104 297 8.7699 10.9623 16.4435 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 285 11.7606 14.7007 22.0511 76.5309 Constraint 104 272 11.5604 14.4505 21.6758 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 279 412 12.8178 16.0223 24.0334 76.4877 Constraint 210 435 9.2240 11.5300 17.2949 76.3539 Constraint 259 412 6.7206 8.4008 12.6012 76.2453 Constraint 242 399 8.2377 10.2971 15.4456 76.2001 Constraint 128 303 11.5687 14.4609 21.6913 75.9352 Constraint 128 285 11.3400 14.1749 21.2624 75.9352 Constraint 128 279 12.5636 15.7045 23.5567 75.9352 Constraint 341 421 11.4898 14.3622 21.5433 75.8691 Constraint 169 421 8.9878 11.2348 16.8522 75.7127 Constraint 237 421 7.4477 9.3096 13.9644 75.6803 Constraint 201 429 12.4930 15.6162 23.4244 75.6803 Constraint 201 421 9.7702 12.2128 18.3192 75.6803 Constraint 190 421 11.1614 13.9518 20.9276 75.6803 Constraint 128 267 12.6240 15.7801 23.6701 75.6352 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 104 242 11.4981 14.3726 21.5589 75.5853 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 136 297 11.7726 14.7157 22.0736 75.5603 Constraint 136 292 10.8565 13.5706 20.3559 75.5603 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 272 421 10.4808 13.1010 19.6515 75.5457 Constraint 267 421 10.5227 13.1533 19.7300 75.5457 Constraint 279 350 9.1911 11.4889 17.2334 75.5152 Constraint 272 350 11.5500 14.4375 21.6562 75.5152 Constraint 182 350 11.5408 14.4261 21.6391 75.5152 Constraint 250 421 8.7290 10.9113 16.3670 75.5018 Constraint 169 429 10.9802 13.7253 20.5879 75.4127 Constraint 297 442 12.0617 15.0771 22.6157 75.3701 Constraint 285 435 12.7063 15.8828 23.8243 75.3701 Constraint 221 429 11.6945 14.6182 21.9273 75.3386 Constraint 221 421 7.8416 9.8020 14.7031 75.3386 Constraint 210 350 12.0371 15.0464 22.5696 75.3082 Constraint 242 412 4.3429 5.4286 8.1429 75.2997 Constraint 303 404 12.8912 16.1140 24.1710 75.2742 Constraint 221 404 12.2923 15.3654 23.0481 75.2463 Constraint 279 355 11.9254 14.9067 22.3601 75.0685 Constraint 292 442 8.3884 10.4854 15.7282 75.0205 Constraint 285 442 10.7034 13.3792 20.0688 75.0205 Constraint 259 442 8.2727 10.3409 15.5113 75.0205 Constraint 210 442 5.4866 6.8583 10.2874 75.0205 Constraint 182 442 9.7964 12.2455 18.3682 75.0205 Constraint 350 429 12.6638 15.8298 23.7446 74.8711 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 104 279 12.7519 15.9399 23.9098 74.7437 Constraint 355 429 12.5629 15.7036 23.5554 74.6225 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 237 404 10.5337 13.1671 19.7507 74.5717 Constraint 272 412 11.8147 14.7683 22.1525 74.4688 Constraint 267 412 10.6206 13.2758 19.9137 74.4688 Constraint 303 429 12.5917 15.7396 23.6094 74.4680 Constraint 297 429 12.9984 16.2480 24.3720 74.4680 Constraint 314 442 9.8550 12.3187 18.4781 74.4230 Constraint 242 350 11.4726 14.3408 21.5111 74.3626 Constraint 259 435 10.3546 12.9432 19.4148 74.3537 Constraint 161 322 12.4471 15.5588 23.3382 74.2406 Constraint 237 399 11.3347 14.1684 21.2526 74.1874 Constraint 221 399 11.4108 14.2635 21.3953 74.1457 Constraint 242 355 12.7917 15.9896 23.9843 74.1253 Constraint 242 442 5.0966 6.3707 9.5561 74.0749 Constraint 250 399 10.9015 13.6269 20.4403 74.0089 Constraint 237 429 9.6363 12.0454 18.0681 73.8931 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 297 12.1073 15.1341 22.7012 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 237 9.7652 12.2065 18.3097 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 297 12.5651 15.7064 23.5596 73.8727 Constraint 113 292 11.4170 14.2712 21.4068 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 104 190 11.6819 14.6023 21.9035 73.8727 Constraint 242 435 7.1243 8.9054 13.3581 73.6212 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 237 412 6.9422 8.6777 13.0166 73.5871 Constraint 201 412 11.0577 13.8221 20.7332 73.5871 Constraint 190 412 12.4721 15.5901 23.3852 73.5871 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 161 237 10.5828 13.2285 19.8427 73.4098 Constraint 250 412 6.2222 7.7777 11.6665 73.4086 Constraint 322 435 13.0828 16.3535 24.5302 73.3820 Constraint 169 412 11.3719 14.2149 21.3223 73.3195 Constraint 176 412 13.3127 16.6409 24.9613 73.2454 Constraint 221 412 8.6476 10.8094 16.2142 73.2453 Constraint 136 272 12.9388 16.1735 24.2602 73.1671 Constraint 259 355 11.5361 14.4201 21.6302 73.0707 Constraint 322 442 10.8070 13.5087 20.2631 73.0506 Constraint 226 421 9.8794 12.3493 18.5239 72.6803 Constraint 250 404 9.8798 12.3497 18.5246 72.6060 Constraint 267 350 10.3356 12.9194 19.3792 72.6034 Constraint 136 221 12.1229 15.1536 22.7304 72.5603 Constraint 350 412 11.7764 14.7205 22.0807 71.9592 Constraint 237 435 7.5949 9.4936 14.2404 71.9085 Constraint 250 435 9.4344 11.7930 17.6895 71.7300 Constraint 221 435 11.2444 14.0555 21.0832 71.5668 Constraint 104 259 12.0443 15.0554 22.5831 71.5403 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 272 10.8873 13.6091 20.4137 71.4434 Constraint 96 259 9.8491 12.3114 18.4671 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 303 12.2685 15.3357 23.0035 71.4377 Constraint 88 297 12.0961 15.1201 22.6802 71.4377 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 88 182 11.5724 14.4655 21.6983 71.4377 Constraint 122 272 13.0946 16.3682 24.5523 71.3017 Constraint 190 341 14.3122 17.8903 26.8355 71.2362 Constraint 176 442 9.9076 12.3845 18.5768 71.1401 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 303 382 12.1960 15.2450 22.8675 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 292 391 7.9484 9.9355 14.9032 71.1209 Constraint 292 382 11.5404 14.4255 21.6383 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 285 382 10.2339 12.7924 19.1885 71.1209 Constraint 210 355 13.9539 17.4424 26.1637 71.0522 Constraint 341 412 13.6712 17.0890 25.6335 71.0322 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 113 314 10.8516 13.5645 20.3467 70.9608 Constraint 113 190 14.0391 17.5489 26.3234 70.8727 Constraint 128 226 10.2451 12.8064 19.2096 70.8727 Constraint 122 221 11.0976 13.8720 20.8080 70.8727 Constraint 96 279 11.8742 14.8427 22.2640 70.8477 Constraint 96 267 12.1787 15.2234 22.8351 70.8477 Constraint 279 442 13.4987 16.8733 25.3100 70.7900 Constraint 279 399 13.3052 16.6315 24.9473 70.6942 Constraint 237 442 4.4317 5.5396 8.3094 70.5751 Constraint 96 242 8.7861 10.9826 16.4739 70.4979 Constraint 272 442 11.1233 13.9042 20.8562 70.4404 Constraint 267 442 11.7218 14.6523 21.9784 70.4404 Constraint 250 442 8.0056 10.0069 15.0104 70.3965 Constraint 122 242 9.8082 12.2603 18.3904 70.3561 Constraint 128 429 9.9404 12.4255 18.6383 70.3317 Constraint 104 429 11.4047 14.2559 21.3838 70.3317 Constraint 169 442 7.0968 8.8710 13.3065 70.3075 Constraint 221 442 7.8447 9.8058 14.7087 70.2333 Constraint 259 382 9.3157 11.6446 17.4669 70.1228 Constraint 201 399 14.1062 17.6327 26.4491 70.0846 Constraint 136 226 13.3731 16.7164 25.0746 69.9020 Constraint 303 375 12.3813 15.4766 23.2149 69.8228 Constraint 292 375 12.7174 15.8968 23.8451 69.8228 Constraint 285 375 11.6796 14.5995 21.8993 69.8228 Constraint 201 435 11.3410 14.1763 21.2644 69.8153 Constraint 226 399 13.7296 17.1620 25.7430 69.7845 Constraint 104 330 8.1029 10.1287 15.1930 69.7387 Constraint 250 429 11.1667 13.9584 20.9376 69.6212 Constraint 169 435 10.7163 13.3954 20.0931 69.5477 Constraint 221 350 11.4644 14.3305 21.4958 69.5153 Constraint 169 399 13.2379 16.5474 24.8211 69.5100 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 182 435 13.1714 16.4643 24.6964 69.3783 Constraint 96 350 9.5716 11.9645 17.9467 69.3563 Constraint 96 341 10.1789 12.7236 19.0855 69.3563 Constraint 104 435 13.7761 17.2201 25.8301 69.3154 Constraint 104 421 9.3511 11.6889 17.5334 69.3154 Constraint 122 259 12.0738 15.0923 22.6384 69.3015 Constraint 161 242 12.8532 16.0666 24.0998 69.2806 Constraint 161 421 12.8166 16.0208 24.0311 68.9723 Constraint 242 375 11.0519 13.8148 20.7222 68.8772 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 226 412 9.3911 11.7388 17.6082 68.7999 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 96 190 11.4113 14.2641 21.3962 68.7852 Constraint 104 341 10.4366 13.0457 19.5686 68.7632 Constraint 128 330 10.5075 13.1344 19.7016 68.7223 Constraint 226 404 13.4199 16.7749 25.1623 68.5717 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 201 442 7.2475 9.0593 13.5890 68.4818 Constraint 190 442 10.0612 12.5765 18.8647 68.4818 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 176 13.1397 16.4246 24.6369 68.4377 Constraint 259 391 6.2539 7.8174 11.7260 68.3856 Constraint 210 382 12.4592 15.5740 23.3610 68.3856 Constraint 136 429 13.0116 16.2645 24.3967 68.3448 Constraint 279 391 10.9033 13.6291 20.4437 68.3280 Constraint 122 226 12.0924 15.1155 22.6733 68.3017 Constraint 144 322 11.4516 14.3145 21.4717 68.2719 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 267 355 12.5144 15.6430 23.4644 68.1517 Constraint 297 449 11.9999 14.9999 22.4999 68.0790 Constraint 182 355 13.9897 17.4871 26.2307 68.0523 Constraint 113 221 13.3456 16.6820 25.0230 67.8823 Constraint 104 226 13.4526 16.8157 25.2236 67.8823 Constraint 221 355 13.6987 17.1233 25.6850 67.8565 Constraint 259 375 11.5306 14.4133 21.6199 67.8226 Constraint 136 314 11.5861 14.4826 21.7239 67.6287 Constraint 128 435 11.1307 13.9134 20.8701 67.5965 Constraint 128 421 7.6399 9.5499 14.3248 67.5965 Constraint 88 161 13.0809 16.3511 24.5267 67.5095 Constraint 242 382 8.4363 10.5453 15.8180 67.4583 Constraint 242 391 6.0876 7.6095 11.4143 67.4400 Constraint 176 429 13.9028 17.3785 26.0678 67.4348 Constraint 237 382 11.6357 14.5447 21.8170 67.3876 Constraint 210 391 9.2117 11.5147 17.2720 67.3876 Constraint 182 391 11.4808 14.3510 21.5266 67.3876 Constraint 104 237 11.9965 14.9956 22.4934 67.3540 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 297 360 9.7917 12.2396 18.3594 67.2518 Constraint 292 368 10.8154 13.5192 20.2788 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 259 368 9.3375 11.6718 17.5077 67.2518 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 421 5.9672 7.4590 11.1885 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 292 449 8.9764 11.2205 16.8308 67.0627 Constraint 285 449 11.9712 14.9640 22.4459 67.0627 Constraint 210 449 6.3314 7.9142 11.8713 67.0627 Constraint 182 449 9.9070 12.3837 18.5756 67.0627 Constraint 169 404 13.7730 17.2163 25.8244 67.0266 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 104 399 11.6909 14.6136 21.9205 66.8561 Constraint 226 435 10.9845 13.7306 20.5959 66.8153 Constraint 226 429 12.7350 15.9188 23.8782 66.7997 Constraint 88 341 12.1322 15.1653 22.7479 66.7795 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 88 330 10.9722 13.7153 20.5729 66.7387 Constraint 136 421 11.4126 14.2658 21.3987 66.6259 Constraint 104 350 11.3125 14.1407 21.2110 66.6210 Constraint 128 399 11.4168 14.2710 21.4065 66.4513 Constraint 113 429 11.1949 13.9936 20.9904 66.3571 Constraint 161 429 13.9934 17.4917 26.2376 66.3500 Constraint 104 442 11.0401 13.8001 20.7002 66.2630 Constraint 292 360 8.0550 10.0687 15.1031 66.2355 Constraint 237 391 9.6347 12.0434 18.0651 66.1731 Constraint 314 449 9.3186 11.6482 17.4724 66.1652 Constraint 153 292 11.1345 13.9181 20.8772 66.1384 Constraint 153 237 9.0638 11.3297 16.9946 66.1384 Constraint 242 449 7.8332 9.7916 14.6873 66.1171 Constraint 122 330 12.6316 15.7895 23.6842 66.0641 Constraint 88 221 12.8589 16.0737 24.1105 65.8667 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 96 226 12.1570 15.1963 22.7945 65.7852 Constraint 88 201 13.2169 16.5211 24.7817 65.7795 Constraint 267 391 9.3796 11.7244 17.5867 65.6110 Constraint 210 375 13.8805 17.3507 26.0260 65.6084 Constraint 96 435 10.5164 13.1455 19.7182 65.5215 Constraint 96 412 9.6791 12.0989 18.1483 65.5215 Constraint 128 412 11.0519 13.8149 20.7224 65.5032 Constraint 104 412 13.2236 16.5294 24.7942 65.5032 Constraint 226 442 7.4966 9.3707 14.0561 65.4818 Constraint 221 382 12.2254 15.2818 22.9227 65.4039 Constraint 122 303 13.2984 16.6231 24.9346 65.3114 Constraint 259 449 10.2764 12.8455 19.2683 65.2755 Constraint 176 449 10.4335 13.0419 19.5629 65.2755 Constraint 144 292 12.6718 15.8398 23.7597 65.2721 Constraint 250 375 12.4364 15.5455 23.3183 65.2671 Constraint 128 442 7.7734 9.7168 14.5752 65.2649 Constraint 88 429 8.7777 10.9721 16.4582 65.2385 Constraint 267 404 13.5590 16.9488 25.4231 65.1929 Constraint 169 449 6.9142 8.6427 12.9641 65.1215 Constraint 96 355 10.5335 13.1669 19.7503 65.0664 Constraint 122 429 8.0099 10.0124 15.0186 64.9382 Constraint 122 421 7.5370 9.4212 14.1319 64.9382 Constraint 113 421 10.3493 12.9367 19.4050 64.9382 Constraint 122 435 10.1300 12.6625 18.9937 64.6382 Constraint 113 435 13.6856 17.1070 25.6604 64.6382 Constraint 272 391 11.1216 13.9020 20.8530 64.5947 Constraint 259 360 8.2129 10.2661 15.3991 64.5166 Constraint 210 360 10.2468 12.8085 19.2127 64.5166 Constraint 136 237 11.6148 14.5185 21.7777 64.4923 Constraint 267 368 11.6605 14.5756 21.8634 64.4590 Constraint 221 391 8.9070 11.1337 16.7006 64.3876 Constraint 250 391 7.6952 9.6190 14.4286 64.2508 Constraint 250 382 8.8522 11.0653 16.5979 64.2508 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 136 442 11.2976 14.1220 21.1830 63.6986 Constraint 136 435 14.3455 17.9319 26.8979 63.6369 Constraint 303 449 12.7532 15.9415 23.9122 63.5943 Constraint 242 368 9.4875 11.8593 17.7890 63.5710 Constraint 242 360 8.5295 10.6619 15.9929 63.5710 Constraint 88 421 8.4637 10.5796 15.8694 63.5196 Constraint 88 412 12.2405 15.3007 22.9510 63.5196 Constraint 88 404 11.8194 14.7743 22.1614 63.5196 Constraint 176 435 13.7863 17.2329 25.8493 63.5110 Constraint 161 442 10.4831 13.1039 19.6558 63.4584 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 113 442 11.6628 14.5785 21.8677 63.3048 Constraint 237 360 12.1154 15.1442 22.7164 63.3022 Constraint 210 368 12.7740 15.9675 23.9512 63.3022 Constraint 182 360 11.4909 14.3637 21.5455 63.3022 Constraint 113 303 13.7260 17.1574 25.7362 63.2181 Constraint 201 391 12.7106 15.8882 23.8323 63.1732 Constraint 190 391 12.9663 16.2079 24.3118 63.1732 Constraint 96 442 8.3633 10.4541 15.6811 63.1717 Constraint 153 226 11.1331 13.9164 20.8746 63.1384 Constraint 153 242 10.7659 13.4574 20.1861 63.0996 Constraint 113 330 11.6851 14.6064 21.9096 63.0755 Constraint 322 449 9.2477 11.5597 17.3395 63.0739 Constraint 136 242 12.3931 15.4914 23.2372 63.0513 Constraint 104 461 10.6271 13.2839 19.9259 63.0253 Constraint 113 237 12.4188 15.5235 23.2852 62.8919 Constraint 104 267 13.4752 16.8440 25.2660 62.8803 Constraint 226 391 11.2568 14.0710 21.1065 62.8731 Constraint 122 412 11.0817 13.8522 20.7783 62.8450 Constraint 122 404 11.7453 14.6816 22.0224 62.8450 Constraint 113 399 12.5040 15.6299 23.4449 62.7767 Constraint 88 350 11.6153 14.5191 21.7786 62.7690 Constraint 279 360 10.6745 13.3432 20.0147 62.7401 Constraint 237 449 7.6898 9.6122 14.4183 62.6173 Constraint 201 449 8.9463 11.1829 16.7744 62.6173 Constraint 190 449 11.7207 14.6509 21.9764 62.6173 Constraint 122 442 8.1662 10.2078 15.3117 62.6067 Constraint 88 435 12.0179 15.0224 22.5336 62.5032 Constraint 136 303 13.9178 17.3972 26.0958 62.4009 Constraint 88 242 10.8569 13.5711 20.3567 62.3481 Constraint 104 449 8.7198 10.8998 16.3496 62.3045 Constraint 144 297 14.3355 17.9194 26.8791 62.2815 Constraint 144 221 13.5667 16.9583 25.4375 62.2815 Constraint 221 449 9.7716 12.2145 18.3217 62.2755 Constraint 128 404 12.7646 15.9558 23.9337 62.2481 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 360 435 10.9784 13.7230 20.5845 62.0836 Constraint 88 285 12.5896 15.7370 23.6056 62.0793 Constraint 272 355 13.9352 17.4191 26.1286 62.0746 Constraint 267 360 10.4452 13.0565 19.5848 61.7237 Constraint 250 368 10.4329 13.0411 19.5617 61.6799 Constraint 250 360 10.9151 13.6439 20.4658 61.6799 Constraint 221 360 10.3388 12.9235 19.3853 61.5166 Constraint 153 322 10.9338 13.6673 20.5009 61.4742 Constraint 153 314 12.7448 15.9310 23.8965 61.4742 Constraint 153 297 13.2675 16.5843 24.8765 61.4742 Constraint 161 449 9.9768 12.4710 18.7065 61.3580 Constraint 267 382 12.0801 15.1001 22.6502 61.3409 Constraint 210 461 10.1838 12.7297 19.0946 61.3064 Constraint 128 467 12.1673 15.2091 22.8136 61.3064 Constraint 128 461 8.7765 10.9707 16.4560 61.3064 Constraint 128 449 5.9601 7.4502 11.1752 61.3064 Constraint 88 259 12.3856 15.4820 23.2229 61.2935 Constraint 182 404 14.0260 17.5325 26.2988 61.2823 Constraint 350 449 13.1442 16.4303 24.6455 61.1987 Constraint 88 442 10.9689 13.7112 20.5667 61.1698 Constraint 122 399 10.1622 12.7028 19.0542 61.0578 Constraint 128 341 12.4006 15.5008 23.2512 61.0540 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 360 442 10.5877 13.2346 19.8519 60.7501 Constraint 104 467 13.4420 16.8024 25.2037 60.7107 Constraint 272 360 11.6403 14.5503 21.8255 60.5093 Constraint 96 250 12.2479 15.3099 22.9649 60.4627 Constraint 330 449 13.0915 16.3644 24.5466 60.4347 Constraint 144 421 11.3932 14.2415 21.3622 60.4326 Constraint 136 461 11.1461 13.9326 20.8989 60.3358 Constraint 136 449 9.2408 11.5510 17.3265 60.3358 Constraint 237 368 13.1375 16.4219 24.6329 60.3022 Constraint 201 360 