# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 18.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 176 303 12.5955 15.7443 23.6165 88.4470 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 303 13.3123 16.6403 24.9605 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 176 250 12.6418 15.8022 23.7034 87.7035 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 176 314 11.6621 14.5776 21.8664 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 285 12.3216 15.4020 23.1030 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 303 12.9819 16.2274 24.3411 84.8820 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 237 303 13.2863 16.6079 24.9118 82.8819 Constraint 237 322 11.7486 14.6858 22.0286 82.8770 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 169 267 12.6140 15.7674 23.6512 82.8523 Constraint 210 330 10.9683 13.7104 20.5655 82.7317 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 292 429 10.4716 13.0895 19.6342 82.0719 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 297 421 9.8861 12.3577 18.5365 81.3738 Constraint 182 341 10.9744 13.7180 20.5770 81.3023 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 285 404 11.5874 14.4842 21.7264 81.2632 Constraint 259 330 11.3543 14.1929 21.2893 80.7315 Constraint 303 412 11.6876 14.6094 21.9142 80.2786 Constraint 169 303 13.4233 16.7791 25.1686 80.2591 Constraint 176 330 12.2910 15.3638 23.0457 80.1608 Constraint 250 322 13.2440 16.5550 24.8326 80.1275 Constraint 190 330 12.5317 15.6646 23.4969 80.0735 Constraint 285 429 12.0411 15.0514 22.5771 80.0717 Constraint 285 350 7.4395 9.2994 13.9491 80.0270 Constraint 169 279 13.1334 16.4167 24.6250 80.0156 Constraint 267 330 11.1639 13.9549 20.9323 79.9388 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 226 322 12.2680 15.3350 23.0025 79.8770 Constraint 221 330 11.1382 13.9227 20.8841 79.7317 Constraint 292 421 6.5351 8.1689 12.2533 79.6366 Constraint 297 399 12.0111 15.0139 22.5209 79.4761 Constraint 182 399 12.8240 16.0299 24.0449 79.4761 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 285 421 8.2255 10.2818 15.4227 79.3366 Constraint 259 421 7.0821 8.8527 13.2790 79.3366 Constraint 259 341 11.0268 13.7834 20.6752 79.3021 Constraint 297 412 12.4100 15.5125 23.2687 79.2806 Constraint 210 404 11.1355 13.9194 20.8791 79.2443 Constraint 242 330 12.7833 15.9791 23.9687 79.2152 Constraint 259 404 10.2098 12.7623 19.1434 78.9631 Constraint 161 292 12.3803 15.4753 23.2130 78.9048 Constraint 210 341 12.3263 15.4078 23.1118 78.7314 Constraint 210 421 5.9785 7.4732 11.2097 78.6385 Constraint 182 421 9.1384 11.4230 17.1344 78.6385 Constraint 279 341 8.7088 10.8860 16.3290 78.5094 Constraint 267 341 11.0384 13.7980 20.6970 78.5094 Constraint 242 429 8.3095 10.3869 15.5804 78.3910 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 210 429 9.1464 11.4330 17.1495 78.3386 Constraint 176 421 11.2097 14.0122 21.0183 78.3386 Constraint 259 399 9.3808 11.7260 17.5890 77.8807 Constraint 292 412 8.7352 10.9190 16.3786 77.5617 Constraint 285 412 9.0236 11.2795 16.9192 77.5617 Constraint 314 435 11.4413 14.3017 21.4525 77.4754 Constraint 242 421 4.9975 6.2469 9.3703 77.3930 Constraint 292 435 11.3350 14.1688 21.2532 77.3703 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 259 429 10.6781 13.3476 20.0214 77.3364 Constraint 242 404 8.1569 10.1961 15.2941 77.2824 Constraint 169 330 12.9885 16.2356 24.3535 77.2069 Constraint 210 399 10.2472 12.8090 19.2135 