14.1534 17.6918 26.5377 60.3022 Constraint 226 360 13.5174 16.8967 25.3451 60.3022 Constraint 221 368 12.2008 15.2510 22.8765 60.3022 Constraint 404 467 8.3910 10.4888 15.7332 60.2295 Constraint 96 449 6.1214 7.6518 11.4777 60.2295 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 136 330 11.7697 14.7122 22.0683 60.1610 Constraint 297 368 12.5481 15.6851 23.5276 60.0484 Constraint 272 449 12.3659 15.4574 23.1862 59.9117 Constraint 136 259 13.7432 17.1789 25.7684 59.9035 Constraint 144 237 11.4153 14.2692 21.4038 59.8621 Constraint 122 285 12.6998 15.8747 23.8121 59.7383 Constraint 113 449 8.6070 10.7587 16.1380 59.6462 Constraint 201 404 14.1240 17.6550 26.4825 59.5827 Constraint 161 435 13.6912 17.1140 25.6711 59.4696 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 297 11.5214 14.4017 21.6026 59.4573 Constraint 80 292 11.3872 14.2340 21.3511 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 80 182 11.9628 14.9535 22.4303 59.4573 Constraint 80 169 12.2715 15.3394 23.0090 59.4573 Constraint 169 461 10.1111 12.6389 18.9584 59.3652 Constraint 322 382 13.3123 16.6404 24.9606 59.2200 Constraint 96 467 10.5020 13.1274 19.6912 59.2132 Constraint 96 461 7.7945 9.7431 14.6146 59.2132 Constraint 88 355 11.5970 14.4962 21.7444 59.0778 Constraint 144 429 11.4419 14.3024 21.4536 59.0374 Constraint 322 461 11.7030 14.6288 21.9432 59.0366 Constraint 153 421 9.4927 11.8659 17.7988 58.9412 Constraint 190 435 13.7852 17.2315 25.8472 58.8233 Constraint 113 242 12.1847 15.2308 22.8462 58.7927 Constraint 128 250 12.2828 15.3535 23.0302 58.6641 Constraint 144 226 13.9872 17.4839 26.2259 58.6498 Constraint 122 461 6.0480 7.5600 11.3400 58.6481 Constraint 122 449 4.9350 6.1687 9.2531 58.6481 Constraint 113 461 9.2294 11.5368 17.3052 58.6481 Constraint 153 272 12.9048 16.1310 24.1965 58.6375 Constraint 330 412 13.9231 17.4039 26.1058 58.5925 Constraint 279 382 13.7708 17.2135 25.8203 58.5041 Constraint 399 467 8.8077 11.0096 16.5144 58.4423 Constraint 113 341 13.5392 16.9240 25.3861 58.3957 Constraint 314 461 11.5149 14.3937 21.5905 58.3946 Constraint 292 461 12.1906 15.2383 22.8574 58.3946 Constraint 161 461 12.1350 15.1688 22.7532 58.3946 Constraint 80 330 8.8597 11.0746 16.6119 58.2658 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 226 382 13.5106 16.8882 25.3324 58.0879 Constraint 104 355 12.5954 15.7442 23.6163 58.0597 Constraint 153 404 13.6982 17.1227 25.6841 57.8460 Constraint 153 399 13.3173 16.6466 24.9699 57.8460 Constraint 88 237 12.1227 15.1534 22.7301 57.7987 Constraint 250 449 11.0051 13.7564 20.6346 57.7746 Constraint 226 449 10.4918 13.1147 19.6721 57.5240 Constraint 122 467 9.0496 11.3120 16.9680 57.4567 Constraint 237 375 14.0221 17.5277 26.2915 57.3253 Constraint 113 412 14.1758 17.7197 26.5796 57.2720 Constraint 279 368 12.2695 15.3368 23.0053 57.2555 Constraint 88 449 7.6931 9.6164 14.4245 57.2112 Constraint 176 391 14.0142 17.5178 26.2767 57.1841 Constraint 80 350 11.3656 14.2070 21.3105 57.1495 Constraint 267 449 13.4851 16.8564 25.2846 56.9998 Constraint 153 435 10.0615 12.5769 18.8654 56.8479 Constraint 153 429 9.8914 12.3643 18.5464 56.8479 Constraint 153 412 11.8498 14.8122 22.2183 56.8479 Constraint 144 435 12.7441 15.9301 23.8951 56.8479 Constraint 210 467 12.9976 16.2470 24.3704 56.5193 Constraint 122 341 13.9488 17.4360 26.1540 56.4977 Constraint 242 461 10.7287 13.4108 20.1162 56.4804 Constraint 350 442 13.4121 16.7652 25.1477 56.4704 Constraint 128 350 12.2854 15.3568 23.0352 56.4164 Constraint 382 449 11.9282 14.9103 22.3654 56.3613 Constraint 297 382 13.8948 17.3685 26.0527 56.2951 Constraint 88 461 7.4148 9.2686 13.9028 56.2132 Constraint 96 391 9.1738 11.4673 17.2009 56.1134 Constraint 96 382 12.4647 15.5809 23.3713 56.1134 Constraint 113 285 14.2167 17.7709 26.6564 55.6871 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 144 442 10.4807 13.1009 19.6514 55.5145 Constraint 80 176 13.8056 17.2569 25.8854 55.4410 Constraint 80 161 14.1441 17.6801 26.5202 55.4410 Constraint 182 461 13.1677 16.4596 24.6894 55.3946 Constraint 421 480 10.4981 13.1226 19.6839 55.3408 Constraint 136 285 14.1971 17.7464 26.6196 55.2995 Constraint 144 461 8.9194 11.1493 16.7239 55.1406 Constraint 144 449 8.2009 10.2511 15.3766 55.1406 Constraint 80 421 11.0253 13.7817 20.6725 55.0475 Constraint 88 467 9.1462 11.4328 17.1492 55.0217 Constraint 80 429 12.0165 15.0206 22.5310 54.9475 Constraint 80 399 11.6889 14.6111 21.9166 54.8724 Constraint 250 350 12.6714 15.8392 23.7588 54.8378 Constraint 201 461 12.6930 15.8662 23.7993 54.7678 Constraint 96 375 11.8957 14.8697 22.3045 54.5990 Constraint 161 259 14.4698 18.0872 27.1308 54.3853 Constraint 113 272 14.3768 17.9710 26.9565 54.3793 Constraint 113 467 11.5843 14.4804 21.7205 54.2900 Constraint 272 382 14.2511 17.8139 26.7209 54.2898 Constraint 314 473 11.1432 13.9290 20.8935 54.2042 Constraint 210 473 12.2964 15.3705 23.0558 54.2042 Constraint 122 350 13.3443 16.6804 25.0205 54.1871 Constraint 144 314 13.0099 16.2624 24.3936 54.1375 Constraint 153 467 11.9314 14.9143 22.3714 53.9491 Constraint 144 467 12.3119 15.3899 23.0848 53.9491 Constraint 122 250 12.9122 16.1402 24.2104 53.9016 Constraint 237 461 10.9286 13.6607 20.4911 53.8222 Constraint 314 480 13.2582 16.5727 24.8591 53.8200 Constraint 104 404 14.0282 17.5352 26.3028 53.6752 Constraint 375 449 12.3317 15.4147 23.1220 53.6444 Constraint 221 461 13.4552 16.8190 25.2285 53.6074 Constraint 80 355 11.9530 14.9413 22.4119 53.4583 Constraint 128 473 12.2382 15.2977 22.9466 53.3946 Constraint 176 461 13.7882 17.2353 25.8529 53.3014 Constraint 96 360 7.7682 9.7103 14.5654 53.2425 Constraint 169 391 12.7710 15.9637 23.9455 53.1859 Constraint 128 391 11.6498 14.5622 21.8433 53.1618 Constraint 122 391 11.9677 14.9596 22.4394 53.1618 Constraint 104 391 12.4408 15.5510 23.3264 53.1618 Constraint 153 259 12.7706 15.9632 23.9448 53.0645 Constraint 330 442 13.8943 17.3679 26.0519 53.0267 Constraint 113 259 13.7623 17.2028 25.8042 53.0033 Constraint 242 467 12.7812 15.9765 23.9647 53.0006 Constraint 176 341 14.5794 18.2243 27.3364 52.9912 Constraint 80 242 13.5356 16.9195 25.3793 52.9386 Constraint 360 449 10.3388 12.9234 19.3852 52.7923 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 355 449 13.7022 17.1277 25.6916 52.6277 Constraint 314 467 13.4294 16.7868 25.1802 52.5579 Constraint 88 391 11.6642 14.5802 21.8704 52.3926 Constraint 412 473 8.5329 10.6662 15.9993 52.3177 Constraint 404 473 5.4961 6.8701 10.3051 52.3177 Constraint 104 360 11.0353 13.7941 20.6912 52.2261 Constraint 279 449 14.2876 17.8596 26.7893 52.1891 Constraint 322 473 12.8230 16.0288 24.0431 52.1110 Constraint 96 473 9.7923 12.2404 18.3606 52.1110 Constraint 96 368 11.5086 14.3857 21.5786 52.0280 Constraint 80 442 13.6411 17.0514 25.5771 51.9952 Constraint 399 480 8.5086 10.6358 15.9537 51.9334 Constraint 169 467 13.4393 16.7991 25.1986 51.9198 Constraint 153 461 7.8545 9.8182 14.7273 51.8559 Constraint 153 449 5.6971 7.1214 10.6821 51.8559 Constraint 412 480 12.2954 15.3692 23.0538 51.5286 Constraint 272 368 13.5608 16.9510 25.4265 51.5203 Constraint 242 473 11.2675 14.0844 21.1266 51.4715 Constraint 190 360 13.8831 17.3538 26.0307 51.3121 Constraint 144 242 12.4021 15.5027 23.2540 51.3008 Constraint 368 449 12.8053 16.0066 24.0099 51.0734 Constraint 144 412 14.4074 18.0093 27.0139 50.8480 Constraint 272 429 13.7218 17.1523 25.7284 50.8314 Constraint 122 473 10.1174 12.6468 18.9702 50.7364 Constraint 113 473 12.7108 15.8885 23.8328 50.7364 Constraint 96 480 11.1551 13.9439 20.9159 50.7287 Constraint 88 272 14.0229 17.5286 26.2929 50.5925 Constraint 399 473 5.0505 6.3131 9.4697 50.5306 Constraint 267 435 13.7586 17.1983 25.7974 50.4890 Constraint 169 360 13.4778 16.8473 25.2709 50.3150 Constraint 88 360 9.7651 12.2064 18.3096 50.2425 Constraint 122 480 10.9696 13.7120 20.5680 49.9473 Constraint 391 461 11.5202 14.4002 21.6004 49.6070 Constraint 330 429 12.9961 16.2452 24.3677 49.5988 Constraint 404 480 9.1584 11.4480 17.1721 49.5142 Constraint 128 360 11.3729 14.2162 21.3243 49.2928 Constraint 122 360 11.2695 14.0869 21.1303 49.2928 Constraint 113 360 12.7345 15.9181 23.8772 49.2928 Constraint 272 435 13.9655 17.4569 26.1853 49.1885 Constraint 259 461 13.1236 16.4045 24.6068 49.1065 Constraint 153 250 13.5443 16.9303 25.3955 48.8558 Constraint 190 350 13.8247 17.2808 25.9212 48.8365 Constraint 355 473 11.8557 14.8197 22.2295 48.7692 Constraint 88 480 9.3489 11.6861 17.5292 48.7267 Constraint 292 473 12.7214 15.9017 23.8526 48.6312 Constraint 104 473 12.9809 16.2261 24.3392 48.6312 Constraint 113 350 13.4335 16.7919 25.1878 48.6140 Constraint 161 314 14.5625 18.2031 27.3046 48.4116 Constraint 128 355 14.0586 17.5732 26.3598 48.2722 Constraint 267 429 13.6956 17.1194 25.6792 48.2711 Constraint 80 461 10.8516 13.5645 20.3468 48.2366 Constraint 80 449 10.5703 13.2129 19.8194 48.2366 Constraint 267 375 13.9608 17.4510 26.1764 47.9994 Constraint 88 473 9.3919 11.7399 17.6098 47.9196 Constraint 80 285 13.2595 16.5744 24.8616 47.8939 Constraint 391 467 12.3405 15.4256 23.1383 47.8881 Constraint 382 467 12.6484 15.8105 23.7158 47.8881 Constraint 382 461 12.7298 15.9123 23.8684 47.8881 Constraint 221 375 13.8934 17.3667 26.0501 47.6372 Constraint 113 480 12.5342 15.6677 23.5016 47.3763 Constraint 80 467 13.1770 16.4712 24.7068 47.0452 Constraint 375 467 11.3363 14.1703 21.2555 46.8718 Constraint 375 461 12.1905 15.2381 22.8571 46.8718 Constraint 259 473 12.8836 16.1045 24.1568 46.8440 Constraint 190 429 13.9906 17.4882 26.2323 46.7972 Constraint 128 480 13.6007 17.0009 25.5014 46.6152 Constraint 144 399 13.9582 17.4477 26.1716 46.5826 Constraint 80 360 10.9690 13.7112 20.5668 46.5210 Constraint 153 391 13.9830 17.4787 26.2181 46.3810 Constraint 226 461 14.0806 17.6008 26.4012 46.2065 Constraint 88 375 12.4702 15.5877 23.3816 46.0260 Constraint 80 259 13.9606 17.4508 26.1762 45.8937 Constraint 237 467 13.1757 16.4696 24.7044 45.8802 Constraint 237 350 13.9538 17.4423 26.1635 45.8479 Constraint 250 355 14.0884 17.6105 26.4158 45.7612 Constraint 136 467 14.1686 17.7108 26.5662 45.5206 Constraint 176 350 14.6059 18.2574 27.3860 45.4948 Constraint 104 480 13.8891 17.3614 26.0421 45.2587 Constraint 169 473 13.3141 16.6426 24.9639 45.1633 Constraint 144 330 14.6211 18.2764 27.4146 44.6180 Constraint 368 461 13.8137 17.2671 25.9007 44.3008 Constraint 360 461 11.3768 14.2210 21.3316 44.3008 Constraint 237 473 12.8529 16.0661 24.0992 44.1858 Constraint 285 473 13.7936 17.2420 25.8631 44.0073 Constraint 350 435 14.2753 17.8442 26.7662 43.4600 Constraint 153 473 12.7612 15.9515 23.9273 43.3762 Constraint 88 382 13.7361 17.1701 25.7551 43.0342 Constraint 350 473 12.3251 15.4063 23.1095 42.9304 Constraint 182 368 14.0939 17.6174 26.4261 42.5204 Constraint 80 473 13.0108 16.2635 24.3952 42.4500 Constraint 80 480 12.7190 15.8987 23.8481 42.0452 Constraint 88 368 12.8273 16.0342 24.0512 41.7361 Constraint 341 429 12.9347 16.1683 24.2525 41.3919 Constraint 368 467 13.8704 17.3380 26.0071 41.3008 Constraint 360 467 12.1334 15.1668 22.7502 41.3008 Constraint 391 480 12.4265 15.5331 23.2997 41.1725 Constraint 382 480 12.6900 15.8625 23.7938 41.1725 Constraint 341 449 13.8618 17.3273 25.9909 40.8705 Constraint 391 473 9.0502 11.3127 16.9690 40.7859 Constraint 136 399 13.8759 17.3449 26.0173 40.6259 Constraint 375 480 10.0903 12.6129 18.9194 40.1744 Constraint 80 272 14.7490 18.4362 27.6543 40.0378 Constraint 80 391 13.2841 16.6051 24.9076 40.0317 Constraint 80 221 13.9811 17.4763 26.2145 39.8923 Constraint 153 285 14.1717 17.7146 26.5719 39.8656 Constraint 221 473 14.1614 17.7018 26.5527 39.8537 Constraint 226 350 14.3157 17.8946 26.8419 39.8479 Constraint 169 350 14.0388 17.5485 26.3228 39.8462 Constraint 272 404 14.1257 17.6571 26.4857 39.7942 Constraint 382 473 9.0358 11.2947 16.9421 39.7696 Constraint 375 473 7.0909 8.8636 13.2955 39.7696 Constraint 113 404 14.2159 17.7699 26.6549 39.7127 Constraint 122 355 13.7237 17.1546 25.7319 39.6255 Constraint 250 473 13.3808 16.7260 25.0891 39.3431 Constraint 355 480 12.8541 16.0676 24.1014 39.3373 Constraint 226 368 14.1470 17.6838 26.5256 39.3363 Constraint 285 461 14.3954 17.9942 26.9913 39.2203 Constraint 122 382 14.1204 17.6505 26.4758 39.0275 Constraint 136 412 14.3457 17.9322 26.8982 38.8282 Constraint 355 442 14.2282 17.7853 26.6779 38.8057 Constraint 153 480 13.8820 17.3524 26.0287 38.8033 Constraint 122 375 13.8295 17.2869 25.9303 38.7457 Constraint 113 391 13.7175 17.1469 25.7203 38.5987 Constraint 144 473 13.1661 16.4576 24.6864 38.5773 Constraint 322 467 13.9603 17.4504 26.1756 38.4666 Constraint 421 489 9.0995 11.3744 17.0615 38.3582 Constraint 368 480 13.0563 16.3204 24.4805 37.6035 Constraint 360 480 11.4857 14.3571 21.5357 37.6035 Constraint 250 461 13.3819 16.7274 25.0911 37.4549 Constraint 153 360 14.3008 17.8761 26.8141 37.3909 Constraint 429 489 6.4851 8.1064 12.1596 37.3601 Constraint 237 330 14.6844 18.3555 27.5333 37.2497 Constraint 368 473 9.9385 12.4231 18.6347 37.1987 Constraint 360 473 8.8089 11.0112 16.5167 37.1987 Constraint 136 341 13.6465 17.0581 25.5871 36.6730 Constraint 176 360 14.3451 17.9314 26.8971 36.5762 Constraint 412 489 11.7543 14.6929 22.0393 36.2650 Constraint 182 382 14.4758 18.0948 27.1421 36.1608 Constraint 322 480 13.9095 17.3869 26.0803 35.8921 Constraint 242 480 14.0443 17.5553 26.3330 35.8508 Constraint 314 489 11.7738 14.7172 22.0758 35.8393 Constraint 210 489 12.3674 15.4593 23.1889 35.8393 Constraint 169 489 12.7824 15.9780 23.9670 35.8393 Constraint 136 489 12.8929 16.1161 24.1742 35.8393 Constraint 128 489 10.7683 13.4604 20.1905 35.8393 Constraint 104 489 11.2055 14.0069 21.0104 35.8393 Constraint 144 480 13.3163 16.6454 24.9681 35.8130 Constraint 399 489 8.8894 11.1118 16.6677 35.6717 Constraint 190 399 14.4589 18.0736 27.1104 35.1133 Constraint 435 497 8.8198 11.0247 16.5371 35.0892 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 421 497 6.3341 7.9177 11.8765 35.0892 Constraint 122 368 14.0180 17.5226 26.2838 34.7295 Constraint 292 467 14.2431 17.8038 26.7057 34.4794 Constraint 303 497 12.8278 16.0347 24.0521 34.2847 Constraint 297 497 13.2006 16.5008 24.7512 34.2847 Constraint 330 497 12.7120 15.8899 23.8349 34.2104 Constraint 144 259 14.3674 17.9593 26.9389 34.1989 Constraint 136 279 14.6039 18.2549 27.3823 34.1574 Constraint 341 497 13.0055 16.2568 24.3853 33.9104 Constraint 201 350 14.7727 18.4658 27.6988 33.8467 Constraint 322 489 12.0090 15.0112 22.5168 33.7461 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 128 497 9.6045 12.0057 18.0085 33.5683 Constraint 104 497 9.6958 12.1198 18.1796 33.5683 Constraint 404 489 9.8426 12.3033 18.4549 33.5480 Constraint 399 497 5.7426 7.1782 10.7673 33.4007 Constraint 314 497 8.7608 10.9510 16.4265 33.2683 Constraint 292 497 10.7892 13.4866 20.2298 33.2683 Constraint 210 497 10.3590 12.9488 19.4232 33.2683 Constraint 182 497 12.8840 16.1050 24.1574 33.2683 Constraint 169 497 11.7828 14.7286 22.0928 33.2683 Constraint 122 489 7.9151 9.8939 14.8408 33.1810 Constraint 113 489 9.9260 12.4075 18.6113 33.1810 Constraint 292 489 13.2728 16.5910 24.8865 33.0025 Constraint 412 497 9.1618 11.4522 17.1783 32.9959 Constraint 404 497 7.8585 9.8232 14.7347 32.9959 Constraint 303 473 14.1208 17.6510 26.4764 32.7946 Constraint 128 382 14.2023 17.7529 26.6294 32.6094 Constraint 242 497 10.4719 13.0898 19.6348 32.3228 Constraint 221 497 12.8175 16.0219 24.0328 32.2683 Constraint 355 497 10.0466 12.5583 18.8374 32.1914 Constraint 350 497 11.1960 13.9950 20.9925 32.1914 Constraint 355 461 13.7327 17.1659 25.7489 32.0458 Constraint 153 489 11.3241 14.1551 21.2327 31.9666 Constraint 144 489 10.7861 13.4827 20.2240 31.9666 Constraint 341 404 12.4505 15.5632 23.3447 31.9074 Constraint 297 404 12.4289 15.5361 23.3042 31.8872 Constraint 128 368 14.1387 17.6734 26.5101 31.7404 Constraint 104 368 14.0424 17.5530 26.3294 31.7404 Constraint 104 250 14.0606 17.5758 26.3637 31.6828 Constraint 322 497 9.5148 11.8935 17.8403 31.4751 Constraint 96 497 6.2746 7.8432 11.7648 31.4751 Constraint 285 497 12.7022 15.8778 23.8166 31.1751 Constraint 259 497 11.9198 14.8997 22.3496 31.1751 Constraint 88 497 5.6890 7.1113 10.6669 31.1751 Constraint 122 497 7.5491 9.4364 14.1546 30.9101 Constraint 113 355 13.6433 17.0541 25.5811 30.7888 Constraint 136 360 13.7889 17.2362 25.8543 30.7698 Constraint 169 341 14.2506 17.8133 26.7199 30.6915 Constraint 201 497 14.0095 17.5119 26.2679 30.6101 Constraint 113 497 9.4270 11.7838 17.6757 30.6101 Constraint 80 412 14.2955 17.8694 26.8041 30.1103 Constraint 144 272 14.6518 18.3148 27.4721 30.0966 Constraint 122 267 13.6581 17.0726 25.6089 29.8022 Constraint 297 375 13.4087 16.7609 25.1414 29.8006 Constraint 153 497 10.9887 13.7358 20.6037 29.3957 Constraint 144 497 11.0996 13.8745 20.8117 29.3957 Constraint 88 190 13.4549 16.8186 25.2278 29.3294 Constraint 136 473 14.1173 17.6466 26.4699 29.1732 Constraint 350 480 13.6311 17.0388 25.5583 28.9017 Constraint 80 368 14.1638 17.7047 26.5570 28.5638 Constraint 80 497 9.3774 11.7218 17.5826 28.4674 Constraint 80 489 10.3060 12.8825 19.3238 28.4674 Constraint 250 467 14.6749 18.3436 27.5154 28.4659 Constraint 435 511 11.3719 14.2149 21.3224 28.4346 Constraint 429 511 8.1092 10.1365 15.2047 28.4346 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 242 489 12.3850 15.4812 23.2218 28.3384 Constraint 161 412 14.2674 17.8343 26.7515 28.1262 Constraint 136 497 11.6137 14.5171 21.7757 27.9953 Constraint 297 435 12.6463 15.8078 23.7117 27.8151 Constraint 350 461 13.4984 16.8730 25.3095 27.6872 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 122 279 14.2254 17.7817 26.6726 26.8797 Constraint 250 341 14.1552 17.6940 26.5410 26.7169 Constraint 412 511 11.3448 14.1811 21.2716 26.7157 Constraint 80 279 14.7320 18.4150 27.6224 26.6608 Constraint 355 489 12.3598 15.4497 23.1746 26.3547 Constraint 250 497 13.2671 16.5838 24.8757 26.3416 Constraint 226 330 14.5074 18.1342 27.2013 26.2623 Constraint 355 435 14.3935 17.9918 26.9877 26.1682 Constraint 399 511 6.6596 8.3245 12.4867 26.1224 Constraint 355 467 13.8694 17.3367 26.0051 26.0554 Constraint 322 511 12.2991 15.3738 23.0608 25.9157 Constraint 96 511 9.5650 11.9562 17.9343 25.9157 Constraint 404 511 8.9594 11.1993 16.7990 25.7176 Constraint 237 497 12.1425 15.1782 22.7672 25.6801 Constraint 237 489 13.8484 17.3105 25.9658 25.6801 Constraint 136 391 14.2395 17.7993 26.6990 25.6388 Constraint 314 511 10.7236 13.4045 20.1068 25.6157 Constraint 292 511 13.6966 17.1208 25.6812 25.6157 Constraint 210 511 13.7717 17.2146 25.8218 25.6157 Constraint 104 511 12.9430 16.1788 24.2682 25.6157 Constraint 88 511 8.2671 10.3339 15.5008 25.6157 Constraint 355 511 9.6326 12.0407 18.0610 25.2986 Constraint 350 511 11.9267 14.9084 22.3626 25.2986 Constraint 391 489 12.0758 15.0948 22.6422 25.2062 Constraint 128 375 14.6019 18.2523 27.3785 25.0466 Constraint 80 511 11.4172 14.2715 21.4073 24.8061 Constraint 242 511 12.7588 15.9485 23.9228 24.6701 Constraint 210 480 14.2913 17.8641 26.7962 24.5985 Constraint 259 467 14.4621 18.0777 27.1165 24.5592 Constraint 303 435 12.0702 15.0877 22.6315 24.4401 Constraint 80 201 14.3436 17.9294 26.8942 24.2307 Constraint 350 489 13.5189 16.8986 25.3479 23.9290 Constraint 80 404 14.0754 17.5943 26.3914 23.8457 Constraint 136 350 13.7632 17.2040 25.8061 23.8124 Constraint 391 497 9.1276 11.4095 17.1142 23.6561 Constraint 153 330 14.0992 17.6240 26.4361 23.5476 Constraint 176 497 14.4321 18.0402 27.0603 23.4809 Constraint 360 497 8.1803 10.2254 15.3380 23.3561 Constraint 382 489 13.1178 16.3973 24.5960 23.1918 Constraint 375 489 11.4736 14.3421 21.5131 23.1918 Constraint 122 511 10.6044 13.2554 19.8832 22.9575 Constraint 330 404 12.5928 15.7410 23.6115 22.8797 Constraint 279 404 13.1914 16.4893 24.7339 22.5213 Constraint 341 442 13.7675 17.2093 25.8140 22.4391 Constraint 391 511 10.6548 13.3185 19.9778 22.2720 Constraint 585 651 12.2057 15.2572 22.8858 22.1681 Constraint 382 497 10.4700 13.0875 19.6312 21.9372 Constraint 201 382 14.4483 18.0604 27.0905 21.8831 Constraint 161 497 13.8277 17.2847 25.9270 21.8259 Constraint 375 497 8.9030 11.1287 16.6931 21.6372 Constraint 368 497 10.3320 12.9150 19.3725 21.6372 Constraint 368 511 10.7660 13.4574 20.1862 20.9739 Constraint 237 341 14.3826 17.9783 26.9675 20.8241 Constraint 279 429 12.9342 16.1678 24.2517 20.7590 Constraint 368 489 13.4290 16.7862 25.1793 20.6209 Constraint 360 489 10.7311 13.4139 20.1209 20.6209 Constraint 599 668 11.6152 14.5190 21.7785 20.5939 Constraint 259 489 13.9867 17.4834 26.2251 20.3417 Constraint 382 511 11.1877 13.9847 20.9770 20.2576 Constraint 176 399 14.4900 18.1124 27.1687 20.1329 Constraint 128 511 12.8132 16.0164 24.0247 20.0427 Constraint 375 511 8.3529 10.4411 15.6617 19.9576 Constraint 360 511 8.8341 11.0427 16.5640 19.9576 Constraint 88 250 11.4169 14.2711 21.4067 19.7970 Constraint 435 519 12.5598 15.6997 23.5496 19.7765 Constraint 429 519 9.6616 12.0770 18.1156 19.7765 Constraint 421 519 10.8762 13.5952 20.3928 19.7765 Constraint 303 599 12.9509 16.1886 24.2829 19.7095 Constraint 590 657 11.6598 14.5748 21.8621 19.6092 Constraint 80 375 13.3908 16.7385 25.1077 19.5638 Constraint 104 375 14.0575 17.5719 26.3579 19.4757 Constraint 279 375 13.3406 16.6757 25.0136 19.4345 Constraint 190 461 14.7765 18.4707 27.7060 19.3058 Constraint 585 657 11.9140 14.8925 22.3388 19.2044 Constraint 557 629 11.8700 14.8374 22.2562 19.1335 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 113 226 12.8139 16.0173 24.0260 18.8021 Constraint 442 519 12.9829 16.2286 24.3429 18.4430 Constraint 161 489 14.1541 17.6926 26.5389 18.3989 Constraint 330 511 13.9034 17.3792 26.0688 18.3842 Constraint 297 461 12.9724 16.2155 24.3233 18.3678 Constraint 341 511 13.1856 16.4820 24.7230 18.2823 Constraint 449 519 10.5041 13.1301 19.6952 18.1430 Constraint 552 629 12.7584 15.9480 23.9220 18.1354 Constraint 122 519 10.5240 13.1551 19.7326 17.9576 Constraint 113 519 11.6697 14.5871 21.8807 17.9576 Constraint 330 461 13.5170 16.8963 25.3444 17.8386 Constraint 226 497 14.4395 18.0494 27.0741 17.6834 Constraint 590 668 12.9979 16.2474 24.3711 17.6246 Constraint 604 676 11.5457 14.4321 21.6482 17.6035 Constraint 399 519 9.2768 11.5960 17.3940 17.4643 Constraint 113 511 11.4206 14.2758 21.4137 17.3844 Constraint 182 489 13.5792 16.9740 25.4609 17.3497 Constraint 303 604 12.6279 15.7849 23.6773 17.2913 Constraint 96 519 9.8146 12.2683 18.4025 17.2576 Constraint 314 613 12.4476 15.5596 23.3393 17.0849 Constraint 391 527 10.6418 13.3023 19.9534 16.9929 Constraint 153 267 14.3675 17.9594 26.9391 16.9805 Constraint 544 622 12.7554 15.9442 23.9163 16.9604 Constraint 322 519 12.3831 15.4789 23.2184 16.9576 Constraint 314 519 11.7766 14.7207 22.0810 16.9576 Constraint 128 519 13.1267 16.4084 24.6126 16.9576 Constraint 104 519 12.6142 15.7677 23.6516 16.9576 Constraint 88 519 8.0895 10.1118 15.1677 16.9576 Constraint 577 644 12.4144 15.5180 23.2770 16.9280 Constraint 314 622 12.6536 15.8170 23.7255 16.9067 Constraint 585 668 13.3361 16.6702 25.0052 16.8710 Constraint 144 360 14.3791 17.9739 26.9608 16.8287 Constraint 285 511 14.1726 17.7158 26.5736 16.7790 Constraint 259 511 13.9652 17.4565 26.1848 16.7790 Constraint 190 404 14.6893 18.3616 27.5424 16.7476 Constraint 88 226 11.6823 14.6028 21.9043 16.7074 Constraint 360 527 9.4450 11.8062 17.7093 16.6929 Constraint 341 604 12.4046 15.5057 23.2586 16.6115 Constraint 136 267 14.9308 18.6635 27.9953 16.5885 Constraint 242 604 11.1631 13.9539 20.9308 16.5734 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 399 527 8.1919 10.2399 15.3599 16.1833 Constraint 153 511 13.6836 17.1044 25.6567 16.1700 Constraint 144 511 13.2801 16.6001 24.9002 16.1700 Constraint 80 519 10.9430 13.6788 20.5182 16.1480 Constraint 544 613 12.7019 15.8774 23.8161 16.0901 Constraint 599 676 12.2759 15.3448 23.0172 16.0459 Constraint 404 519 11.1843 13.9804 20.9706 16.0432 Constraint 429 604 8.2338 10.2923 15.4384 15.9828 Constraint 144 527 11.6628 14.5785 21.8678 15.9576 Constraint 322 604 9.6891 12.1114 18.1671 15.9067 Constraint 435 527 10.5512 13.1890 19.7835 15.7785 Constraint 429 527 7.8000 9.7499 14.6249 15.7785 Constraint 421 527 8.1705 10.2131 15.3196 15.7785 Constraint 412 527 10.8851 13.6064 20.4096 15.7785 Constraint 404 527 10.4794 13.0993 19.6490 15.7785 Constraint 314 629 11.9118 14.8897 22.3346 15.6922 Constraint 242 599 10.1332 12.6665 18.9998 15.5965 Constraint 399 604 9.8861 12.3577 18.5365 15.5851 Constraint 303 511 13.7817 17.2272 25.8408 15.4455 Constraint 442 527 10.3979 12.9974 19.4961 15.4431 Constraint 404 604 9.6054 12.0068 18.0102 15.4067 Constraint 404 622 10.5186 13.1482 19.7223 15.3945 Constraint 404 613 10.4816 13.1020 19.6530 15.3945 Constraint 421 604 9.1381 11.4227 17.1340 15.1288 Constraint 314 604 9.5524 11.9404 17.9107 15.0970 Constraint 412 519 12.7437 15.9296 23.8944 15.0576 Constraint 303 461 13.4182 16.7728 25.1592 15.0261 Constraint 421 629 10.0693 12.5866 18.8799 14.9829 Constraint 421 622 10.6083 13.2604 19.8906 14.9829 Constraint 412 622 11.2623 14.0778 21.1168 14.9829 Constraint 375 527 11.1600 13.9499 20.9249 14.9740 Constraint 355 519 10.9704 13.7130 20.5695 14.9739 Constraint 153 527 11.9263 14.9079 22.3619 14.9576 Constraint 136 527 12.7812 15.9765 23.9648 14.9576 Constraint 122 527 8.4902 10.6128 15.9192 14.9576 Constraint 113 527 9.8762 12.3452 18.5178 14.9576 Constraint 314 599 9.6142 12.0177 18.0266 14.9297 Constraint 201 341 14.6458 18.3072 27.4609 14.8350 Constraint 449 535 10.9344 13.6680 20.5020 14.8266 Constraint 267 497 14.3126 17.8908 26.8362 14.7686 Constraint 391 604 11.1924 13.9905 20.9857 14.7279 Constraint 360 604 11.2072 14.0089 21.0134 14.6994 Constraint 391 613 12.6228 15.7785 23.6677 14.5920 Constraint 429 535 9.4476 11.8095 17.7143 14.4620 Constraint 421 535 9.3680 11.7101 17.5651 14.4620 Constraint 429 622 9.8179 12.2724 18.4085 14.4099 Constraint 429 613 9.0409 11.3012 16.9517 14.4099 Constraint 412 613 12.0352 15.0440 22.5660 14.4099 Constraint 404 629 10.0764 12.5955 18.8933 14.4067 Constraint 182 473 12.6553 15.8192 23.7287 14.3474 Constraint 480 599 10.1010 12.6262 18.9394 14.3104 Constraint 341 473 13.2440 16.5550 24.8325 14.2675 Constraint 128 527 10.5538 13.1922 19.7883 14.2577 Constraint 96 527 7.7305 9.6632 14.4947 14.2577 Constraint 122 535 11.6157 14.5196 21.7794 14.2141 Constraint 161 330 14.9588 18.6985 28.0478 14.1758 Constraint 449 527 7.9650 9.9562 14.9343 14.1450 Constraint 442 535 12.3818 15.4772 23.2158 14.1266 Constraint 571 636 12.1017 15.1271 22.6907 14.0630 Constraint 590 676 13.9344 17.4180 26.1270 14.0613 Constraint 544 629 13.2309 16.5387 24.8080 14.0576 Constraint 399 613 10.5055 13.1318 19.6977 14.0122 Constraint 429 629 9.4424 11.8030 17.7045 13.9951 Constraint 412 629 10.7439 13.4298 20.1447 13.9951 Constraint 421 613 10.6867 13.3583 20.0375 13.9829 Constraint 375 519 11.3528 14.1910 21.2866 13.9577 Constraint 360 519 10.5757 13.2196 19.8294 13.9577 Constraint 210 527 10.9866 13.7332 20.5999 13.9577 Constraint 169 527 12.3848 15.4810 23.2214 13.9577 Constraint 88 527 7.0190 8.7738 13.1607 13.9577 Constraint 322 599 9.9047 12.3809 18.5714 13.9297 Constraint 292 599 10.4744 13.0930 19.6396 13.9297 Constraint 285 599 12.1307 15.1633 22.7450 13.9297 Constraint 259 599 11.4431 14.3038 21.4557 13.9297 Constraint 391 622 11.9794 14.9742 22.4614 13.9252 Constraint 382 613 12.8469 16.0586 24.0879 13.9252 Constraint 368 613 13.2888 16.6110 24.9166 13.9252 Constraint 272 497 14.2489 17.8111 26.7167 13.8619 Constraint 461 535 9.7397 12.1747 18.2620 13.8285 Constraint 88 279 12.8829 16.1036 24.1554 13.8052 Constraint 330 527 11.6381 14.5477 21.8215 13.6405 Constraint 391 535 10.0147 12.5184 18.7776 13.5832 Constraint 391 629 11.7446 14.6807 22.0211 13.5104 Constraint 341 571 13.1781 16.4727 24.7090 13.5103 Constraint 350 604 14.3368 17.9210 26.8816 13.4760 Constraint 461 604 10.2357 12.7947 19.1920 13.4599 Constraint 429 599 8.6711 10.8389 16.2583 13.4329 Constraint 242 629 10.7283 13.4103 20.1155 13.3750 Constraint 350 467 13.5452 16.9315 25.3972 13.3699 Constraint 435 535 11.7051 14.6314 21.9470 13.3668 Constraint 613 687 12.0902 15.1128 22.6692 13.3429 Constraint 330 435 13.3938 16.7423 25.1134 13.3234 Constraint 360 535 8.5833 10.7291 16.0937 13.2832 Constraint 391 519 11.9113 14.8891 22.3336 13.2721 Constraint 330 489 12.8986 16.1232 24.1849 13.2532 Constraint 210 535 12.6666 15.8332 23.7498 13.2141 Constraint 128 535 12.5075 15.6344 23.4516 13.2141 Constraint 577 657 11.1525 13.9406 20.9109 13.2139 Constraint 144 404 14.2439 17.8049 26.7074 13.1811 Constraint 360 599 9.8853 12.3566 18.5349 13.1658 Constraint 297 577 11.1433 13.9292 20.8938 13.1515 Constraint 314 590 11.0100 13.7625 20.6437 13.1323 Constraint 322 590 11.7127 14.6409 21.9613 13.1201 Constraint 128 544 13.4276 16.7844 25.1767 13.1093 Constraint 104 544 12.8053 16.0066 24.0099 13.1093 Constraint 322 613 11.3170 14.1462 21.2193 13.0945 Constraint 557 636 12.5667 15.7083 23.5625 13.0803 Constraint 480 604 8.3464 10.4330 15.6495 13.0738 Constraint 435 604 10.5279 13.1599 19.7399 13.0104 Constraint 80 237 12.7064 15.8830 23.8245 13.0071 Constraint 435 622 11.0190 13.7737 20.6606 12.9983 Constraint 399 622 10.6760 13.3449 20.0174 12.9958 Constraint 412 604 10.2213 12.7767 19.1650 12.9951 Constraint 382 622 11.9740 14.9676 22.4513 12.9089 Constraint 375 613 11.0879 13.8599 20.7898 12.9089 Constraint 360 613 12.3834 15.4792 23.2188 12.9089 Constraint 113 250 12.6484 15.8105 23.7157 12.8985 Constraint 467 590 11.2274 14.0342 21.0513 12.8870 Constraint 461 599 10.2161 12.7702 19.1553 12.8870 Constraint 461 590 11.8877 14.8596 22.2894 12.8870 Constraint 473 590 10.4974 13.1218 19.6827 12.8851 Constraint 449 585 12.7729 15.9661 23.9491 12.8748 Constraint 242 622 10.7150 13.3938 20.0906 12.7901 Constraint 237 629 9.8326 12.2908 18.4362 12.7798 Constraint 399 535 7.5685 9.4606 14.1909 12.7736 Constraint 122 604 12.1232 15.1540 22.7310 12.6547 Constraint 322 527 8.6280 10.7850 16.1775 12.6242 Constraint 314 527 8.5478 10.6848 16.0272 12.6242 Constraint 292 527 10.9137 13.6421 20.4632 12.6242 Constraint 104 527 9.8768 12.3460 18.5189 12.6242 Constraint 237 599 9.9216 12.4020 18.6030 12.6003 Constraint 210 599 8.9713 11.2142 16.8213 12.6003 Constraint 210 604 8.3354 10.4192 15.6289 12.5830 Constraint 421 599 8.0975 10.1219 15.1828 12.5790 Constraint 272 461 14.3823 17.9778 26.9667 12.5643 Constraint 622 698 11.9334 14.9168 22.3751 12.5471 Constraint 399 629 10.2922 12.8653 19.2979 12.5258 Constraint 341 599 12.6564 15.8205 23.7307 12.4789 Constraint 461 613 12.4180 15.5226 23.2838 12.4600 Constraint 412 535 10.9853 13.7316 20.5974 12.3688 Constraint 473 629 8.4392 10.5490 15.8235 12.3648 Constraint 473 613 9.9214 12.4018 18.6026 12.3648 Constraint 341 527 11.5615 14.4519 21.6778 12.3594 Constraint 604 687 10.9956 13.7446 20.6168 12.3429 Constraint 303 577 10.1209 12.6511 18.9766 12.3419 Constraint 279 577 11.5019 14.3773 21.5660 12.3419 Constraint 279 599 13.0627 16.3283 24.4925 12.3019 Constraint 382 527 11.7056 14.6320 21.9480 12.2740 Constraint 421 585 12.1338 15.1672 22.7508 12.2278 Constraint 104 382 13.8095 17.2619 25.8928 12.2019 Constraint 571 651 13.2980 16.6225 24.9338 12.1853 Constraint 391 599 9.0141 11.2677 16.9015 12.1780 Constraint 144 519 12.6299 15.7874 23.6811 12.1701 Constraint 279 435 13.0956 16.3695 24.5543 12.1594 Constraint 613 698 13.1900 16.4875 24.7313 12.1423 Constraint 382 535 11.1169 13.8961 20.8441 12.1373 Constraint 272 577 12.8029 16.0036 24.0054 12.1352 Constraint 182 577 11.8656 14.8320 22.2480 12.1352 Constraint 297 604 11.0261 13.7827 20.6740 12.1230 Constraint 88 535 10.1420 12.6775 19.0163 12.1209 Constraint 435 585 12.5941 15.7426 23.6140 12.0940 Constraint 429 585 10.3639 12.9548 19.4322 12.0940 Constraint 552 636 13.6532 17.0665 25.5997 12.0822 Constraint 429 590 9.5592 11.9490 17.9235 12.0787 Constraint 96 552 13.2560 16.5700 24.8550 12.0161 Constraint 435 629 10.3485 12.9356 19.4034 12.0105 Constraint 442 629 10.3145 12.8932 19.3398 12.0085 Constraint 161 250 15.0464 18.8079 28.2119 11.9820 Constraint 421 636 12.7747 15.9684 23.9526 11.9820 Constraint 480 622 10.5285 13.1606 19.7409 11.9805 Constraint 368 527 11.0976 13.8719 20.8079 11.9740 Constraint 341 535 11.8770 14.8463 22.2694 11.9497 Constraint 382 604 11.5134 14.3918 21.5876 11.9374 Constraint 375 604 10.3701 12.9626 19.4439 11.9374 Constraint 368 604 11.8619 14.8273 22.2410 11.9374 Constraint 292 604 9.3760 11.7200 17.5799 11.9163 Constraint 259 604 11.5392 14.4239 21.6359 11.9163 Constraint 322 622 12.1207 15.1509 22.7263 11.9080 Constraint 442 599 11.3104 14.1380 21.2070 11.8924 Constraint 473 585 8.9783 11.2229 16.8343 11.8870 Constraint 467 585 9.3127 11.6409 17.4613 11.8870 Constraint 461 585 10.3285 12.9106 19.3659 11.8870 Constraint 297 535 13.6361 17.0452 25.5678 11.8807 Constraint 292 535 11.8932 14.8665 22.2998 11.8807 Constraint 182 535 14.3072 17.8840 26.8260 11.8807 Constraint 104 535 12.4370 15.5463 23.3194 11.8807 Constraint 80 527 9.4109 11.7636 17.6454 11.8146 Constraint 449 599 10.9491 13.6863 20.5295 11.7815 Constraint 104 552 11.9633 14.9542 22.4312 11.7759 Constraint 599 687 10.8009 13.5011 20.2516 11.7699 Constraint 577 668 13.7662 17.2077 25.8115 11.7602 Constraint 303 629 14.0263 17.5329 26.2994 11.7019 Constraint 341 577 10.3349 12.9186 19.3779 11.7007 Constraint 322 552 13.0170 16.2713 24.4069 11.6673 Constraint 88 599 11.4019 14.2524 21.3785 11.6548 Constraint 88 604 11.3614 14.2017 21.3026 11.6548 Constraint 412 599 9.0098 11.2623 16.8934 11.5912 Constraint 480 629 8.9723 11.2154 16.8231 11.5757 Constraint 604 698 11.3667 14.2084 21.3126 11.5471 Constraint 303 585 12.8375 16.0468 24.0702 11.5425 Constraint 341 557 13.2351 16.5439 24.8159 11.5276 Constraint 480 590 9.9864 12.4830 18.7246 11.5027 Constraint 237 355 14.3823 17.9779 26.9668 11.4849 Constraint 404 585 10.8767 13.5959 20.3938 11.4451 Constraint 404 599 7.7848 9.7310 14.5966 11.4298 Constraint 404 590 9.2115 11.5144 17.2717 11.4298 Constraint 435 613 11.0684 13.8355 20.7533 11.4253 Constraint 322 585 10.9783 13.7228 20.5842 11.3974 Constraint 314 585 11.2719 14.0898 21.1347 11.3974 Constraint 467 629 9.5932 11.9915 17.9872 11.3667 Constraint 467 622 11.1944 13.9930 