77.1456 Constraint 330 399 11.8276 14.7845 22.1767 76.9691 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 292 355 10.9572 13.6965 20.5447 76.8450 Constraint 210 412 8.0753 10.0941 15.1412 76.5453 Constraint 128 297 9.2039 11.5049 17.2573 76.5309 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 259 10.6591 13.3239 19.9858 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 297 8.7699 10.9623 16.4435 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 210 435 9.2240 11.5300 17.2949 76.3539 Constraint 259 412 6.7206 8.4008 12.6012 76.2453 Constraint 182 412 11.6555 14.5694 21.8541 76.2453 Constraint 182 429 12.4959 15.6199 23.4299 76.0818 Constraint 161 272 13.1690 16.4612 24.6918 76.0680 Constraint 272 341 11.1259 13.9073 20.8610 75.9385 Constraint 128 303 11.5687 14.4609 21.6913 75.9352 Constraint 128 285 11.3400 14.1749 21.2624 75.9352 Constraint 128 272 10.0251 12.5314 18.7970 75.9352 Constraint 104 303 10.3964 12.9955 19.4932 75.9352 Constraint 104 272 11.5379 14.4224 21.6335 75.9352 Constraint 242 399 8.2128 10.2660 15.3990 75.9001 Constraint 242 341 12.6952 15.8691 23.8036 75.7856 Constraint 221 341 11.9404 14.9255 22.3882 75.7314 Constraint 169 421 8.9878 11.2348 16.8522 75.7127 Constraint 237 421 7.4477 9.3096 13.9644 75.6803 Constraint 201 421 9.7702 12.2128 18.3192 75.6803 Constraint 190 421 11.1614 13.9518 20.9276 75.6803 Constraint 128 279 12.5535 15.6919 23.5379 75.6352 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 104 242 11.4981 14.3726 21.5589 75.5853 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 136 292 10.8565 13.5706 20.3559 75.5603 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 272 421 10.4808 13.1010 19.6515 75.5457 Constraint 267 421 10.5227 13.1533 19.7300 75.5457 Constraint 279 350 9.1911 11.4889 17.2334 75.5152 Constraint 250 421 8.7290 10.9113 16.3670 75.5018 Constraint 169 429 10.9802 13.7253 20.5879 75.4127 Constraint 297 442 12.0617 15.0771 22.6157 75.3701 Constraint 221 421 7.8416 9.8020 14.7031 75.3386 Constraint 242 412 4.3429 5.4286 8.1429 75.2997 Constraint 221 404 12.2923 15.3654 23.0481 75.2463 Constraint 285 355 9.3499 11.6874 17.5311 75.0708 Constraint 292 442 8.3884 10.4854 15.7282 75.0205 Constraint 210 442 5.4866 6.8583 10.2874 75.0205 Constraint 182 442 9.7964 12.2455 18.3682 75.0205 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 279 421 11.5391 14.4238 21.6357 74.5618 Constraint 272 412 11.8147 14.7683 22.1525 74.4688 Constraint 267 412 10.6206 13.2758 19.9137 74.4688 Constraint 285 442 10.6672 13.3340 20.0009 74.3537 Constraint 161 322 12.4471 15.5588 23.3382 74.2406 Constraint 303 442 12.8679 16.0849 24.1273 74.1771 Constraint 221 399 11.4108 14.2635 21.3953 74.1457 Constraint 279 355 11.8843 14.8553 22.2830 74.0522 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 297 12.1073 15.1341 22.7012 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 297 12.5651 15.7064 23.5596 73.8727 Constraint 113 292 11.4170 14.2712 21.4068 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 104 190 11.6819 14.6023 21.9035 73.8727 Constraint 341 421 11.4039 14.2549 21.3823 73.8689 Constraint 237 399 11.3136 14.1420 21.2129 73.7826 Constraint 242 435 7.1243 8.9054 13.3581 73.6212 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 161 237 10.5828 13.2285 19.8427 73.4098 Constraint 314 442 9.7843 12.2304 18.3456 73.4067 Constraint 259 350 9.7746 12.2182 18.3273 73.3960 Constraint 221 429 11.6153 14.5191 