20.9896 11.3667 Constraint 467 613 10.3868 12.9835 19.4752 11.3667 Constraint 461 629 10.8956 13.6195 20.4292 11.3667 Constraint 473 604 7.2151 9.0188 13.5282 11.3648 Constraint 190 382 14.9773 18.7217 28.0825 11.3558 Constraint 449 604 11.3329 14.1661 21.2491 11.3546 Constraint 557 644 13.8247 17.2809 25.9214 11.3351 Constraint 330 599 12.4660 15.5825 23.3737 11.3330 Constraint 285 577 11.7768 14.7210 22.0815 11.3256 Constraint 267 577 13.4095 16.7618 25.1427 11.3256 Constraint 330 473 14.1411 17.6764 26.5146 11.2690 Constraint 182 467 13.0122 16.2653 24.3979 11.2612 Constraint 382 519 12.9525 16.1907 24.2860 11.2577 Constraint 404 535 9.4640 11.8300 17.7449 11.2228 Constraint 201 473 13.5836 16.9795 25.4692 11.1861 Constraint 182 375 13.9569 17.4461 26.1692 11.1814 Constraint 629 706 11.0510 13.8137 20.7206 11.1424 Constraint 622 706 12.9742 16.2177 24.3266 11.1424 Constraint 535 613 12.4416 15.5520 23.3280 11.1285 Constraint 535 604 11.5048 14.3810 21.5714 11.1285 Constraint 242 535 11.4165 14.2707 21.4060 11.1209 Constraint 242 527 10.5146 13.1432 19.7148 11.1209 Constraint 96 535 9.9876 12.4845 18.7267 11.1209 Constraint 368 599 9.7359 12.1698 18.2548 11.1065 Constraint 391 590 10.1335 12.6669 19.0003 11.0321 Constraint 382 599 9.8086 12.2608 18.3911 11.0321 Constraint 382 590 10.7665 13.4581 20.1871 11.0321 Constraint 368 590 10.7074 13.3842 20.0763 11.0321 Constraint 442 604 9.9066 12.3833 18.5749 10.9983 Constraint 535 622 12.2755 15.3444 23.0166 10.9826 Constraint 480 613 8.9412 11.1765 16.7647 10.9825 Constraint 368 519 12.4636 15.5795 23.3692 10.9577 Constraint 330 590 13.6890 17.1113 25.6669 10.9281 Constraint 292 622 11.7373 14.6717 22.0075 10.9080 Constraint 182 622 12.0167 15.0209 22.5314 10.9080 Constraint 590 687 13.6183 17.0228 25.5343 10.9032 Constraint 421 552 12.3863 15.4828 23.2243 10.8870 Constraint 250 330 14.8956 18.6194 27.9292 10.8855 Constraint 69 449 9.7738 12.2173 18.3259 10.8517 Constraint 69 435 12.5818 15.7272 23.5908 10.8517 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 279 13.6813 17.1016 25.6524 10.8517 Constraint 69 272 14.2551 17.8189 26.7283 10.8517 Constraint 69 267 14.0334 17.5418 26.3127 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 69 136 12.2217 15.2771 22.9157 10.8517 Constraint 88 267 11.1444 13.9306 20.8958 10.8052 Constraint 375 535 8.2071 10.2589 15.3883 10.8038 Constraint 368 535 9.0647 11.3308 16.9962 10.8038 Constraint 355 535 8.1668 10.2085 15.3127 10.8038 Constraint 350 535 9.9144 12.3929 18.5894 10.8038 Constraint 330 535 12.3228 15.4035 23.1053 10.8038 Constraint 350 519 11.4708 14.3386 21.5078 10.8037 Constraint 467 599 8.9105 11.1381 16.7071 10.7937 Constraint 473 599 7.6739 9.5923 14.3885 10.7919 Constraint 303 489 12.7951 15.9938 23.9907 10.7787 Constraint 285 489 14.0064 17.5080 26.2620 10.7787 Constraint 497 599 11.8179 14.7724 22.1586 10.7647 Constraint 350 577 13.2797 16.5997 24.8995 10.7045 Constraint 341 585 11.4938 14.3672 21.5508 10.6843 Constraint 355 527 9.1328 11.4160 17.1240 10.6405 Constraint 350 527 10.0492 12.5615 18.8422 10.6405 Constraint 651 729 12.3755 15.4694 23.2041 10.6254 Constraint 644 720 12.1090 15.1362 22.7044 10.6254 Constraint 201 604 9.4531 11.8164 17.7246 10.5869 Constraint 176 604 9.9726 12.4657 18.6986 10.5869 Constraint 330 577 10.8608 13.5760 20.3640 10.5547 Constraint 330 571 12.8145 16.0182 24.0273 10.5384 Constraint 303 571 12.6250 15.7813 23.6720 10.5384 Constraint 128 552 13.1461 16.4326 24.6490 10.5361 Constraint 330 585 12.1508 15.1885 22.7827 10.5262 Constraint 279 604 12.9739 16.2174 24.3261 10.5081 Constraint 360 629 11.3561 14.1952 21.2927 10.5049 Constraint 297 622 14.0796 17.5995 26.3992 10.5032 Constraint 182 613 12.2953 15.3692 23.0537 10.5032 Constraint 176 622 11.5716 14.4645 21.6967 10.5032 Constraint 176 613 12.5095 15.6368 23.4552 10.5032 Constraint 355 604 12.8951 16.1189 24.1783 10.4990 Constraint 201 368 14.4376 18.0470 27.0704 10.4851 Constraint 297 552 12.1297 15.1621 22.7431 10.4768 Constraint 421 590 9.7208 12.1511 18.2266 10.4452 Constraint 412 590 10.6901 13.3626 20.0439 10.4452 Constraint 144 577 11.4683 14.3354 21.5031 10.4238 Constraint 467 604 7.5563 9.4454 14.1680 10.3667 Constraint 375 599 8.7149 10.8937 16.3405 10.3653 Constraint 473 622 9.0539 11.3174 16.9761 10.3649 Constraint 330 480 13.7139 17.1424 25.7135 10.3565 Constraint 473 636 9.9436 12.4295 18.6442 10.3504 Constraint 467 636 11.0078 13.7597 20.6396 10.3504 Constraint 80 544 13.1099 16.3874 24.5811 10.3113 Constraint 599 698 11.5480 14.4349 21.6524 10.3074 Constraint 449 552 12.0051 15.0064 22.5096 10.2535 Constraint 88 585 11.5241 14.4051 21.6076 10.2500 Constraint 144 250 13.9282 17.4102 26.1153 10.2095 Constraint 571 644 13.6075 17.0094 25.5141 10.1891 Constraint 80 435 13.7075 17.1344 25.7015 10.1818 Constraint 136 511 14.2623 17.8278 26.7417 10.1701 Constraint 604 706 12.8098 16.0122 24.0183 10.1424 Constraint 557 657 13.3991 16.7488 25.1233 10.1267 Constraint 210 629 7.8560 9.8200 14.7300 10.1105 Constraint 480 585 7.2784 9.0980 13.6470 10.0816 Constraint 136 480 13.7660 17.2075 25.8113 10.0803 Constraint 399 599 7.1324 8.9155 13.3732 10.0475 Constraint 399 590 8.6471 10.8089 16.2133 10.0475 Constraint 449 577 11.7088 14.6360 21.9540 10.0407 Constraint 375 590 9.1344 11.4180 17.1270 10.0157 Constraint 360 590 9.7844 12.2305 18.3457 10.0157 Constraint 88 552 11.2892 14.1115 21.1672 9.9798 Constraint 80 552 11.9155 14.8943 22.3415 9.9778 Constraint 382 629 10.7412 13.4265 20.1398 9.9605 Constraint 297 599 11.2182 14.0227 21.0340 9.9394 Constraint 292 590 12.2011 15.2514 22.8771 9.9394 Constraint 360 622 11.4094 14.2617 21.3926 9.9320 Constraint 122 577 11.1647 13.9559 20.9338 9.9263 Constraint 221 604 10.2058 12.7573 19.1359 9.9202 Constraint 210 622 8.3573 10.4466 15.6699 9.9202 Constraint 210 613 9.1312 11.4140 17.1209 9.9202 Constraint 190 604 11.2476 14.0595 21.0893 9.9202 Constraint 182 604 8.8883 11.1104 16.6656 9.9202 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 330 613 13.4424 16.8030 25.2045 9.9025 Constraint 421 544 12.1256 15.1570 22.7355 9.8870 Constraint 88 613 13.3906 16.7382 25.1073 9.8452 Constraint 69 497 5.1329 6.4161 9.6242 9.8353 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 467 10.9775 13.7219 20.5829 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 442 11.6979 14.6224 21.9336 9.8353 Constraint 69 169 13.0591 16.3239 24.4859 9.8353 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 69 144 12.3422 15.4278 23.1417 9.8353 Constraint 657 735 11.3058 14.1323 21.1985 9.7954 Constraint 651 735 12.7198 15.8997 23.8496 9.7954 Constraint 435 590 12.4522 15.5652 23.3478 9.7940 Constraint 360 585 10.5687 13.2108 19.8163 9.7886 Constraint 355 585 12.5478 15.6847 23.5271 9.7886 Constraint 322 535 10.2675 12.8344 19.2515 9.7875 Constraint 314 535 8.6973 10.8716 16.3074 9.7875 Constraint 303 535 12.6698 15.8373 23.7559 9.7875 Constraint 182 527 12.2827 15.3534 23.0301 9.7875 Constraint 201 467 13.0384 16.2979 24.4469 9.7399 Constraint 322 629 10.0994 12.6242 18.9363 9.7057 Constraint 292 629 10.1011 12.6264 18.9396 9.7057 Constraint 259 629 11.7360 14.6700 22.0050 9.7057 Constraint 88 590 12.8798 16.0998 24.1496 9.6548 Constraint 144 535 10.5031 13.1289 19.6934 9.6410 Constraint 511 585 14.0847 17.6059 26.4088 9.6305 Constraint 644 729 13.2539 16.5674 24.8511 9.6273 Constraint 237 604 8.8217 11.0272 16.5408 9.5991 Constraint 480 636 9.0982 11.3728 17.0592 9.5613 Constraint 297 571 13.3881 16.7351 25.1026 9.5384 Constraint 279 571 13.5219 16.9023 25.3535 9.5384 Constraint 272 604 11.4114 14.2643 21.3965 9.5154 Constraint 341 435 12.6891 15.8614 23.7921 9.4656 Constraint 182 552 13.1051 16.3814 24.5720 9.4605 Constraint 429 636 10.6506 13.3133 19.9700 9.4289 Constraint 314 552 12.9738 16.2172 24.3258 9.3836 Constraint 322 544 14.0237 17.5296 26.2945 9.3827 Constraint 330 557 13.2309 16.5387 24.8080 9.3653 Constraint 449 629 10.8969 13.6211 20.4317 9.3546 Constraint 449 622 11.3068 14.1335 21.2003 9.3546 Constraint 449 613 11.9317 14.9146 22.3720 9.3546 Constraint 330 604 10.2537 12.8172 19.2257 9.3195 Constraint 489 599 10.5323 13.1653 19.7480 9.3187 Constraint 136 544 13.4108 16.7635 25.1453 9.2997 Constraint 467 552 11.0322 13.7902 20.6853 9.2555 Constraint 461 552 10.5420 13.1775 19.7662 9.2555 Constraint 461 544 11.7190 14.6487 21.9730 9.2554 Constraint 113 585 12.0859 15.1073 22.6610 9.2500 Constraint 113 552 11.5500 14.4375 21.6562 9.2363 Constraint 144 544 11.7394 14.6743 22.0114 9.2362 Constraint 88 629 12.1291 15.1613 22.7420 9.1785 Constraint 297 473 11.7827 14.7284 22.0926 9.1590 Constraint 355 599 10.5059 13.1323 19.6985 9.1218 Constraint 355 590 11.5297 14.4121 21.6181 9.1218 Constraint 350 599 12.6279 15.7849 23.6774 9.1218 Constraint 221 622 10.9782 13.7228 20.5841 9.1208 Constraint 201 629 7.5621 9.4527 14.1790 9.1105 Constraint 144 585 11.7786 14.7233 22.0849 9.0906 Constraint 489 613 11.8589 14.8237 22.2355 9.0821 Constraint 489 604 10.3677 12.9596 19.4394 9.0821 Constraint 489 577 10.8886 13.6108 20.4161 9.0631 Constraint 480 571 10.7893 13.4866 20.2299 9.0612 Constraint 473 552 10.5132 13.1415 19.7123 9.0469 Constraint 176 544 14.2291 17.7863 26.6795 8.9997 Constraint 153 303 14.2617 17.8272 26.7407 8.9804 Constraint 80 535 11.9608 14.9509 22.4264 8.9778 Constraint 153 350 14.0008 17.5010 26.2515 8.9776 Constraint 144 350 14.3810 17.9763 26.9644 8.9776 Constraint 404 636 10.9809 13.7261 20.5892 8.9596 Constraint 399 636 11.7047 14.6309 21.9464 8.9596 Constraint 375 622 8.5753 10.7192 16.0787 8.9442 Constraint 226 604 11.2602 14.0753 21.1129 8.9324 Constraint 421 657 13.4203 16.7754 25.1631 8.9158 Constraint 285 604 10.8666 13.5833 20.3749 8.9147 Constraint 629 720 11.7344 14.6680 22.0020 8.9027 Constraint 629 713 10.9956 13.7445 20.6167 8.9027 Constraint 622 713 13.0104 16.2631 24.3946 8.9027 Constraint 577 698 13.4519 16.8148 25.2222 8.9027 Constraint 577 687 13.3224 16.6530 24.9794 8.9027 Constraint 461 577 9.6313 12.0391 18.0587 8.8966 Constraint 297 489 11.7847 14.7309 22.0964 8.8807 Constraint 571 657 12.2939 15.3674 23.0511 8.8538 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 242 613 9.5926 11.9908 17.9862 8.7997 Constraint 449 590 12.4550 15.5688 23.3531 8.7817 Constraint 467 651 13.6235 17.0294 25.5441 8.7775 Constraint 467 644 13.2790 16.5988 24.8982 8.7775 Constraint 292 480 12.7918 15.9898 23.9847 8.7747 Constraint 429 552 11.3633 14.2042 21.3062 8.7430 Constraint 429 544 11.7930 14.7412 22.1118 8.7411 Constraint 303 590 13.0635 16.3293 24.4940 8.7372 Constraint 297 590 13.2844 16.6055 24.9082 8.7250 Constraint 322 636 11.3267 14.1583 21.2375 8.7211 Constraint 292 613 11.0384 13.7980 20.6970 8.7160 Constraint 272 622 13.1157 16.3946 24.5919 8.7160 Constraint 190 622 11.5982 14.4977 21.7465 8.7160 Constraint 190 613 13.3991 16.7488 25.1233 8.7160 Constraint 297 629 11.8784 14.8479 22.2719 8.7057 Constraint 221 629 10.0603 12.5754 18.8631 8.7057 Constraint 182 629 9.3341 11.6676 17.5015 8.7057 Constraint 176 629 8.6640 10.8300 16.2450 8.7057 Constraint 221 489 13.0561 16.3202 24.4803 8.6855 Constraint 122 599 11.4063 14.2579 21.3869 8.6644 Constraint 391 585 10.8900 13.6125 20.4188 8.6426 Constraint 382 585 11.7329 14.6662 21.9993 8.6426 Constraint 375 585 10.0254 12.5317 18.7976 8.6426 Constraint 368 585 11.3496 14.1870 21.2805 8.6426 Constraint 153 535 11.1620 13.9524 20.9287 8.6411 Constraint 136 535 12.3045 15.3807 23.0710 8.6411 Constraint 113 535 10.7988 13.4985 20.2477 8.6411 Constraint 210 590 10.3679 12.9599 19.4398 8.6100 Constraint 201 599 8.8273 11.0341 16.5512 8.6100 Constraint 429 577 10.4769 13.0961 19.6441 8.5809 Constraint 421 577 10.7308 13.4135 20.1203 8.5809 Constraint 314 577 8.8295 11.0369 16.5554 8.5785 Constraint 279 585 14.2916 17.8646 26.7968 8.5586 Constraint 303 557 14.0147 17.5184 26.2776 8.5557 Constraint 497 585 11.2464 14.0580 21.0870 8.5503 Constraint 136 552 12.9816 16.2270 24.3405 8.5363 Constraint 122 552 11.2093 14.0116 21.0174 8.5363 Constraint 136 250 14.5846 18.2308 27.3461 8.5255 Constraint 182 544 12.4253 15.5316 23.2974 8.4759 Constraint 435 599 9.5751 11.9689 17.9533 8.4606 Constraint 412 585 12.6860 15.8575 23.7863 8.4606 Constraint 161 527 14.2161 17.7701 26.6552 8.3846 Constraint 153 519 12.5801 15.7251 23.5877 8.3846 Constraint 341 552 10.8863 13.6079 20.4118 8.3836 Constraint 303 552 10.7801 13.4751 20.2126 8.3836 Constraint 285 552 13.6703 17.0879 25.6318 8.3836 Constraint 497 604 10.2062 12.7577 19.1366 8.3821 Constraint 341 590 12.7659 15.9574 23.9362 8.3759 Constraint 461 622 11.3586 14.1982 21.2973 8.3668 Constraint 136 404 14.0405 17.5506 26.3260 8.3561 Constraint 449 636 13.5106 16.8883 25.3325 8.3383 Constraint 489 590 12.0122 15.0152 22.5228 8.3207 Constraint 128 577 10.9763 13.7204 20.5806 8.3196 Constraint 144 391 13.6244 17.0305 25.5457 8.2919 Constraint 467 544 10.6583 13.3229 19.9844 8.2555 Constraint 449 544 11.8040 14.7551 22.1326 8.2536 Constraint 153 552 12.6634 15.8292 23.7439 8.2363 Constraint 144 552 10.5911 13.2389 19.8584 8.2363 Constraint 604 720 14.1296 17.6620 26.4930 8.2359 Constraint 604 713 13.5451 16.9313 25.3970 8.2359 Constraint 210 585 11.4220 14.2775 21.4162 8.2167 Constraint 182 585 12.6352 15.7941 23.6911 8.2167 Constraint 355 613 13.3189 16.6486 24.9729 8.1526 Constraint 259 622 11.1842 13.9803 20.9704 8.1330 Constraint 250 622 10.5164 13.1454 19.7182 8.1330 Constraint 237 622 5.5461 6.9326 10.3989 8.1330 Constraint 237 613 8.2910 10.3637 15.5456 8.1330 Constraint 226 622 9.3212 11.6516 17.4773 8.1330 Constraint 221 613 11.7762 14.7202 22.0803 8.1330 Constraint 201 622 7.8336 9.7921 14.6881 8.1330 Constraint 210 636 10.4452 13.0564 19.5847 8.1259 Constraint 292 519 11.9132 14.8915 22.3372 8.1209 Constraint 242 519 11.6734 14.5918 21.8877 8.1209 Constraint 237 535 13.0638 16.3297 24.4946 8.1209 Constraint 237 527 11.9324 14.9155 22.3732 8.1209 Constraint 221 519 13.7402 17.1753 25.7630 8.1209 Constraint 210 519 11.9483 14.9353 22.4030 8.1209 Constraint 182 519 14.3932 17.9915 26.9873 8.1209 Constraint 480 577 9.5271 11.9088 17.8633 8.1056 Constraint 489 571 11.2271 14.0339 21.0508 8.0631 Constraint 69 237 14.3653 17.9566 26.9349 8.0149 Constraint 527 599 9.8904 12.3630 18.5445 8.0082 Constraint 113 375 14.3289 17.9111 26.8666 7.9920 Constraint 480 657 10.4689 13.0862 19.6293 7.9884 Constraint 480 651 12.2055 15.2569 22.8853 7.9884 Constraint 480 644 11.4068 14.2585 21.3878 7.9884 Constraint 399 585 8.9211 11.1514 16.7271 7.9580 Constraint 272 599 10.6818 13.3523 20.0284 7.9432 Constraint 221 599 8.7764 10.9705 16.4557 7.9432 Constraint 190 599 10.1463 12.6829 19.0243 7.9432 Constraint 182 599 8.6422 10.8027 16.2041 7.9432 Constraint 182 590 12.2717 15.3396 23.0094 7.9432 Constraint 176 599 9.4077 11.7596 17.6394 7.9432 Constraint 88 577 11.0601 13.8251 20.7376 7.9264 Constraint 330 629 13.1089 16.3861 24.5791 7.9186 Constraint 285 629 12.4653 15.5816 23.3724 7.9186 Constraint 303 613 13.5159 16.8949 25.3423 7.9064 Constraint 297 613 12.8784 16.0980 24.1469 7.9064 Constraint 272 613 13.8888 17.3610 26.0415 7.9064 Constraint 599 706 12.5498 15.6872 23.5309 7.9046 Constraint 113 368 14.1058 17.6322 26.4483 7.9038 Constraint 467 577 8.9345 11.1681 16.7521 7.8967 Constraint 473 577 9.1363 11.4203 17.1305 7.8948 Constraint 435 552 12.6478 15.8098 23.7146 7.8870 Constraint 169 382 14.3054 17.8818 26.8227 7.8629 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 489 622 11.3558 14.1947 21.2921 7.7985 Constraint 473 651 10.5814 13.2268 19.8402 7.7756 Constraint 473 644 10.3382 12.9228 19.3842 7.7756 Constraint 297 585 12.4794 15.5993 23.3989 7.7567 Constraint 314 651 13.8499 17.3124 25.9686 7.7423 Constraint 285 622 13.3523 16.6903 25.0355 7.7282 Constraint 267 622 14.4047 18.0059 27.0088 7.7282 Constraint 250 613 12.2132 15.2665 22.8997 7.7282 Constraint 226 613 11.8197 14.7747 22.1620 7.7282 Constraint 201 613 9.8964 12.3705 18.5558 7.7282 Constraint 176 636 10.7271 13.4089 20.1134 7.7211 Constraint 360 651 12.0586 15.0732 22.6098 7.6971 Constraint 330 552 10.2706 12.8382 19.2573 7.6673 Constraint 297 544 11.9613 14.9516 22.4274 7.6663 Constraint 96 604 11.7655 14.7068 22.0603 7.6587 Constraint 96 599 10.6787 13.3484 20.0226 7.6587 Constraint 636 720 12.9221 16.1526 24.2290 7.6427 Constraint 169 535 12.2047 15.2558 22.8837 7.6411 Constraint 169 613 10.4593 13.0742 19.6112 7.6331 Constraint 169 604 8.1601 10.2001 15.3001 7.6331 Constraint 527 604 11.1622 13.9527 20.9290 7.5812 Constraint 350 552 13.0806 16.3507 24.5261 7.5740 Constraint 279 552 11.9216 14.9020 22.3530 7.5740 Constraint 629 729 12.8289 16.0361 24.0541 7.5692 Constraint 355 629 12.0916 15.1145 22.6717 7.5675 Constraint 322 577 8.2053 10.2566 15.3849 7.5622 Constraint 242 577 10.2381 12.7976 19.1965 7.5622 Constraint 552 657 13.6859 17.1074 25.6611 7.5557 Constraint 176 590 12.8367 16.0459 24.0689 7.5384 Constraint 144 599 11.7466 14.6832 22.0249 7.4993 Constraint 144 590 12.8347 16.0434 24.0651 7.4993 Constraint 435 651 13.5753 16.9691 25.4536 7.4443 Constraint 429 651 12.1863 15.2329 22.8494 7.4443 Constraint 429 644 12.9091 16.1364 24.2046 7.4443 Constraint 435 577 10.7906 13.4883 20.2324 7.4350 Constraint 292 585 11.6770 14.5962 21.8944 7.4071 Constraint 144 604 10.9273 13.6591 20.4886 7.4022 Constraint 341 544 13.1870 16.4838 24.7257 7.3990 Constraint 480 668 12.3536 15.4420 23.1630 7.3932 Constraint 497 613 10.7565 13.4456 20.1683 7.3822 Constraint 272 552 13.8971 17.3713 26.0570 7.3673 Constraint 497 577 10.2242 12.7803 19.1704 7.3631 Constraint 136 590 13.1624 16.4530 24.6795 7.3529 Constraint 136 585 11.0419 13.8023 20.7035 7.3529 Constraint 104 585 10.9335 13.6668 20.5003 7.3529 Constraint 429 657 12.1368 15.1710 22.7565 7.3505 Constraint 421 651 12.8163 16.0204 24.0306 7.3505 Constraint 412 651 13.0125 16.2656 24.3984 7.3505 Constraint 176 404 13.8271 17.2838 25.9257 7.3215 Constraint 96 585 12.8507 16.0634 24.0951 7.2539 Constraint 449 571 13.0527 16.3159 24.4739 7.2535 Constraint 442 577 10.9793 13.7241 20.5862 7.2475 Constraint 636 713 11.9933 14.9916 22.4875 7.2378 Constraint 599 720 13.5434 16.9293 25.3939 7.2378 Constraint 153 557 12.7454 15.9317 23.8976 7.2343 Constraint 144 557 11.1781 13.9727 20.9590 7.2343 Constraint 122 557 13.2321 16.5401 24.8101 7.2343 Constraint 136 577 10.9758 13.7197 20.5796 7.2264 Constraint 144 285 14.9428 18.6785 28.0177 7.2153 Constraint 169 511 13.7644 17.2054 25.8082 7.1702 Constraint 226 341 14.6188 18.2735 27.4102 7.1548 Constraint 250 604 11.3847 14.2309 21.3464 7.1452 Constraint 644 735 12.4837 15.6046 23.4069 7.1441 Constraint 322 644 11.0473 13.8091 20.7137 7.1413 Constraint 153 577 12.6101 15.7627 23.6440 7.1391 Constraint 237 636 11.2651 14.0814 21.1221 7.1381 Constraint 201 636 10.1708 12.7135 19.0703 7.1381 Constraint 355 651 12.0369 15.0461 22.5691 7.1241 Constraint 391 657 12.8339 16.0424 24.0636 7.1209 Constraint 391 644 13.5702 16.9628 25.4441 7.1209 Constraint 360 657 12.6424 15.8030 23.7045 7.1209 Constraint 360 644 12.5741 15.7176 23.5764 7.1209 Constraint 242 571 11.0999 13.8749 20.8124 7.1084 Constraint 80 382 14.3748 17.9686 26.9528 7.1081 Constraint 473 571 11.3452 14.1814 21.2722 7.0632 Constraint 480 557 11.0056 13.7570 20.6355 7.0468 Constraint 80 250 12.0620 15.0775 22.6162 7.0153 Constraint 519 590 12.6232 15.7790 23.6686 7.0082 Constraint 442 622 7.2932 9.1165 13.6748 7.0079 Constraint 442 613 8.6592 10.8240 16.2360 7.0079 Constraint 355 622 11.1559 13.9448 20.9172 7.0067 Constraint 467 657 11.7063 14.6329 21.9494 6.9903 Constraint 161 599 11.7012 14.6265 21.9397 6.9896 Constraint 226 473 14.3620 17.9524 26.9287 6.9893 Constraint 412 636 13.0977 16.3721 24.5581 6.9750 Constraint 169 622 9.2775 11.5969 17.3953 6.9663 Constraint 314 636 12.7145 15.8932 23.8397 6.9340 Constraint 250 629 11.2391 14.0489 21.0733 6.9308 Constraint 113 577 10.6878 13.3598 20.0396 6.9264 Constraint 285 613 12.7572 15.9464 23.9197 6.9186 Constraint 279 629 13.5392 16.9240 25.3860 6.9186 Constraint 272 629 10.5541 13.1926 19.7889 6.9186 Constraint 267 629 12.8427 16.0534 24.0802 6.9186 Constraint 267 604 12.0117 15.0146 22.5219 6.9186 Constraint 259 613 11.4374 14.2967 21.4451 6.9186 Constraint 190 629 8.8907 11.1133 16.6700 6.9186 Constraint 221 467 13.4041 16.7551 25.1326 6.9031 Constraint 421 557 12.1352 15.1690 22.7535 6.8890 Constraint 519 599 10.9220 13.6526 20.4788 6.8622 Constraint 511 599 12.4183 15.5228 23.2842 6.8622 Constraint 58 429 12.6492 15.8114 23.7172 6.8531 Constraint 58 421 11.7793 14.7242 22.0863 6.8531 Constraint 58 404 14.2257 17.7821 26.6732 6.8531 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 375 12.8779 16.0974 24.1461 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 297 12.4181 15.5226 23.2839 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 58 285 13.3458 16.6823 25.0234 6.8531 Constraint 58 259 14.3583 17.9478 26.9217 6.8531 Constraint 58 210 13.4081 16.7601 25.1401 6.8531 Constraint 58 128 11.5778 14.4722 21.7083 6.8531 Constraint 242 590 8.2842 10.3552 15.5329 6.8350 Constraint 169 629 8.2924 10.3655 15.5483 6.8235 Constraint 226 599 8.8932 11.1165 16.6748 6.8228 Constraint 636 735 14.6342 18.2928 27.4392 6.8127 Constraint 176 467 13.0655 16.3318 24.4978 6.7922 Constraint 341 519 10.6890 13.3612 20.0418 6.7875 Constraint 341 489 11.9272 14.9090 22.3635 6.7875 Constraint 330 519 11.0490 13.8113 20.7169 6.7875 Constraint 303 527 9.4890 11.8612 17.7918 6.7875 Constraint 303 519 11.9943 14.9929 22.4893 6.7875 Constraint 297 527 9.9482 12.4353 18.6530 6.7875 Constraint 297 519 13.0113 16.2641 24.3961 6.7875 Constraint 285 535 11.7797 14.7246 22.0869 6.7875 Constraint 285 527 10.0309 12.5387 18.8080 6.7875 Constraint 285 519 13.1150 16.3937 24.5906 6.7875 Constraint 279 527 12.9570 16.1963 24.2944 6.7875 Constraint 272 527 12.5725 15.7157 23.5735 6.7875 Constraint 267 527 12.8076 16.0095 24.0142 6.7875 Constraint 259 535 10.9586 13.6982 20.5474 6.7875 Constraint 259 527 9.4405 11.8006 17.7010 6.7875 Constraint 259 519 12.8745 16.0931 24.1396 6.7875 Constraint 250 535 12.6318 15.7897 23.6846 6.7875 Constraint 250 527 12.0037 15.0046 22.5069 6.7875 Constraint 226 527 12.7838 15.9797 23.9695 6.7875 Constraint 221 535 12.7837 15.9797 23.9695 6.7875 Constraint 221 527 9.9513 12.4391 18.6587 6.7875 Constraint 201 527 13.0146 16.2683 24.4024 6.7875 Constraint 201 489 14.2140 17.7675 26.6513 6.7875 Constraint 190 527 13.9598 17.4498 26.1747 6.7875 Constraint 176 527 14.1412 17.6765 26.5148 6.7875 Constraint 461 657 13.7564 17.1956 25.7933 6.7775 Constraint 461 636 11.6594 14.5742 21.8614 6.7775 Constraint 322 657 11.7362 14.6702 22.0053 6.7468 Constraint 322 651 11.1283 13.9103 20.8655 6.7365 Constraint 161 467 13.3504 16.6880 25.0320 6.7171 Constraint 391 651 11.9107 14.8884 22.3325 6.7093 Constraint 136 599 11.6718 14.5897 21.8846 6.6644 Constraint 113 599 11.0690 13.8363 20.7545 6.6644 Constraint 399 552 12.0783 15.0978 22.6468 6.6498 Constraint 169 599 8.7472 10.9340 16.4010 6.6408 Constraint 169 590 11.9971 14.9964 22.4947 6.6408 Constraint 497 590 10.8936 13.6170 20.4255 6.6188 Constraint 122 585 10.7565 13.4456 20.1684 6.5931 Constraint 330 544 11.3600 14.2000 21.3000 6.5894 Constraint 497 629 9.5376 11.9220 17.8829 6.5841 Constraint 489 629 9.1735 11.4668 17.2003 6.5841 Constraint 636 729 13.3792 16.7240 25.0859 6.5711 Constraint 585 698 14.5403 18.1754 27.2630 6.5711 Constraint 292 577 8.4433 10.5542 15.8313 6.5622 Constraint 259 577 10.1894 12.7368 19.1052 6.5622 Constraint 237 577 11.1710 13.9638 20.9456 6.5622 Constraint 221 577 10.5515 13.1893 19.7840 6.5622 Constraint 210 577 8.7197 10.8996 16.3495 6.5622 Constraint 210 651 12.6651 15.8313 23.7470 6.5583 Constraint 360 636 12.3198 15.3998 23.0996 6.5511 Constraint 176 473 11.9324 14.9154 22.3732 6.4513 Constraint 341 613 13.1650 16.4562 24.6843 6.3657 Constraint 80 190 14.8698 18.5872 27.8808 6.3414 Constraint 221 636 12.6381 15.7977 23.6965 6.3388 Constraint 511 604 11.4989 14.3736 21.5604 6.3256 Constraint 467 571 11.9853 14.9816 22.4724 6.2555 Constraint 467 557 12.3601 15.4501 23.1752 6.2555 Constraint 449 557 12.7855 15.9819 23.9728 6.2555 Constraint 412 577 10.8997 13.6247 20.4370 6.2475 Constraint 461 557 12.0065 15.0081 22.5122 6.2391 Constraint 144 571 10.9867 13.7333 20.6000 6.2362 Constraint 136 571 13.6098 17.0123 25.5184 6.2325 Constraint 128 571 13.4127 16.7659 25.1488 6.2325 Constraint 201 585 12.5119 15.6398 23.4597 6.2205 Constraint 176 585 12.3706 15.4633 23.1949 6.2205 Constraint 303 480 12.8022 16.0027 24.0041 6.2038 Constraint 250 599 8.9053 11.1316 16.6973 6.1683 Constraint 267 599 11.0915 13.8643 20.7965 6.1561 Constraint 201 590 11.1435 13.9294 20.8941 6.1561 Constraint 210 657 12.1406 15.1758 22.7637 6.1535 Constraint 122 544 10.6832 13.3539 20.0309 6.1430 Constraint 122 571 13.1493 16.4366 24.6550 6.1392 Constraint 412 657 12.6984 15.8730 23.8094 6.1363 Constraint 399 657 10.9192 13.6490 20.4735 6.1363 Constraint 382 651 9.8333 12.2916 18.4375 6.1363 Constraint 368 657 11.7713 14.7141 22.0712 6.1363 Constraint 368 651 9.5549 11.9436 17.9154 6.1363 Constraint 368 644 11.7228 14.6536 21.9803 6.1363 Constraint 355 644 13.1411 16.4263 24.6395 6.1363 Constraint 527 613 11.4811 14.3513 21.5270 6.1352 Constraint 519 604 12.0702 15.0877 22.6316 6.1352 Constraint 461 571 11.9751 14.9689 22.4533 6.1095 Constraint 489 585 9.9037 12.3796 18.5694 6.1063 Constraint 473 557 10.7444 13.4305 20.1458 6.0469 Constraint 161 577 11.0215 13.7769 20.6654 6.0235 Constraint 350 590 13.2355 16.5444 24.8166 6.0067 Constraint 80 226 14.0391 17.5488 26.3232 5.9990 Constraint 382 636 11.8288 14.7860 22.1790 5.9904 Constraint 375 636 8.4615 10.5769 15.8654 5.9904 Constraint 375 629 5.0053 6.2566 9.3849 5.9904 Constraint 368 636 12.1881 15.2351 22.8526 5.9904 Constraint 368 629 8.6082 10.7602 16.1404 5.9904 Constraint 368 622 8.1084 10.1355 15.2032 5.9904 Constraint 153 382 14.5798 18.2248 27.3371 5.9901 Constraint 153 279 14.2840 17.8550 26.7825 5.9886 Constraint 473 657 8.6288 10.7860 16.1791 5.9884 Constraint 161 341 14.7548 18.4435 27.6652 5.9828 Constraint 153 341 12.6217 15.7771 23.6657 5.9828 Constraint 144 341 13.0044 16.2555 24.3832 5.9828 Constraint 169 644 10.7507 13.4383 20.1575 5.9785 Constraint 350 629 13.9340 17.4175 26.1262 5.9782 Constraint 382 644 12.4081 15.5101 23.2651 5.9750 Constraint 489 657 12.1785 15.2231 22.8347 5.9726 Constraint 303 622 14.7477 18.4347 27.6520 5.9525 Constraint 330 636 12.3381 15.4226 23.1339 5.9340 Constraint 297 636 12.1898 15.2372 22.8559 5.9340 Constraint 292 636 11.4139 14.2674 21.4011 5.9340 Constraint 272 636 13.0596 16.3245 24.4868 5.9340 Constraint 190 636 11.8889 14.8611 22.2916 5.9340 Constraint 182 636 10.2565 12.8206 19.2309 5.9340 Constraint 226 629 7.5958 9.4948 14.2422 5.9308 Constraint 267 473 14.2455 17.8069 26.7103 5.9009 Constraint 161 399 15.0051 18.7563 28.1345 5.8628 Constraint 113 613 11.7958 14.7447 22.1171 5.8549 Constraint 88 636 13.2042 16.5053 24.7579 5.8549 Constraint 80 604 13.0379 16.2973 24.4460 5.8485 Constraint 80 585 12.4363 15.5453 23.3180 5.8485 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 480 12.6846 15.8557 23.7836 5.8367 Constraint 58 473 12.4000 15.5000 23.2500 5.8367 Constraint 58 467 14.1825 17.7281 26.5921 5.8367 Constraint 58 461 12.3920 15.4900 23.2350 5.8367 Constraint 58 449 11.9904 14.9880 22.4819 5.8367 Constraint 58 442 14.8358 18.5447 27.8171 5.8367 Constraint 58 412 15.0328 18.7910 28.1864 5.8367 Constraint 58 182 13.7661 17.2077 25.8115 5.8367 Constraint 58 169 14.7118 18.3897 27.5845 5.8367 Constraint 58 153 14.3962 17.9953 26.9929 5.8367 Constraint 58 144 12.5389 15.6736 23.5104 5.8367 Constraint 58 136 11.9186 14.8983 22.3474 5.8367 Constraint 169 636 8.8854 11.1067 16.6601 5.8357 Constraint 237 590 7.5759 9.4699 14.2049 5.8350 Constraint 80 267 14.6989 18.3736 27.5604 5.8238 Constraint 527 622 9.7044 12.1304 18.1957 5.8017 Constraint 519 622 10.8433 13.5541 20.3312 5.8017 Constraint 412 552 12.0799 15.0999 22.6499 5.7938 Constraint 404 577 8.4977 10.6221 15.9332 5.7881 Constraint 322 571 10.8131 13.5164 20.2746 5.7750 Constraint 314 571 9.0778 11.3472 17.0208 5.7750 Constraint 279 497 14.4003 18.0004 27.0006 5.7707 Constraint 190 651 13.2452 16.5565 24.8348 5.7590 Constraint 182 651 11.1059 13.8824 20.8235 5.7590 Constraint 176 651 11.0926 13.8658 20.7987 5.7590 Constraint 190 590 12.9235 16.1543 24.2315 5.7513 Constraint 272 375 13.7962 17.2453 25.8680 5.7122 Constraint 136 613 11.9623 14.9528 22.4293 5.6645 Constraint 136 604 9.1653 11.4567 17.1850 5.6645 Constraint 128 613 11.9172 14.8965 22.3447 5.6645 Constraint 128 604 8.7007 10.8759 16.3138 5.6645 Constraint 128 599 9.6290 12.0363 18.0544 5.6645 Constraint 128 590 11.6310 14.5388 21.8082 5.6645 Constraint 122 613 12.1345 15.1681 22.7522 5.6645 Constraint 122 590 12.0723 15.0903 22.6355 5.6645 Constraint 113 604 9.0652 11.3315 16.9972 5.6645 Constraint 113 590 12.5590 15.6987 23.5481 5.6645 Constraint 104 604 8.9112 11.1389 16.7084 5.6645 Constraint 297 511 15.0491 18.8114 28.2171 5.6582 Constraint 435 636 12.3627 15.4533 23.1800 5.6571 Constraint 399 544 12.1619 15.2023 22.8035 5.6498 Constraint 435 571 12.4659 15.5823 23.3735 5.6478 Constraint 80 599 12.3419 15.4274 23.1411 5.5866 Constraint 169 651 11.7107 14.6383 21.9575 5.5737 Constraint 341 461 13.8524 17.3154 25.9732 5.5730 Constraint 330 467 14.6311 18.2888 27.4332 5.5730 Constraint 303 544 12.4717 15.5897 23.3845 5.5730 Constraint 279 544 12.2520 15.3150 22.9725 5.5730 Constraint 279 535 14.9140 18.6425 27.9637 5.5730 Constraint 272 544 13.5493 16.9366 25.4049 5.5730 Constraint 267 535 14.2425 17.8031 26.7047 5.5730 Constraint 226 375 14.2353 17.7942 26.6913 5.5730 Constraint 190 544 14.6249 18.2811 27.4217 5.5730 Constraint 613 706 13.0469 16.3086 24.4629 5.5693 Constraint 489 651 13.7868 17.2335 25.8502 5.5678 Constraint 391 636 13.0980 16.3725 24.5587 5.5633 Constraint 382 657 10.4582 13.0727 19.6091 5.5633 Constraint 375 657 8.1899 10.2374 15.3561 5.5633 Constraint 128 585 9.6165 12.0207 18.0310 5.5597 Constraint 190 585 13.9959 17.4949 26.2424 5.5538 Constraint 442 552 11.1960 13.9951 20.9926 5.5536 Constraint 442 544 12.1765 15.2206 22.8309 5.5536 Constraint 237 511 12.8257 16.0321 24.0482 5.5478 Constraint 399 577 9.8884 12.3606 18.5408 5.4468 Constraint 391 552 10.4506 13.0633 19.5949 5.4440 Constraint 96 544 11.3083 14.1354 21.2031 5.4431 Constraint 242 585 10.7567 13.4459 20.1689 5.4417 Constraint 421 644 13.5411 16.9264 25.3895 5.4385 Constraint 314 644 13.1499 16.4374 24.6560 5.3664 Constraint 314 668 13.0258 16.2823 24.4234 5.3644 Constraint 292 657 12.4216 15.5270 23.2905 5.3644 Constraint 259 668 14.3279 17.9099 26.8649 5.3644 Constraint 242 636 12.0165 15.0206 22.5309 5.3586 Constraint 297 644 10.6676 13.3345 20.0017 5.3542 Constraint 272 651 13.1903 16.4878 24.7318 5.3542 Constraint 272 644 12.1467 15.1833 22.7750 5.3542 Constraint 182 644 9.3390 11.6737 17.5105 5.3542 Constraint 226 636 12.3225 15.4032 23.1048 5.3510 Constraint 153 590 13.3991 16.7489 25.1233 5.3078 Constraint 161 622 12.4587 15.5734 23.3601 5.2391 Constraint 161 613 11.7941 14.7426 22.1139 5.2391 Constraint 161 552 13.4628 16.8285 25.2428 5.2363 Constraint 153 571 11.6138 14.5172 21.7759 5.2363 Constraint 153 544 11.1909 13.9886 20.9829 5.2363 Constraint 259 480 13.3746 16.7183 25.0774 5.2057 Constraint 88 622 12.6727 15.8409 23.7614 5.1881 Constraint 80 590 13.6122 17.0152 25.5228 5.1818 Constraint 210 644 10.1670 12.7087 19.0631 5.1760 Constraint 201 644 10.0204 12.5255 18.7882 5.1760 Constraint 190 644 11.2075 14.0094 21.0141 5.1760 Constraint 176 644 8.6263 10.7829 16.1743 5.1760 Constraint 169 657 11.2965 14.1206 21.1809 5.1689 Constraint 259 590 9.5860 11.9825 17.9738 5.1683 Constraint 250 590 9.0578 11.3222 16.9833 5.1683 Constraint 226 590 10.5378 13.1722 19.7583 5.1683 Constraint 221 590 10.3070 12.8837 19.3256 5.1683 Constraint 360 544 13.4165 16.7706 25.1559 5.1431 Constraint 113 544 10.9310 13.6637 20.4956 5.1431 Constraint 88 544 8.8191 11.0239 16.5359 5.1431 Constraint 113 571 13.2757 16.5946 24.8919 5.1392 Constraint 519 613 12.5350 15.6687 23.5030 5.1353 Constraint 391 577 7.6385 9.5482 14.3222 5.1315 Constraint 391 571 8.0203 10.0253 15.0380 5.1315 Constraint 368 577 9.8527 12.3159 18.4739 5.1315 Constraint 360 577 8.7455 10.9319 16.3978 5.1315 Constraint 360 571 9.4810 11.8513 17.7769 5.1315 Constraint 355 577 10.5520 13.1901 19.7851 5.1315 Constraint 421 668 13.9012 17.3766 26.0648 5.1229 Constraint 237 571 11.2505 14.0631 21.0947 5.1123 Constraint 341 668 12.3669 15.4586 23.1879 5.1075 Constraint 341 644 13.9623 17.4529 26.1793 5.1075 Constraint 341 651 13.9332 17.4165 26.1247 5.1030 Constraint 668 742 9.3796 11.7244 17.5867 5.0954 Constraint 657 742 11.4732 14.3415 21.5123 5.0954 Constraint 442 657 13.8608 17.3260 25.9890 5.0192 Constraint 442 636 13.1286 16.4107 24.6161 5.0192 Constraint 226 467 13.7562 17.1953 25.7929 5.0051 Constraint 190 467 13.7204 17.1505 25.7257 5.0051 Constraint 104 622 10.9527 13.6909 20.5364 4.9977 Constraint 104 599 8.5214 10.6518 15.9777 4.9977 Constraint 104 590 10.8407 13.5509 20.3264 4.9977 Constraint 527 629 9.3628 11.7035 17.5553 4.9921 Constraint 519 629 10.8032 13.5040 20.2559 4.9921 Constraint 511 629 11.0937 13.8672 20.8007 4.9921 Constraint 169 368 14.3953 17.9941 26.9912 4.9920 Constraint 435 657 11.9924 14.9905 22.4857 4.9904 Constraint 412 644 14.9201 18.6501 27.9752 4.9904 Constraint 404 657 8.2415 10.3018 15.4527 4.9904 Constraint 404 651 8.5264 10.6580 15.9870 4.9904 Constraint 404 644 10.8862 13.6078 20.4116 4.9904 Constraint 399 651 9.4730 11.8412 17.7618 4.9904 Constraint 399 644 10.8733 13.5916 20.3875 4.9904 Constraint 375 651 5.6128 7.0160 10.5241 4.9904 Constraint 375 644 8.0069 10.0087 15.0130 4.9904 Constraint 350 622 13.5836 16.9795 25.4692 4.9904 Constraint 497 622 9.1902 11.4878 17.2316 4.9890 Constraint 473 668 10.5373 13.1716 19.7574 4.9884 Constraint 292 571 10.8359 13.5449 20.3174 4.9654 Constraint 285 571 10.8206 13.5257 20.2886 4.9654 Constraint 259 571 10.8061 13.5077 20.2615 4.9654 Constraint 391 557 10.2916 12.8644 19.2967 4.9565 Constraint 360 557 10.8354 13.5443 20.3164 4.9565 Constraint 