21.7786 73.3384 Constraint 169 412 11.3719 14.2149 21.3223 73.3195 Constraint 169 250 11.9719 14.9648 22.4472 73.2762 Constraint 221 412 8.6476 10.8094 16.2142 73.2453 Constraint 322 442 10.8070 13.5087 20.2631 73.0506 Constraint 250 399 10.8529 13.5661 20.3492 73.0108 Constraint 237 404 10.4282 13.0353 19.5529 72.7845 Constraint 250 404 9.8798 12.3497 18.5246 72.6060 Constraint 259 442 8.0525 10.0656 15.0984 72.5666 Constraint 259 435 10.2455 12.8068 19.2102 72.5666 Constraint 136 221 12.1229 15.1536 22.7304 72.5603 Constraint 182 350 11.3955 14.2444 21.3665 72.5153 Constraint 242 442 4.8649 6.0811 9.1216 72.2877 Constraint 259 355 11.4792 14.3489 21.5234 71.8562 Constraint 237 429 9.4887 11.8608 17.7913 71.7999 Constraint 237 412 6.7497 8.4371 12.6557 71.7999 Constraint 201 412 10.9593 13.6991 20.5486 71.7999 Constraint 355 429 12.4801 15.6002 23.4003 71.6225 Constraint 250 412 6.0105 7.5132 11.2697 71.6214 Constraint 201 429 12.3643 15.4554 23.1831 71.5869 Constraint 221 435 11.2444 14.0555 21.0832 71.5668 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 272 10.8873 13.6091 20.4137 71.4434 Constraint 96 259 9.8491 12.3114 18.4671 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 88 182 11.5724 14.4655 21.6983 71.4377 Constraint 176 442 9.9076 12.3845 18.5768 71.1401 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 292 382 11.5404 14.4255 21.6383 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 285 382 10.2339 12.7924 19.1885 71.1209 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 113 314 10.8516 13.5645 20.3467 70.9608 Constraint 226 421 9.7619 12.2024 18.3036 70.8931 Constraint 122 221 11.0976 13.8720 20.8080 70.8727 Constraint 96 279 11.8742 14.8427 22.2640 70.8477 Constraint 190 412 12.3594 15.4492 23.1739 70.5871 Constraint 237 442 4.4317 5.5396 8.3094 70.5751 Constraint 128 226 10.2273 12.7841 19.1762 70.5726 Constraint 104 285 11.5097 14.3872 21.5807 70.5405 Constraint 96 242 8.7861 10.9826 16.4739 70.4979 Constraint 267 399 12.5600 15.7000 23.5501 70.3942 Constraint 122 242 9.8082 12.2603 18.3904 70.3561 Constraint 128 429 9.9404 12.4255 18.6383 70.3317 Constraint 104 429 11.4047 14.2559 21.3838 70.3317 Constraint 221 442 7.8447 9.8058 14.7087 70.2333 Constraint 242 355 12.6617 15.8271 23.7407 69.9109 Constraint 285 375 11.6796 14.5995 21.8993 69.8228 Constraint 237 435 7.3795 9.2244 13.8366 69.8153 Constraint 201 435 11.3410 14.1763 21.2644 69.8153 Constraint 272 442 11.0855 13.8569 20.7853 69.7737 Constraint 267 442 11.6921 14.6151 21.9227 69.7737 Constraint 104 330 8.1029 10.1287 15.1930 69.7387 Constraint 267 350 10.1469 12.6836 19.0254 69.6148 Constraint 169 435 10.7163 13.3954 20.0931 69.5477 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 292 391 7.7693 9.7117 14.5675 69.4020 Constraint 322 404 12.3499 15.4373 23.1560 69.3624 Constraint 96 341 10.1789 12.7236 19.0855 69.3563 Constraint 104 421 9.3511 11.6889 17.5334 69.3154 Constraint 136 272 12.8339 16.0423 24.0635 69.2404 Constraint 350 412 11.6415 14.5519 21.8278 68.9593 Constraint 242 375 11.0519 13.8148 20.7222 68.8772 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 88 303 12.1778 15.2223 22.8334 68.8667 Constraint 226 412 9.3911 11.7388 17.6082 68.7999 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 96 190 11.4113 14.2641 21.3962 68.7852 Constraint 104 341 10.4366 13.0457 19.5686 68.7632 Constraint 128 330 10.5075 13.1344 19.7016 68.7223 