355 557 11.9757 14.9696 22.4544 4.9565 Constraint 330 651 10.0868 12.6085 18.9128 4.9494 Constraint 330 644 10.0074 12.5092 18.7638 4.9494 Constraint 303 644 13.8535 17.3168 25.9753 4.9494 Constraint 297 651 10.9259 13.6574 20.4861 4.9494 Constraint 292 651 12.8065 16.0081 24.0122 4.9494 Constraint 259 636 13.8553 17.3192 25.9788 4.9462 Constraint 272 590 12.8088 16.0110 24.0165 4.9416 Constraint 190 368 14.0557 17.5696 26.3545 4.9120 Constraint 104 571 12.1199 15.1498 22.7247 4.8990 Constraint 511 590 12.3730 15.4663 23.1995 4.8623 Constraint 113 636 11.6348 14.5435 21.8152 4.8549 Constraint 113 629 10.5586 13.1983 19.7974 4.8549 Constraint 153 585 12.0631 15.0789 22.6183 4.8060 Constraint 435 557 12.0566 15.0707 22.6061 4.7957 Constraint 429 557 12.0210 15.0263 22.5394 4.7957 Constraint 421 571 10.8541 13.5676 20.3514 4.7957 Constraint 412 557 11.9867 14.9834 22.4751 4.7957 Constraint 399 557 12.5868 15.7335 23.6002 4.7957 Constraint 341 480 10.7568 13.4460 20.1690 4.7834 Constraint 250 577 11.6349 14.5437 21.8155 4.7750 Constraint 201 651 12.0911 15.1139 22.6709 4.7712 Constraint 585 676 14.2800 17.8499 26.7749 4.7501 Constraint 535 629 10.4627 13.0784 19.6176 4.7191 Constraint 96 613 12.4256 15.5320 23.2981 4.6683 Constraint 96 590 11.8863 14.8578 22.2868 4.6683 Constraint 272 535 14.9659 18.7074 28.0611 4.6664 Constraint 169 480 12.1117 15.1396 22.7095 4.6642 Constraint 161 604 8.7642 10.9552 16.4328 4.6561 Constraint 429 571 11.7846 14.7308 22.0962 4.6498 Constraint 201 535 13.8789 17.3486 26.0229 4.6411 Constraint 404 544 13.5238 16.9047 25.3571 4.6335 Constraint 104 577 7.7838 9.7297 14.5946 4.5929 Constraint 489 636 11.0236 13.7795 20.6693 4.5697 Constraint 604 729 14.0928 17.6160 26.4240 4.5694 Constraint 226 577 11.4860 14.3575 21.5363 4.5660 Constraint 201 577 9.6781 12.0976 18.1464 4.5660 Constraint 190 577 10.8965 13.6206 20.4309 4.5660 Constraint 176 577 9.5913 11.9891 17.9837 4.5660 Constraint 404 668 12.2559 15.3198 22.9797 4.5633 Constraint 399 668 13.2522 16.5653 24.8479 4.5633 Constraint 382 668 13.1645 16.4556 24.6834 4.5633 Constraint 375 668 10.5819 13.2273 19.8410 4.5633 Constraint 368 668 13.4308 16.7885 25.1828 4.5633 Constraint 341 629 13.0854 16.3568 24.5352 4.5569 Constraint 341 636 14.0739 17.5924 26.3886 4.5492 Constraint 341 698 13.4198 16.7748 25.1622 4.5480 Constraint 341 687 13.9644 17.4555 26.1832 4.5480 Constraint 651 742 12.9578 16.1972 24.2958 4.5224 Constraint 442 571 11.5692 14.4615 21.6922 4.4603 Constraint 161 571 12.3602 15.4502 23.1753 4.4267 Constraint 161 535 10.4552 13.0690 19.6035 4.4267 Constraint 322 698 12.9511 16.1889 24.2833 4.3798 Constraint 297 698 11.8512 14.8140 22.2210 4.3798 Constraint 292 698 13.2226 16.5283 24.7925 4.3798 Constraint 322 676 9.7726 12.2157 18.3236 4.3664 Constraint 322 668 9.1989 11.4986 17.2479 4.3664 Constraint 297 668 8.9684 11.2105 16.8158 4.3664 Constraint 292 676 12.1649 15.2061 22.8091 4.3664 Constraint 292 668 10.4137 13.0171 19.5257 4.3664 Constraint 292 644 10.7353 13.4191 20.1287 4.3664 Constraint 285 668 13.9483 17.4354 26.1531 4.3664 Constraint 272 676 12.5646 15.7057 23.5586 4.3664 Constraint 272 668 10.3027 12.8783 19.3175 4.3664 Constraint 267 668 14.0080 17.5100 26.2650 4.3664 Constraint 221 668 11.6433 14.5541 21.8312 4.3664 Constraint 210 668 10.2023 12.7528 19.1292 4.3664 Constraint 201 668 10.4398 13.0498 19.5746 4.3664 Constraint 201 657 11.6135 14.5168 21.7753 4.3664 Constraint 190 676 12.7959 15.9949 23.9923 4.3664 Constraint 190 668 9.8535 12.3169 18.4754 4.3664 Constraint 190 657 11.4202 14.2752 21.4128 4.3664 Constraint 182 676 9.7358 12.1698 18.2547 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 182 657 9.1175 11.3968 17.0953 4.3664 Constraint 176 676 10.6182 13.2728 19.9092 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 176 657 9.2254 11.5317 17.2976 4.3664 Constraint 161 404 14.8242 18.5302 27.7954 4.3581 Constraint 136 519 13.1321 16.4151 24.6227 4.3335 Constraint 552 644 13.7058 17.1323 25.6984 4.3161 Constraint 297 480 10.9284 13.6605 20.4907 4.3057 Constraint 285 480 12.9121 16.1401 24.2102 4.3057 Constraint 182 480 11.3919 14.2399 21.3598 4.3057 Constraint 113 382 13.6096 17.0119 25.5179 4.2899 Constraint 169 585 10.7208 13.4010 20.1015 4.2513 Constraint 161 590 12.0119 15.0149 22.5223 4.2513 Constraint 161 585 9.9082 12.3853 18.5780 4.2513 Constraint 210 544 13.2670 16.5837 24.8755 4.2363 Constraint 169 571 13.7851 17.2314 25.8471 4.2363 Constraint 169 552 12.9210 16.1513 24.2269 4.2363 Constraint 169 544 11.8440 14.8050 22.2075 4.2363 Constraint 161 557 13.3615 16.7019 25.0529 4.2363 Constraint 153 604 11.1652 13.9564 20.9347 4.2146 Constraint 153 599 10.8111 13.5139 20.2709 4.2146 Constraint 250 489 12.4904 15.6130 23.4195 4.2144 Constraint 88 657 11.7365 14.6706 22.0059 4.1901 Constraint 113 651 12.1829 15.2286 22.8428 4.1881 Constraint 113 644 12.5386 15.6733 23.5099 4.1881 Constraint 113 622 12.0632 15.0790 22.6184 4.1881 Constraint 104 651 11.1556 13.9445 20.9168 4.1881 Constraint 104 644 12.1683 15.2104 22.8156 4.1881 Constraint 104 613 10.1453 12.6817 19.0225 4.1881 Constraint 88 651 12.7804 15.9755 23.9632 4.1881 Constraint 237 644 11.9856 14.9821 22.4731 4.1837 Constraint 226 644 12.7780 15.9724 23.9587 4.1837 Constraint 237 657 13.2109 16.5136 24.7704 4.1689 Constraint 341 657 11.2228 14.0285 21.0428 4.1209 Constraint 69 250 13.7359 17.1699 25.7548 4.0163 Constraint 58 279 14.8066 18.5082 27.7624 4.0163 Constraint 58 242 13.6345 17.0431 25.5646 4.0163 Constraint 51 404 14.7570 18.4462 27.6694 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 368 14.4564 18.0705 27.1057 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 341 13.7194 17.1492 25.7238 4.0163 Constraint 51 330 12.6862 15.8578 23.7866 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 303 13.5882 16.9853 25.4779 4.0163 Constraint 51 297 14.8148 18.5186 27.7778 4.0163 Constraint 51 292 13.4736 16.8420 25.2630 4.0163 Constraint 51 210 13.9320 17.4150 26.1226 4.0163 Constraint 51 144 12.2532 15.3165 22.9747 4.0163 Constraint 51 136 12.6908 15.8635 23.7952 4.0163 Constraint 51 128 12.1092 15.1365 22.7047 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 41 360 14.0288 17.5361 26.3041 4.0163 Constraint 41 314 13.6431 17.0538 25.5807 4.0163 Constraint 41 122 13.6300 17.0375 25.5562 4.0163 Constraint 41 113 12.3966 15.4958 23.2437 4.0163 Constraint 285 467 13.2967 16.6209 24.9313 3.9913 Constraint 467 668 13.1516 16.4395 24.6592 3.9904 Constraint 382 577 8.3938 10.4923 15.7385 3.9855 Constraint 382 571 7.2942 9.1178 13.6767 3.9855 Constraint 375 577 8.5375 10.6719 16.0079 3.9855 Constraint 375 571 8.2427 10.3034 15.4551 3.9855 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 355 571 10.2479 12.8099 19.2149 3.9855 Constraint 350 571 11.7574 14.6968 22.0452 3.9855 Constraint 341 622 13.3094 16.6367 24.9550 3.9840 Constraint 330 622 14.0949 17.6187 26.4280 3.9840 Constraint 552 651 13.2321 16.5401 24.8102 3.9826 Constraint 341 706 11.5132 14.3915 21.5873 3.9750 Constraint 330 706 9.2476 11.5595 17.3392 3.9750 Constraint 330 698 11.2860 14.1075 21.1613 3.9750 Constraint 322 706 11.3874 14.2342 21.3514 3.9750 Constraint 314 706 12.9270 16.1588 24.2381 3.9750 Constraint 303 706 11.9031 14.8788 22.3183 3.9750 Constraint 297 706 9.9401 12.4251 18.6376 3.9750 Constraint 292 706 12.3381 15.4227 23.1340 3.9750 Constraint 285 706 13.4088 16.7610 25.1415 3.9750 Constraint 279 706 11.6634 14.5792 21.8688 3.9750 Constraint 279 698 13.2400 16.5500 24.8250 3.9750 Constraint 267 706 13.9092 17.3865 26.0798 3.9750 Constraint 314 657 11.8044 14.7555 22.1333 3.9750 Constraint 497 657 10.5611 13.2014 19.8021 3.9726 Constraint 497 644 11.6219 14.5274 21.7911 3.9726 Constraint 489 644 12.8650 16.0813 24.1219 3.9726 Constraint 314 676 12.8425 16.0531 24.0796 3.9673 Constraint 285 585 11.5974 14.4968 21.7452 3.9654 Constraint 259 585 11.6190 14.5238 21.7857 3.9654 Constraint 285 636 14.5569 18.1961 27.2941 3.9647 Constraint 267 613 14.8050 18.5063 27.7594 3.9647 Constraint 341 676 12.1263 15.1579 22.7368 3.9616 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 330 668 8.4725 10.5907 15.8860 3.9616 Constraint 330 657 9.6266 12.0333 18.0499 3.9616 Constraint 303 668 12.8489 16.0611 24.0916 3.9616 Constraint 297 676 9.3739 11.7173 17.5760 3.9616 Constraint 297 657 10.0349 12.5436 18.8155 3.9616 Constraint 279 676 13.3365 16.6706 25.0058 3.9616 Constraint 279 668 12.0012 15.0015 22.5023 3.9616 Constraint 272 657 11.6877 14.6096 21.9144 3.9616 Constraint 303 651 13.7974 17.2467 25.8701 3.9570 Constraint 279 644 13.3906 16.7382 25.1073 3.9570 Constraint 285 590 10.2577 12.8222 19.2333 3.9538 Constraint 279 590 14.0630 17.5787 26.3680 3.9538 Constraint 267 590 12.4954 15.6193 23.4289 3.9538 Constraint 250 636 14.4618 18.0772 27.1158 3.9538 Constraint 169 577 9.7901 12.2376 18.3564 3.9302 Constraint 136 557 10.5052 13.1315 19.6973 3.9009 Constraint 128 557 10.8112 13.5139 20.2709 3.9009 Constraint 113 557 11.6337 14.5422 21.8132 3.9009 Constraint 104 557 10.1808 12.7260 19.0889 3.9009 Constraint 303 467 10.9854 13.7318 20.5976 3.8804 Constraint 297 467 8.9438 11.1797 16.7696 3.8804 Constraint 272 473 11.9616 14.9519 22.4279 3.8804 Constraint 190 473 12.5660 15.7075 23.5612 3.8804 Constraint 161 473 8.9584 11.1980 16.7970 3.8804 Constraint 122 636 11.3771 14.2214 21.3321 3.8587 Constraint 644 742 10.9852 13.7315 20.5972 3.8557 Constraint 69 552 13.5063 16.8829 25.3244 3.8531 Constraint 58 221 14.8500 18.5625 27.8437 3.8531 Constraint 382 552 9.6106 12.0133 18.0199 3.8105 Constraint 375 552 9.2928 11.6160 17.4240 3.8105 Constraint 360 552 9.0246 11.2808 16.9211 3.8105 Constraint 350 557 13.3391 16.6739 25.0108 3.8105 Constraint 375 544 13.5737 16.9672 25.4507 3.8096 Constraint 314 544 14.0630 17.5788 26.3682 3.8096 Constraint 88 571 10.6174 13.2718 19.9077 3.8058 Constraint 322 557 10.8606 13.5757 20.3636 3.7923 Constraint 314 557 9.9164 12.3955 18.5933 3.7923 Constraint 104 636 10.7379 13.4224 20.1336 3.7833 Constraint 104 629 8.1346 10.1682 15.2523 3.7833 Constraint 210 571 10.3119 12.8899 19.3348 3.7788 Constraint 421 676 14.1081 17.6352 26.4528 3.7718 Constraint 442 590 9.3094 11.6367 17.4551 3.7702 Constraint 442 585 10.3145 12.8931 19.3397 3.7702 Constraint 590 698 13.3578 16.6973 25.0459 3.7344 Constraint 122 622 10.7926 13.4907 20.2361 3.6683 Constraint 404 557 12.4398 15.5498 23.3247 3.6498 Constraint 404 552 11.0995 13.8743 20.8115 3.6498 Constraint 435 544 10.8331 13.5414 20.3121 3.6479 Constraint 412 544 11.9468 14.9335 22.4003 3.6479 Constraint 557 651 12.1306 15.1632 22.7448 3.6315 Constraint 96 577 10.1302 12.6627 18.9941 3.5968 Constraint 497 651 11.5614 14.4517 21.6776 3.5678 Constraint 442 557 11.0769 13.8461 20.7691 3.4603 Constraint 391 544 13.2945 16.6181 24.9272 3.4594 Constraint 237 585 9.6966 12.1207 18.1811 3.4456 Constraint 221 585 12.1790 15.2238 22.8357 3.4456 Constraint 161 629 10.8461 13.5576 20.3364 3.4417 Constraint 161 544 9.7700 12.2125 18.3188 3.4267 Constraint 259 676 14.8105 18.5132 27.7697 3.3875 Constraint 242 657 12.5782 15.7227 23.5841 3.3875 Constraint 292 687 14.6360 18.2950 27.4425 3.3818 Constraint 272 698 11.9642 14.9552 22.4328 3.3818 Constraint 190 698 12.0980 15.1225 22.6838 3.3818 Constraint 190 687 14.1709 17.7136 26.5704 3.3818 Constraint 182 698 10.4633 13.0791 19.6187 3.3818 Constraint 182 687 11.9522 14.9402 22.4103 3.3818 Constraint 176 698 10.9787 13.7234 20.5851 3.3818 Constraint 176 687 12.3863 15.4829 23.2244 3.3818 Constraint 169 698 13.2887 16.6109 24.9163 3.3818 Constraint 169 687 13.7257 17.1572 25.7358 3.3818 Constraint 169 676 11.2641 14.0801 21.1202 3.3818 Constraint 169 668 9.4042 11.7552 17.6328 3.3818 Constraint 259 657 13.6087 17.0109 25.5164 3.3798 Constraint 259 644 13.4950 16.8687 25.3030 3.3740 Constraint 237 668 13.4069 16.7587 25.1380 3.3740 Constraint 226 668 13.0505 16.3132 24.4698 3.3740 Constraint 221 676 13.3382 16.6728 25.0091 3.3740 Constraint 221 644 11.0297 13.7871 20.6807 3.3740 Constraint 210 676 11.5051 14.3814 21.5721 3.3740 Constraint 201 676 12.3335 15.4169 23.1253 3.3740 Constraint 449 657 12.5303 15.6628 23.4943 3.3601 Constraint 449 651 11.5002 14.3753 21.5629 3.3601 Constraint 412 571 10.6953 13.3691 20.0537 3.3498 Constraint 33 399 14.7826 18.4783 27.7174 3.3388 Constraint 33 360 14.1610 17.7012 26.5518 3.3388 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 33 303 14.7631 18.4538 27.6807 3.3388 Constraint 33 122 13.6116 17.0144 25.5217 3.3388 Constraint 544 687 14.1563 17.6953 26.5430 3.3315 Constraint 622 720 12.7558 15.9448 23.9172 3.3296 Constraint 613 713 12.3453 15.4316 23.1475 3.3296 Constraint 571 698 12.5180 15.6475 23.4713 3.3296 Constraint 571 687 11.6965 14.6206 21.9309 3.3296 Constraint 557 706 13.3322 16.6653 24.9979 3.3296 Constraint 557 687 12.7531 15.9414 23.9120 3.3296 Constraint 279 489 13.2031 16.5039 24.7559 3.3076 Constraint 279 480 13.5020 16.8775 25.3162 3.3076 Constraint 272 489 12.1729 15.2161 22.8242 3.3076 Constraint 272 480 11.9792 14.9740 22.4610 3.3076 Constraint 267 480 13.6630 17.0788 25.6181 3.3076 Constraint 221 480 11.9320 14.9150 22.3726 3.3076 Constraint 201 480 13.2349 16.5436 24.8154 3.3076 Constraint 190 480 13.2781 16.5977 24.8965 3.3076 Constraint 176 489 14.1695 17.7119 26.5678 3.3076 Constraint 96 636 11.6166 14.5207 21.7811 3.1920 Constraint 96 629 8.9311 11.1639 16.7458 3.1920 Constraint 88 644 13.4570 16.8212 25.2318 3.1920 Constraint 136 657 10.2395 12.7994 19.1991 3.1901 Constraint 128 657 10.6896 13.3621 20.0431 3.1901 Constraint 122 668 12.9830 16.2288 24.3432 3.1901 Constraint 122 657 10.9685 13.7106 20.5659 3.1901 Constraint 113 668 11.8192 14.7740 22.1610 3.1901 Constraint 113 657 9.4139 11.7674 17.6511 3.1901 Constraint 104 676 12.3897 15.4871 23.2307 3.1901 Constraint 104 668 11.4116 14.2645 21.3968 3.1901 Constraint 104 657 8.9961 11.2451 16.8676 3.1901 Constraint 88 676 14.3002 17.8753 26.8129 3.1901 Constraint 88 668 13.3860 16.7325 25.0988 3.1901 Constraint 350 651 12.1581 15.1976 22.7965 3.1337 Constraint 350 657 12.7233 15.9042 23.8562 3.1305 Constraint 242 557 11.3888 14.2359 21.3539 3.1277 Constraint 242 552 10.3386 12.9232 19.3848 3.1277 Constraint 190 497 13.8692 17.3365 26.0048 3.1125 Constraint 144 622 12.3255 15.4069 23.1103 3.0726 Constraint 144 613 11.2804 14.1005 21.1508 3.0726 Constraint 442 651 11.9971 14.9964 22.4945 3.0269 Constraint 442 644 13.4201 16.7751 25.1627 3.0269 Constraint 161 644 12.0042 15.0053 22.5079 3.0016 Constraint 136 622 10.8896 13.6120 20.4179 3.0016 Constraint 128 622 8.7995 10.9994 16.4991 3.0016 Constraint 96 622 9.7228 12.1535 18.2303 3.0016 Constraint 404 571 7.6716 9.5895 14.3843 3.0009 Constraint 399 571 6.9044 8.6306 12.9458 3.0009 Constraint 382 557 8.8518 11.0648 16.5972 3.0009 Constraint 375 557 8.8090 11.0112 16.5169 3.0009 Constraint 368 557 8.5536 10.6920 16.0380 3.0009 Constraint 368 552 7.6438 9.5547 14.3321 3.0009 Constraint 355 552 9.3676 11.7095 17.5642 3.0009 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 467 12.1656 15.2071 22.8106 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 449 11.4549 14.3187 21.4780 3.0000 Constraint 51 442 14.9773 18.7216 28.0823 3.0000 Constraint 51 429 11.6845 14.6056 21.9084 3.0000 Constraint 51 421 11.7813 14.7266 22.0899 3.0000 Constraint 51 391 14.8757 18.5946 27.8919 3.0000 Constraint 51 355 10.7311 13.4139 20.1209 3.0000 Constraint 51 350 13.6796 17.0995 25.6492 3.0000 Constraint 51 153 13.6447 17.0559 25.5838 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 473 12.5906 15.7383 23.6075 3.0000 Constraint 41 467 14.1381 17.6726 26.5089 3.0000 Constraint 41 461 13.9501 17.4376 26.1565 3.0000 Constraint 41 429 14.3138 17.8923 26.8384 3.0000 Constraint 41 421 14.7267 18.4084 27.6126 3.0000 Constraint 41 399 13.2985 16.6232 24.9347 3.0000 Constraint 41 355 11.5988 14.4986 21.7478 3.0000 Constraint 41 341 15.0407 18.8009 28.2014 3.0000 Constraint 41 330 14.9440 18.6800 28.0201 3.0000 Constraint 41 322 13.8643 17.3304 25.9956 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 489 13.0759 16.3449 24.5173 3.0000 Constraint 33 480 14.5110 18.1388 27.2081 3.0000 Constraint 33 473 15.0623 18.8278 28.2417 3.0000 Constraint 33 355 11.4914 14.3642 21.5463 3.0000 Constraint 33 350 14.2217 17.7772 26.6657 3.0000 Constraint 33 341 12.9148 16.1436 24.2153 3.0000 Constraint 33 330 12.2735 15.3418 23.0128 3.0000 Constraint 33 322 12.0182 15.0227 22.5341 3.0000 Constraint 33 128 15.1971 18.9963 28.4945 3.0000 Constraint 33 113 10.9570 13.6962 20.5443 3.0000 Constraint 33 104 11.2225 14.0281 21.0421 3.0000 Constraint 267 461 15.0416 18.8020 28.2030 3.0000 Constraint 511 622 9.9739 12.4674 18.7011 2.9922 Constraint 511 613 11.3190 14.1488 21.2232 2.9922 Constraint 169 355 12.4567 15.5709 23.3563 2.9886 Constraint 161 350 13.1662 16.4577 24.6866 2.9886 Constraint 350 585 13.2171 16.5214 24.7821 2.9855 Constraint 429 676 14.4169 18.0212 27.0317 2.9846 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 322 713 11.3366 14.1708 21.2561 2.9827 Constraint 314 713 12.6796 15.8496 23.7743 2.9827 Constraint 303 720 13.2566 16.5707 24.8561 2.9827 Constraint 303 713 12.0239 15.0298 22.5447 2.9827 Constraint 297 713 10.9330 13.6663 20.4994 2.9827 Constraint 292 713 13.4471 16.8089 25.2134 2.9827 Constraint 259 706 14.4390 18.0487 27.0730 2.9827 Constraint 511 636 13.3774 16.7217 25.0825 2.9777 Constraint 350 706 14.0808 17.6010 26.4016 2.9769 Constraint 330 687 10.2735 12.8419 19.2629 2.9769 Constraint 322 687 12.3680 15.4600 23.1900 2.9769 Constraint 297 687 11.5783 14.4729 21.7094 2.9769 Constraint 279 687 14.7735 18.4669 27.7004 2.9769 Constraint 272 706 10.4848 13.1060 19.6590 2.9769 Constraint 272 687 13.9658 17.4573 26.1859 2.9769 Constraint 221 706 13.4076 16.7595 25.1393 2.9769 Constraint 210 706 13.5422 16.9278 25.3917 2.9769 Constraint 190 706 11.9135 14.8919 22.3378 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 176 706 10.9944 13.7431 20.6146 2.9769 Constraint 169 706 13.6706 17.0882 25.6324 2.9769 Constraint 497 668 10.1778 12.7222 19.0834 2.9759 Constraint 527 657 9.2490 11.5613 17.3419 2.9758 Constraint 527 651 10.0309 12.5387 18.8080 2.9758 Constraint 527 644 11.3009 14.1261 21.1892 2.9758 Constraint 519 657 10.9086 13.6358 20.4536 2.9758 Constraint 519 651 12.1509 15.1886 22.7830 2.9758 Constraint 303 657 12.6983 15.8729 23.8093 2.9750 Constraint 285 657 13.3307 16.6634 24.9951 2.9750 Constraint 303 676 12.4503 15.5629 23.3444 2.9692 Constraint 285 644 13.6734 17.0917 25.6375 2.9692 Constraint 267 644 14.1592 17.6990 26.5485 2.9692 Constraint 250 571 8.6134 10.7667 16.1501 2.9692 Constraint 272 585 12.6818 15.8522 23.7783 2.9570 Constraint 176 368 14.9649 18.7062 28.0593 2.9118 Constraint 292 544 14.5864 18.2329 27.3494 2.9028 Constraint 169 557 12.4250 15.5313 23.2970 2.9028 Constraint 161 657 12.5642 15.7052 23.5578 2.8587 Constraint 161 636 10.5932 13.2415 19.8623 2.8587 Constraint 136 629 8.3249 10.4062 15.6092 2.8587 Constraint 128 636 9.4497 11.8121 17.7182 2.8587 Constraint 128 629 7.9865 9.9831 14.9747 2.8587 Constraint 122 644 11.8086 14.7608 22.1412 2.8587 Constraint 122 629 8.2557 10.3197 15.4795 2.8587 Constraint 636 742 13.5613 16.9516 25.4274 2.8576 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 69 201 14.0545 17.5682 26.3523 2.8367 Constraint 69 176 15.0963 18.8703 28.3055 2.8367 Constraint 58 585 15.1166 18.8958 28.3437 2.8367 Constraint 58 557 14.1313 17.6641 26.4962 2.8367 Constraint 58 552 12.3955 15.4944 23.2416 2.8367 Constraint 58 535 14.8581 18.5726 27.8589 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 267 552 13.3180 16.6475 24.9713 2.8105 Constraint 88 557 10.0176 12.5220 18.7830 2.8077 Constraint 297 557 13.0227 16.2784 24.4176 2.7923 Constraint 292 557 11.6106 14.5133 21.7699 2.7923 Constraint 210 557 11.5494 14.4367 21.6551 2.7923 Constraint 182 557 13.5189 16.8987 25.3480 2.7923 Constraint 461 668 14.2481 17.8101 26.7152 2.7872 Constraint 461 651 11.5621 14.4527 21.6790 2.7872 Constraint 461 644 11.1264 13.9080 20.8620 2.7872 Constraint 449 668 14.5718 18.2147 27.3220 2.7872 Constraint 449 644 11.7265 14.6581 21.9871 2.7872 Constraint 221 651 13.8443 17.3053 25.9580 2.7820 Constraint 226 585 12.4520 15.5650 23.3475 2.7788 Constraint 221 571 10.2477 12.8096 19.2144 2.7788 Constraint 599 713 8.7654 10.9568 16.4352 2.6629 Constraint 571 713 10.2855 12.8568 19.2852 2.6629 Constraint 544 636 14.7308 18.4135 27.6202 2.6334 Constraint 113 267 14.0947 17.6184 26.4276 2.6146 Constraint 161 651 12.6817 15.8521 23.7781 2.5968 Constraint 128 651 9.8717 12.3396 18.5094 2.5968 Constraint 80 577 13.0842 16.3552 24.5328 2.5963 Constraint 113 676 13.1697 16.4621 24.6932 2.5943 Constraint 497 687 11.9138 14.8922 22.3384 2.5710 Constraint 341 467 14.9417 18.6772 28.0158 2.5709 Constraint 497 636 9.6923 12.1154 18.1730 2.5698 Constraint 267 511 15.0059 18.7574 28.1361 2.5479 Constraint 250 511 12.1895 15.2368 22.8552 2.5479 Constraint 237 519 10.2084 12.7605 19.1408 2.5479 Constraint 226 535 14.6899 18.3624 27.5435 2.5479 Constraint 226 511 12.5971 15.7464 23.6196 2.5479 Constraint 221 511 11.8550 14.8188 22.2281 2.5479 Constraint 201 519 12.3622 15.4528 23.1792 2.5479 Constraint 201 511 12.5551 15.6938 23.5408 2.5479 Constraint 182 511 13.4037 16.7546 25.1320 2.5479 Constraint 176 519 14.6154 18.2693 27.4039 2.5479 Constraint 169 519 11.4646 14.3308 21.4961 2.5479 Constraint 136 636 7.8595 9.8244 14.7366 2.4539 Constraint 489 698 10.4019 13.0024 19.5036 2.4029 Constraint 489 668 10.0708 12.5886 18.8828 2.4029 Constraint 535 651 11.3356 14.1695 21.2542 2.4028 Constraint 519 687 12.7513 15.9391 23.9087 2.4028 Constraint 314 698 12.3814 15.4768 23.2152 2.3952 Constraint 285 698 12.4884 15.6105 23.4158 2.3952 Constraint 267 698 13.1375 16.4219 24.6329 2.3952 Constraint 259 698 12.7611 15.9514 23.9270 2.3952 Constraint 221 698 13.0402 16.3003 24.4504 2.3952 Constraint 242 651 13.9815 17.4769 26.2154 2.3894 Constraint 242 668 13.0411 16.3014 24.4521 2.3875 Constraint 226 657 12.8221 16.0276 24.0414 2.3817 Constraint 221 657 11.0941 13.8676 20.8014 2.3817 Constraint 590 706 10.2211 12.7763 19.1645 2.3315 Constraint 585 706 12.0782 15.0977 22.6465 2.3315 Constraint 585 687 11.4713 14.3391 21.5087 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 571 706 8.9503 11.1879 16.7818 2.3315 Constraint 552 706 14.1486 17.6857 26.5286 2.3315 Constraint 535 706 13.1382 16.4227 24.6341 2.3315 Constraint 226 355 15.1880 18.9850 28.4776 2.3223 Constraint 190 355 15.0179 18.7724 28.1585 2.3223 Constraint 161 391 14.5712 18.2140 27.3210 2.3002 Constraint 144 668 12.3647 15.4559 23.1838 2.2630 Constraint 144 657 11.0792 13.8490 20.7735 2.2630 Constraint 144 651 12.1540 15.1925 22.7888 2.2630 Constraint 144 644 11.4335 14.2918 21.4378 2.2630 Constraint 144 636 9.3843 11.7304 17.5955 2.2630 Constraint 144 629 9.0009 11.2511 16.8766 2.2630 Constraint 237 480 13.2589 16.5737 24.8605 2.2144 Constraint 161 668 13.3221 16.6526 24.9789 2.1920 Constraint 136 676 12.0285 15.0356 22.5534 2.1920 Constraint 136 668 10.3614 12.9517 19.4276 2.1920 Constraint 136 651 9.5354 11.9192 17.8788 2.1920 Constraint 136 644 9.3581 11.6976 17.5464 2.1920 Constraint 128 676 11.9492 14.9365 22.4048 2.1920 Constraint 128 668 10.7631 13.4539 20.1808 2.1920 Constraint 128 644 9.0555 11.3194 16.9791 2.1920 Constraint 122 651 10.2654 12.8318 19.2477 2.1920 Constraint 96 676 13.2223 16.5278 24.7917 2.1920 Constraint 96 668 12.7114 15.8892 23.8338 2.1920 Constraint 96 657 10.3054 12.8818 19.3226 2.1920 Constraint 96 651 9.4922 11.8653 17.7979 2.1920 Constraint 96 644 10.9546 13.6932 20.5398 2.1920 Constraint 80 636 11.9829 14.9787 22.4680 2.1914 Constraint 80 629 9.7710 12.2138 18.3207 2.1914 Constraint 80 622 11.2755 14.0944 21.1416 2.1914 Constraint 80 613 12.1994 15.2493 22.8739 2.1914 Constraint 421 687 13.8678 17.3348 26.0021 2.1687 Constraint 360 668 12.0318 15.0397 22.5596 2.1459 Constraint 355 657 9.8707 12.3384 18.5076 2.1459 Constraint 242 544 10.3918 12.9898 19.4847 2.1431 Constraint 237 544 11.3781 14.2227 21.3340 2.1431 Constraint 201 544 13.2133 16.5166 24.7749 2.1431 Constraint 279 473 12.0329 15.0411 22.5616 2.0932 Constraint 279 467 10.8279 13.5349 20.3024 2.0932 Constraint 279 461 13.7077 17.1346 25.7019 2.0932 Constraint 272 467 9.3005 11.6257 17.4385 2.0932 Constraint 267 467 12.8439 16.0548 24.0823 2.0932 Constraint 176 535 12.3723 15.4653 23.1980 2.0932 Constraint 176 480 10.9418 13.6773 20.5159 2.0932 Constraint 161 480 7.1619 8.9524 13.4285 2.0932 Constraint 153 368 14.6597 18.3246 27.4870 2.0002 Constraint 497 676 11.3501 14.1877 21.2815 1.9981 Constraint 489 676 12.6621 15.8276 23.7414 1.9981 Constraint 480 706 12.2829 15.3536 23.0304 1.9981 Constraint 480 698 9.8229 12.2786 18.4179 1.9981 Constraint 480 687 12.0985 15.1231 22.6847 1.9981 Constraint 480 676 12.1720 15.2150 22.8225 1.9981 Constraint 473 706 11.2505 14.0631 21.0947 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 687 10.3057 12.8821 19.3231 1.9981 Constraint 473 676 10.3858 12.9822 19.4733 1.9981 Constraint 544 657 11.3592 14.1990 21.2985 1.9980 Constraint 544 651 11.5427 14.4283 21.6425 1.9980 Constraint 544 644 13.3011 16.6264 24.9395 1.9980 Constraint 622 729 11.3391 14.1739 21.2609 1.9962 Constraint 613 729 13.4003 16.7504 25.1256 1.9962 Constraint 613 720 13.4091 16.7613 25.1420 1.9962 Constraint 571 676 14.2406 17.8007 26.7011 1.9962 Constraint 571 668 13.3454 16.6817 25.0225 1.9962 Constraint 557 713 11.0265 13.7831 20.6747 1.9962 Constraint 557 698 12.2378 15.2973 22.9460 1.9962 Constraint 429 668 12.7435 15.9294 23.8941 1.9923 Constraint 303 698 11.8475 14.8093 22.2140 1.9904 Constraint 355 636 12.5132 15.6416 23.4623 1.9878 Constraint 350 636 13.3899 16.7374 25.1061 1.9878 Constraint 355 720 13.9462 17.4327 26.1491 1.9846 Constraint 350 720 12.5830 15.7287 23.5931 1.9846 Constraint 350 713 13.7189 17.1486 25.7229 1.9846 Constraint 350 676 14.2953 17.8691 26.8036 1.9846 Constraint 341 720 10.9728 13.7160 20.5740 1.9846 Constraint 330 735 14.3219 17.9024 26.8536 1.9846 Constraint 330 729 13.7593 17.1991 25.7986 1.9846 Constraint 330 720 9.5377 11.9221 17.8831 1.9846 Constraint 322 720 13.0323 16.2904 24.4355 1.9846 Constraint 297 729 14.6404 18.3005 27.4508 1.9846 Constraint 297 720 10.5132 13.1415 19.7122 1.9846 Constraint 292 720 14.5620 18.2026 27.3038 1.9846 Constraint 285 676 13.6662 17.0828 25.6241 1.9846 Constraint 279 720 12.1029 15.1287 22.6930 1.9846 Constraint 279 713 12.1520 15.1899 22.7849 1.9846 Constraint 272 720 13.5825 16.9782 25.4672 1.9846 Constraint 272 713 12.4496 15.5619 23.3429 1.9846 Constraint 267 676 14.2774 17.8468 26.7701 1.9846 Constraint 221 713 15.1487 18.9358 28.4038 1.9846 Constraint 210 713 14.7464 18.4330 27.6494 1.9846 Constraint 201 706 13.6475 17.0593 25.5890 1.9846 Constraint 190 713 14.0991 17.6239 26.4358 1.9846 Constraint 182 720 13.0729 16.3411 24.5117 1.9846 Constraint 182 713 10.7340 13.4174 20.1262 1.9846 Constraint 176 713 12.8130 16.0163 24.0244 1.9846 Constraint 169 713 14.7777 18.4722 27.7082 1.9846 Constraint 285 557 11.9176 14.8970 22.3455 1.9827 Constraint 303 636 12.3672 15.4590 23.1885 1.9801 Constraint 279 636 12.5267 15.6583 23.4875 1.9801 Constraint 267 636 14.7547 18.4434 27.6651 1.9801 Constraint 527 636 11.8476 14.8095 22.2142 1.9777 Constraint 279 657 11.4814 14.3518 21.5277 1.9769 Constraint 267 657 13.2406 16.5507 24.8260 1.9769 Constraint 527 698 10.0694 12.5867 18.8801 1.9759 Constraint 527 687 9.9418 12.4272 18.6409 1.9759 Constraint 527 676 11.2431 14.0539 21.0809 1.9759 Constraint 527 668 9.2554 11.5693 17.3539 1.9759 Constraint 519 676 13.6823 17.1029 25.6544 1.9759 Constraint 519 668 11.0903 13.8628 20.7942 1.9759 Constraint 519 644 11.9898 14.9872 22.4808 1.9759 Constraint 511 668 10.9288 13.6611 20.4916 1.9759 Constraint 511 657 9.9054 12.3817 18.5726 1.9759 Constraint 511 644 11.8123 14.7654 22.1481 1.9759 Constraint 285 651 14.2835 17.8544 26.7816 1.9724 Constraint 279 651 12.7709 15.9636 23.9455 1.9724 Constraint 272 571 10.9814 13.7267 20.5900 1.9692 Constraint 267 585 12.4279 15.5349 23.3023 1.9692 Constraint 267 571 9.7471 12.1839 18.2759 1.9692 Constraint 250 585 10.4917 13.1147 19.6720 1.9692 Constraint 226 571 9.2552 11.5690 17.3535 1.9692 Constraint 201 571 11.0086 13.7608 20.6411 1.9692 Constraint 190 571 12.3536 15.4420 23.1630 1.9692 Constraint 182 571 11.4098 14.2622 21.3934 1.9692 Constraint 176 571 13.5089 16.8862 25.3293 1.9692 Constraint 153 644 11.1258 13.9072 20.8608 1.8812 Constraint 153 622 10.9588 13.6985 20.5478 1.8812 Constraint 153 613 10.5444 13.1805 19.7707 1.8812 Constraint 96 571 11.2767 14.0959 21.1438 1.8096 Constraint 96 557 10.6861 13.3577 20.0365 1.8096 Constraint 292 552 8.9778 11.2222 16.8333 1.7942 Constraint 259 557 10.9337 13.6671 20.5006 1.7942 Constraint 259 552 9.0173 11.2716 16.9074 1.7942 Constraint 250 557 11.5779 14.4724 21.7086 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 237 651 11.4341 14.2926 21.4390 1.7942 Constraint 237 557 10.8597 13.5747 20.3620 1.7942 Constraint 237 552 9.7078 12.1348 18.2022 1.7942 Constraint 226 651 13.2206 16.5258 24.7886 1.7942 Constraint 226 557 13.5689 16.9611 25.4416 1.7942 Constraint 226 552 12.0298 15.0373 22.5559 1.7942 Constraint 221 557 11.8019 14.7524 22.1286 1.7942 Constraint 221 552 9.9863 12.4829 18.7243 1.7942 Constraint 210 552 8.3974 10.4968 15.7451 1.7942 Constraint 201 557 13.4240 16.7800 25.1700 1.7942 Constraint 201 552 12.2026 15.2533 22.8799 1.7942 Constraint 190 552 13.5052 16.8815 25.3222 1.7942 Constraint 461 676 13.5810 16.9762 25.4643 1.7872 Constraint 449 676 12.2674 15.3343 23.0014 1.7872 Constraint 442 676 14.9870 18.7338 28.1006 1.7872 Constraint 435 644 13.6184 17.0230 25.5346 1.6667 Constraint 599 729 10.2283 12.7854 19.1781 1.6648 Constraint 590 729 12.0658 15.0822 22.6233 1.6648 Constraint 590 720 12.4041 15.5051 23.2577 1.6648 Constraint 590 713 9.0496 11.3120 16.9680 1.6648 Constraint 577 729 12.8341 16.0426 24.0639 1.6648 Constraint 577 720 11.4410 14.3012 21.4518 1.6648 Constraint 577 713 8.9813 11.2266 16.8399 1.6648 Constraint 571 735 14.1857 17.7321 26.5982 1.6648 Constraint 571 729 10.5821 13.2276 19.8414 1.6648 Constraint 571 720 10.6241 13.2801 19.9202 1.6648 Constraint 544 713 13.2374 16.5468 24.8201 1.6648 Constraint 535 729 13.5030 16.8787 25.3181 1.6648 Constraint 535 720 14.3249 17.9061 26.8591 1.6648 Constraint 535 713 11.7108 14.6385 21.9577 1.6648 Constraint 511 729 12.9557 16.1946 24.2919 1.6648 Constraint 442 668 14.5930 18.2412 27.3619 1.6590 Constraint 144 676 13.5375 16.9219 25.3829 1.5963 Constraint 113 687 12.7264 15.9080 23.8621 1.5938 Constraint 104 687 11.5848 14.4810 21.7215 1.5938 Constraint 88 687 12.5816 15.7270 23.5905 1.5938 Constraint 412 687 13.2828 16.6035 24.9053 1.5730 Constraint 412 668 13.4197 16.7746 25.1620 1.5730 Constraint 391 698 14.1791 17.7239 26.5859 1.5730 Constraint 391 687 12.1075 15.1344 22.7015 1.5730 Constraint 391 668 11.9947 14.9934 22.4901 1.5730 Constraint 368 687 11.2921 14.1152 21.1727 1.5730 Constraint 360 698 13.7527 17.1909 25.7864 1.5730 Constraint 360 687 12.0772 15.0966 22.6448 1.5730 Constraint 355 687 12.7945 15.9931 23.9897 1.5730 Constraint 355 676 14.5474 18.1842 27.2763 1.5730 Constraint 629 735 8.8340 11.0425 16.5637 1.5710 Constraint 511 651 11.8954 14.8692 22.3039 1.5710 Constraint 355 706 14.5309 18.1636 27.2454 1.5653 Constraint 350 698 14.0713 17.5891 26.3837 1.5653 Constraint 350 668 12.4299 15.5373 23.3060 1.5653 Constraint 153 651 12.1423 15.1779 22.7668 1.4763 Constraint 80 571 12.8119 16.0149 24.0224 1.4048 Constraint 80 557 12.1466 15.1832 22.7749 1.4048 Constraint 535 636 14.4257 18.0321 27.0482 1.4048 Constraint 535 668 9.0224 11.2780 16.9169 1.4029 Constraint 535 657 7.2637 9.0797 13.6195 1.4029 Constraint 535 644 9.3864 11.7330 17.5995 1.4029 Constraint 519 698 9.4958 11.8698 17.8047 1.4029 Constraint 250 698 12.3882 15.4852 23.2279 1.4029 Constraint 250 668 13.9582 17.4478 26.1717 1.4029 Constraint 242 698 11.5124 14.3905 21.5857 1.4029 Constraint 242 687 14.3197 17.8996 26.8494 1.4029 Constraint 242 676 14.1668 17.7085 26.5627 1.4029 Constraint 122 698 13.8632 17.3289 25.9934 1.4029 Constraint 104 698 12.6273 15.7841 23.6762 1.4029 Constraint 210 698 11.5166 14.3957 21.5936 1.3971 Constraint 201 698 11.0506 13.8132 20.7198 1.3971 Constraint 250 644 12.9560 16.1950 24.2925 1.3894 Constraint 242 644 9.4810 11.8513 17.7769 1.3894 Constraint 544 706 11.9397 14.9246 22.3869 1.3335 Constraint 272 511 15.1332 18.9166 28.3748 1.3335 Constraint 190 511 13.6668 17.0836 25.6253 1.3335 Constraint 176 511 12.4200 15.5250 23.2875 1.3335 Constraint 161 706 12.9910 16.2388 24.3582 1.3335 Constraint 161 519 11.4665 14.3332 21.4998 1.3335 Constraint 161 511 9.9317 12.4146 18.6219 1.3335 Constraint 153 706 13.9148 17.3935 26.0902 1.3335 Constraint 144 706 14.3802 17.9752 26.9628 1.3335 Constraint 136 382 10.9813 13.7266 20.5899 1.2981 Constraint 279 519 14.4759 18.0949 27.1423 1.2144 Constraint 272 519 13.0663 16.3329 24.4994 1.2144 Constraint 267 519 12.3521 15.4401 23.1601 1.2144 Constraint 267 489 9.3743 11.7178 17.5767 1.2144 Constraint 250 519 7.1876 8.9845 13.4767 1.2144 Constraint 250 480 7.1196 8.8995 13.3492 1.2144 Constraint 226 519 9.6801 12.1001 18.1502 1.2144 Constraint 226 489 9.3572 11.6965 17.5447 1.2144 Constraint 226 480 11.7837 14.7296 22.0944 1.2144 Constraint 190 519 12.2729 15.3412 23.0117 1.2144 Constraint 190 489 10.9236 13.6545 20.4817 1.2144 Constraint 80 676 11.5458 14.4323 21.6484 1.1914 Constraint 80 668 12.2359 15.2948 22.9423 1.1914 Constraint 80 657 8.6727 10.8409 16.2613 1.1914 Constraint 80 651 7.3178 9.1473 13.7209 1.1914 Constraint 80 644 11.2896 14.1120 21.1680 1.1914 Constraint 442 687 14.1465 17.6832 26.5247 1.1687 Constraint 355 668 9.6082 12.0102 18.0153 1.1459 Constraint 350 644 12.7607 15.9509 23.9263 1.1459 Constraint 237 729 12.8077 16.0096 24.0145 1.0715 Constraint 226 729 14.0097 17.5122 26.2682 1.0715 Constraint 201 742 11.9025 14.8781 22.3172 1.0715 Constraint 201 735 12.3761 15.4701 23.2051 1.0715 Constraint 201 729 11.2525 14.0656 21.0984 1.0715 Constraint 201 720 13.4999 16.8749 25.3123 1.0715 Constraint 190 735 14.5357 