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 201 442 7.2475 9.0593 13.5890 68.4818 Constraint 190 442 10.0612 12.5765 18.8647 68.4818 Constraint 242 350 11.1917 13.9896 20.9844 68.4738 Constraint 122 272 13.0210 16.2763 24.4145 68.4650 Constraint 122 237 9.3698 11.7122 17.5684 68.4650 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 297 11.9830 14.9787 22.4681 68.4377 Constraint 88 176 13.1397 16.4246 24.6369 68.4377 Constraint 259 382 9.1736 11.4670 17.2005 68.4039 Constraint 259 391 6.2539 7.8174 11.7260 68.3856 Constraint 210 350 11.7324 14.6655 21.9982 68.3239 Constraint 250 442 7.7928 9.7410 14.6115 68.3033 Constraint 122 226 12.0924 15.1155 22.6733 68.3017 Constraint 96 267 12.0797 15.0996 22.6494 68.2768 Constraint 169 442 6.8572 8.5715 12.8573 68.2142 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 104 226 13.4526 16.8157 25.2236 67.8823 Constraint 259 375 11.5306 14.4133 21.6199 67.8226 Constraint 250 435 9.1265 11.4081 17.1122 67.6366 Constraint 128 421 7.6399 9.5499 14.3248 67.5965 Constraint 88 161 13.0809 16.3511 24.5267 67.5095 Constraint 136 297 11.4211 14.2764 21.4146 67.4767 Constraint 176 412 13.1896 16.4871 24.7306 67.2563 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 292 368 10.8154 13.5192 20.2788 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 421 5.9672 7.4590 11.1885 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 128 267 12.3730 15.4663 23.1994 67.0739 Constraint 292 449 8.9764 11.2205 16.8308 67.0627 Constraint 210 449 6.3314 7.9142 11.8713 67.0627 Constraint 182 449 9.9070 12.3837 18.5756 67.0627 Constraint 250 429 11.0214 13.7768 20.6652 67.0503 Constraint 285 435 12.4285 15.5357 23.3035 66.9603 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 226 435 10.9845 13.7306 20.5959 66.8153 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 88 330 10.9722 13.7153 20.5729 66.7387 Constraint 136 421 11.4126 14.2658 21.3987 66.6259 Constraint 96 350 9.3577 11.6971 17.5457 66.6210 Constraint 279 391 10.8054 13.5068 20.2602 66.6091 Constraint 279 412 12.5265 15.6581 23.4871 66.4795 Constraint 104 399 11.6726 14.5907 21.8861 66.4513 Constraint 242 391 5.9528 7.4410 11.1615 66.4420 Constraint 242 382 8.3401 10.4252 15.6377 66.4420 Constraint 161 421 12.7343 15.9179 23.8769 66.3500 Constraint 104 442 11.0401 13.8001 20.7002 66.2630 Constraint 297 360 9.7152 12.1440 18.2159 66.2355 Constraint 237 391 9.6347 12.0434 18.0651 66.1731 Constraint 210 391 9.1127 11.3908 17.0862 66.1731 Constraint 182 391 11.4140 14.2675 21.4012 66.1731 Constraint 314 449 9.3186 11.6482 17.4724 66.1652 Constraint 128 435 11.0393 13.7991 20.6986 66.0027 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 96 226 12.1570 15.1963 22.7945 65.7852 Constraint 144 322 11.3324 14.1655 21.2483 65.7009 Constraint 259 368 9.1907 11.4884 17.2326 65.5329 Constraint 96 435 10.5164 13.1455 19.7182 65.5215 Constraint 96 412 9.6791 12.0989 18.1483 65.5215 Constraint 128 412 11.0519 13.8149 20.7224 65.5032 Constraint 226 442 7.4966 9.3707 14.0561 65.4818 Constraint 104 237 11.9082 14.8852 22.3278 65.4629 Constraint 272 350 11.0273 13.7842 20.6762 65.3891 Constraint 259 449 10.2764 12.8455 19.2683 65.2755 Constraint 128 442 7.7734 9.7168 14.5752 65.2649 Constraint 88 429 8.7777 10.9721 16.4582 65.2385 Constraint 153 237 8.9813 11.2266 16.8398 65.1928 Constraint 297 449 11.8695 14.8369 22.2553 65.1672 Constraint 303 382 11.9400 14.9250 22.3874 65.1318 Constraint 169 449 6.9142 8.6427 