18.1696 27.2544 1.0715 Constraint 176 742 11.9922 14.9902 22.4853 1.0715 Constraint 176 735 12.4912 15.6140 23.4210 1.0715 Constraint 176 729 12.3370 15.4212 23.1319 1.0715 Constraint 169 729 11.8301 14.7876 22.1815 1.0715 Constraint 169 720 12.9801 16.2251 24.3377 1.0715 Constraint 161 742 11.0485 13.8107 20.7160 1.0715 Constraint 161 735 10.8157 13.5196 20.2794 1.0715 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 161 720 10.3047 12.8809 19.3214 1.0715 Constraint 153 729 11.8672 14.8340 22.2509 1.0715 Constraint 153 720 12.0457 15.0571 22.5857 1.0715 Constraint 153 668 11.8279 14.7849 22.1773 1.0715 Constraint 153 657 12.1059 15.1323 22.6985 1.0715 Constraint 153 636 10.4342 13.0427 19.5641 1.0715 Constraint 153 629 10.0957 12.6196 18.9294 1.0715 Constraint 355 544 11.2518 14.0647 21.0971 1.0163 Constraint 350 544 9.6767 12.0958 18.1437 1.0163 Constraint 69 577 13.9825 17.4781 26.2171 1.0163 Constraint 58 382 12.4270 15.5338 23.3007 1.0163 Constraint 58 267 14.8008 18.5010 27.7515 1.0163 Constraint 58 250 13.9829 17.4786 26.2179 1.0163 Constraint 58 237 15.1981 18.9976 28.4965 1.0163 Constraint 51 382 13.7682 17.2103 25.8154 1.0163 Constraint 51 375 10.0852 12.6065 18.9097 1.0163 Constraint 51 285 9.7781 12.2226 18.3339 1.0163 Constraint 51 279 13.9507 17.4384 26.1576 1.0163 Constraint 51 272 14.7981 18.4977 27.7465 1.0163 Constraint 51 267 12.8363 16.0454 24.0681 1.0163 Constraint 51 259 9.1874 11.4842 17.2263 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 242 8.0307 10.0384 15.0575 1.0163 Constraint 51 237 11.5867 14.4834 21.7251 1.0163 Constraint 51 226 14.0355 17.5444 26.3166 1.0163 Constraint 51 221 12.1783 15.2229 22.8343 1.0163 Constraint 51 182 14.2975 17.8719 26.8078 1.0163 Constraint 51 169 14.2008 17.7511 26.6266 1.0163 Constraint 41 375 13.3894 16.7368 25.1052 1.0163 Constraint 41 303 14.7562 18.4452 27.6678 1.0163 Constraint 41 292 15.0292 18.7865 28.1798 1.0163 Constraint 41 285 12.9875 16.2344 24.3516 1.0163 Constraint 41 259 11.8259 14.7823 22.1735 1.0163 Constraint 41 250 11.3244 14.1556 21.2333 1.0163 Constraint 41 242 10.4645 13.0807 19.6210 1.0163 Constraint 41 237 13.6592 17.0740 25.6110 1.0163 Constraint 41 221 15.1614 18.9518 28.4277 1.0163 Constraint 41 210 14.4949 18.1186 27.1780 1.0163 Constraint 136 687 13.0106 16.2633 24.3949 1.0005 Constraint 128 687 13.1704 16.4630 24.6945 1.0005 Constraint 122 687 13.7562 17.1953 25.7929 1.0005 Constraint 122 676 11.8824 14.8530 22.2794 1.0005 Constraint 96 687 14.0483 17.5604 26.3406 1.0005 Constraint 467 706 14.4293 18.0366 27.0550 1.0000 Constraint 467 698 11.4986 14.3733 21.5599 1.0000 Constraint 467 687 13.2135 16.5168 24.7752 1.0000 Constraint 467 676 13.0097 16.2622 24.3933 1.0000 Constraint 461 698 14.6299 18.2874 27.4310 1.0000 Constraint 435 698 12.6245 15.7806 23.6709 1.0000 Constraint 435 687 13.4996 16.8745 25.3117 1.0000 Constraint 435 668 12.8660 16.0825 24.1238 1.0000 Constraint 429 698 11.7026 14.6283 21.9424 1.0000 Constraint 429 687 12.2809 15.3511 23.0266 1.0000 Constraint 421 698 14.6171 18.2714 27.4071 1.0000 Constraint 412 698 13.2225 16.5282 24.7923 1.0000 Constraint 412 676 15.0632 18.8290 28.2435 1.0000 Constraint 404 706 12.6616 15.8270 23.7404 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 687 8.6870 10.8587 16.2881 1.0000 Constraint 404 676 10.9343 13.6678 20.5017 1.0000 Constraint 399 706 14.0172 17.5215 26.2822 1.0000 Constraint 399 698 11.3454 14.1818 21.2726 1.0000 Constraint 399 687 10.0466 12.5582 18.8373 1.0000 Constraint 399 676 11.0780 13.8474 20.7712 1.0000 Constraint 391 676 13.9218 17.4023 26.1034 1.0000 Constraint 382 706 13.8797 17.3496 26.0244 1.0000 Constraint 382 698 10.8883 13.6103 20.4155 1.0000 Constraint 382 687 8.7387 10.9234 16.3851 1.0000 Constraint 382 676 11.7533 14.6916 22.0374 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 687 5.9127 7.3909 11.0863 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 368 706 14.5687 18.2109 27.3164 1.0000 Constraint 368 698 12.6523 15.8153 23.7230 1.0000 Constraint 368 676 11.3301 14.1626 21.2439 1.0000 Constraint 360 676 12.8172 16.0216 24.0323 1.0000 Constraint 629 742 7.6822 9.6027 14.4041 0.9981 Constraint 622 742 11.4098 14.2622 21.3933 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 604 742 8.0595 10.0744 15.1116 0.9981 Constraint 604 735 8.8596 11.0744 16.6117 0.9981 Constraint 599 742 11.4013 14.2516 21.3774 0.9981 Constraint 599 735 10.9187 13.6484 20.4725 0.9981 Constraint 590 742 13.6744 17.0930 25.6395 0.9981 Constraint 590 735 13.3750 16.7187 25.0781 0.9981 Constraint 585 742 12.4589 15.5736 23.3604 0.9981 Constraint 585 735 13.6112 17.0140 25.5210 0.9981 Constraint 585 729 13.9763 17.4704 26.2057 0.9981 Constraint 585 720 13.7889 17.2361 25.8541 0.9981 Constraint 585 713 9.0195 11.2744 16.9116 0.9981 Constraint 577 676 11.9189 14.8986 22.3479 0.9981 Constraint 557 742 15.0244 18.7805 28.1708 0.9981 Constraint 557 735 12.2675 15.3343 23.0015 0.9981 Constraint 557 729 13.6105 17.0131 25.5197 0.9981 Constraint 557 720 14.2375 17.7969 26.6954 0.9981 Constraint 557 676 11.4879 14.3598 21.5397 0.9981 Constraint 557 668 10.3037 12.8796 19.3194 0.9981 Constraint 552 735 13.8193 17.2741 25.9111 0.9981 Constraint 552 713 13.4750 16.8438 25.2657 0.9981 Constraint 552 698 10.9559 13.6949 20.5423 0.9981 Constraint 552 687 10.8262 13.5327 20.2990 0.9981 Constraint 552 676 13.7563 17.1954 25.7931 0.9981 Constraint 552 668 12.1345 15.1682 22.7522 0.9981 Constraint 544 735 12.5709 15.7136 23.5704 0.9981 Constraint 544 698 11.5817 14.4771 21.7156 0.9981 Constraint 544 676 14.4019 18.0024 27.0036 0.9981 Constraint 544 668 11.6643 14.5804 21.8706 0.9981 Constraint 535 742 11.6473 14.5592 21.8388 0.9981 Constraint 535 735 8.9201 11.1501 16.7251 0.9981 Constraint 535 698 8.6861 10.8576 16.2864 0.9981 Constraint 535 687 9.2070 11.5087 17.2631 0.9981 Constraint 535 676 10.4339 13.0423 19.5635 0.9981 Constraint 527 742 13.5141 16.8926 25.3389 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 729 13.5009 16.8761 25.3142 0.9981 Constraint 527 720 13.3832 16.7289 25.0934 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 527 706 10.1745 12.7181 19.0772 0.9981 Constraint 519 742 14.9527 18.6909 28.0363 0.9981 Constraint 519 735 11.1465 13.9331 20.8997 0.9981 Constraint 519 729 14.3587 17.9484 26.9226 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 519 706 12.2041 15.2551 22.8827 0.9981 Constraint 511 742 11.6193 14.5241 21.7861 0.9981 Constraint 511 735 8.6213 10.7766 16.1649 0.9981 Constraint 511 720 13.7507 17.1884 25.7825 0.9981 Constraint 511 713 9.0139 11.2673 16.9010 0.9981 Constraint 511 706 12.4253 15.5316 23.2974 0.9981 Constraint 511 698 8.7420 10.9275 16.3912 0.9981 Constraint 511 687 11.0652 13.8315 20.7473 0.9981 Constraint 511 676 12.2781 15.3476 23.0214 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 497 706 8.3556 10.4446 15.6668 0.9981 Constraint 497 698 4.7218 5.9023 8.8534 0.9981 Constraint 489 742 12.8183 16.0229 24.0343 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 720 11.4156 14.2695 21.4043 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 489 706 8.2414 10.3018 15.4527 0.9981 Constraint 489 687 8.4643 10.5803 15.8705 0.9981 Constraint 480 742 12.9188 16.1485 24.2228 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 720 13.4710 16.8388 25.2581 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 314 720 13.7885 17.2356 25.8534 0.9981 Constraint 314 687 12.0074 15.0093 22.5140 0.9981 Constraint 303 687 14.1499 17.6873 26.5310 0.9981 Constraint 285 720 15.1550 18.9437 28.4156 0.9981 Constraint 285 713 13.1019 16.3773 24.5660 0.9981 Constraint 285 687 14.1882 17.7353 26.6029 0.9981 Constraint 259 713 14.8390 18.5488 27.8232 0.9981 Constraint 259 687 14.5203 18.1504 27.2256 0.9981 Constraint 242 706 14.7702 18.4628 27.6942 0.9981 Constraint 144 382 13.9315 17.4144 26.1215 0.9981 Constraint 113 713 14.6851 18.3564 27.5346 0.9981 Constraint 113 698 13.9365 17.4206 26.1309 0.9981 Constraint 104 713 11.7284 14.6605 21.9907 0.9981 Constraint 104 706 13.1073 16.3842 24.5762 0.9981 Constraint 88 713 12.7865 15.9832 23.9747 0.9981 Constraint 88 706 12.6872 15.8590 23.7885 0.9981 Constraint 88 698 10.4801 13.1001 19.6501 0.9981 Constraint 279 622 13.2206 16.5257 24.7886 0.9878 Constraint 279 613 14.7121 18.3901 27.5852 0.9878 Constraint 267 651 13.5224 16.9030 25.3545 0.9878 Constraint 279 557 13.8901 17.3627 26.0440 0.9846 Constraint 272 557 13.8066 17.2582 25.8873 0.9846 Constraint 267 557 12.7585 15.9481 23.9222 0.9846 Constraint 259 651 14.3365 17.9206 26.8809 0.9846 Constraint 519 636 9.9181 12.3977 18.5965 0.9778 Constraint 113 279 13.0300 16.2875 24.4312 0.8957 Constraint 382 544 13.3153 16.6441 24.9662 0.8096 Constraint 368 544 14.9687 18.7109 28.0663 0.8096 Constraint 259 544 12.5763 15.7204 23.5806 0.8096 Constraint 250 544 11.6904 14.6130 21.9195 0.8096 Constraint 226 544 13.4433 16.8042 25.2062 0.8096 Constraint 221 544 12.2386 15.2983 22.9475 0.8096 Constraint 190 557 14.5969 18.2462 27.3693 0.8096 Constraint 176 557 14.1181 17.6476 26.4715 0.8096 Constraint 176 552 12.4742 15.5927 23.3891 0.8096 Constraint 544 729 12.9019 16.1274 24.1911 0.6667 Constraint 544 720 12.6604 15.8255 23.7383 0.6667 Constraint 237 742 12.1392 15.1740 22.7609 0.6667 Constraint 237 735 14.2288 17.7860 26.6790 0.6667 Constraint 226 742 12.6866 15.8582 23.7873 0.6667 Constraint 226 735 15.1496 18.9370 28.4056 0.6667 Constraint 210 742 14.4409 18.0512 27.0768 0.6667 Constraint 190 742 12.8160 16.0200 24.0300 0.6667 Constraint 169 742 11.2226 14.0283 21.0425 0.6667 Constraint 169 735 11.7239 14.6549 21.9823 0.6667 Constraint 161 713 12.5922 15.7403 23.6104 0.6667 Constraint 153 742 12.1154 15.1443 22.7164 0.6667 Constraint 153 735 11.9781 14.9726 22.4588 0.6667 Constraint 153 713 14.0784 17.5981 26.3971 0.6667 Constraint 144 742 15.0435 18.8044 28.2066 0.6667 Constraint 144 735 13.9828 17.4785 26.2178 0.6667 Constraint 144 729 13.7368 17.1710 25.7565 0.6667 Constraint 144 720 12.8521 16.0651 24.0977 0.6667 Constraint 136 742 14.8526 18.5657 27.8486 0.6667 Constraint 136 735 13.6536 17.0670 25.6005 0.6667 Constraint 136 729 14.8572 18.5715 27.8572 0.6667 Constraint 136 720 13.9665 17.4581 26.1872 0.6667 Constraint 128 742 14.8056 18.5070 27.7605 0.6667 Constraint 128 735 14.6901 18.3626 27.5439 0.6667 Constraint 461 687 14.6190 18.2738 27.4106 0.5957 Constraint 449 687 12.4188 15.5235 23.2852 0.5957 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 391 742 12.6700 15.8375 23.7562 0.5730 Constraint 391 735 13.3728 16.7159 25.0739 0.5730 Constraint 382 742 14.9153 18.6442 27.9663 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 735 13.3124 16.6405 24.9608 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 360 735 12.5408 15.6760 23.5140 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 355 698 11.0780 13.8475 20.7712 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 350 735 12.6027 15.7534 23.6301 0.5730 Constraint 350 687 13.7045 17.1306 25.6959 0.5730 Constraint 341 742 12.2541 15.3177 22.9765 0.5730 Constraint 341 735 13.4893 16.8616 25.2924 0.5730 Constraint 272 729 14.0280 17.5351 26.3026 0.4048 Constraint 250 687 14.1963 17.7454 26.6180 0.4048 Constraint 250 676 15.1397 18.9246 28.3869 0.4048 Constraint 250 657 12.2311 15.2888 22.9332 0.4048 Constraint 237 720 13.4446 16.8058 25.2087 0.4048 Constraint 237 698 4.3036 5.3795 8.0693 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 237 676 8.4658 10.5822 15.8733 0.4048 Constraint 226 720 14.7331 18.4163 27.6245 0.4048 Constraint 226 698 6.4367 8.0458 12.0687 0.4048 Constraint 226 687 10.6659 13.3324 19.9986 0.4048 Constraint 226 676 10.9952 13.7440 20.6159 0.4048 Constraint 221 729 14.6076 18.2596 27.3893 0.4048 Constraint 221 687 12.9314 16.1643 24.2465 0.4048 Constraint 210 729 13.2184 16.5230 24.7844 0.4048 Constraint 210 720 14.7114 18.3893 27.5839 0.4048 Constraint 210 687 10.0080 12.5100 18.7650 0.4048 Constraint 201 687 8.3711 10.4639 15.6959 0.4048 Constraint 190 729 11.2529 14.0661 21.0991 0.4048 Constraint 190 720 14.4045 18.0056 27.0085 0.4048 Constraint 182 729 13.8402 17.3002 25.9503 0.4048 Constraint 176 720 12.3195 15.3993 23.0990 0.4048 Constraint 161 698 11.5867 14.4834 21.7251 0.4048 Constraint 161 687 12.2665 15.3331 22.9997 0.4048 Constraint 161 676 8.0481 10.0601 15.0902 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 144 698 13.7421 17.1776 25.7664 0.4048 Constraint 144 687 13.5342 16.9178 25.3767 0.4048 Constraint 136 698 14.0537 17.5672 26.3508 0.4048 Constraint 128 729 14.1043 17.6304 26.4456 0.4048 Constraint 128 698 10.4838 13.1047 19.6570 0.4048 Constraint 96 698 12.6741 15.8426 23.7640 0.4048 Constraint 33 382 13.4922 16.8653 25.2979 0.3388 Constraint 33 375 11.0191 13.7738 20.6608 0.3388 Constraint 33 368 13.2850 16.6062 24.9093 0.3388 Constraint 33 292 13.1632 16.4540 24.6810 0.3388 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 279 13.8904 17.3630 26.0445 0.3388 Constraint 33 267 12.1135 15.1419 22.7129 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 33 237 13.1593 16.4492 24.6737 0.3388 Constraint 33 226 14.5041 18.1302 27.1952 0.3388 Constraint 33 221 13.0255 16.2819 24.4228 0.3388 Constraint 33 210 13.7334 17.1667 25.7501 0.3388 Constraint 176 382 14.9138 18.6422 27.9633 0.3000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 735 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 742 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 720 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 742 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 720 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 676 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 706 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 742 0.8000 1.0000 1.5000 0.0000 Constraint 421 735 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 706 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 742 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 742 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 706 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 713 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 613 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 729 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 729 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 544 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 729 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 720 0.8000 1.0000 1.5000 0.0000 Constraint 267 713 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 742 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 713 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 706 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 742 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 735 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 355 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 535 0.8000 1.0000 1.5000 0.0000 Constraint 190 375 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 742 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 355 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 375 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 360 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 285 0.8000 1.0000 1.5000 0.0000 Constraint 161 279 0.8000 1.0000 1.5000 0.0000 Constraint 161 267 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 375 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 713 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 368 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 303 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 267 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 355 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 720 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 706 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 544 0.8000 1.0000 1.5000 0.0000 Constraint 69 535 0.8000 1.0000 1.5000 0.0000 Constraint 69 226 0.8000 1.0000 1.5000 0.0000 Constraint 69 190 0.8000 1.0000 1.5000 0.0000 Constraint 69 161 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 272 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 435 0.8000 1.0000 1.5000 0.0000 Constraint 51 412 0.8000 1.0000 1.5000 0.0000 Constraint 51 201 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 449 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 368 0.8000 1.0000 1.5000 0.0000 Constraint 41 350 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 267 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 144 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 461 0.8000 1.0000 1.5000 0.0000 Constraint 33 449 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 429 0.8000 1.0000 1.5000 0.0000 Constraint 33 421 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 404 0.8000 1.0000 1.5000 0.0000 Constraint 33 391 0.8000 1.0000 1.5000 0.0000 Constraint 33 297 0.8000 1.0000 1.5000 0.0000 Constraint 33 272 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 144 0.8000 1.0000 1.5000 0.0000 Constraint 33 136 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: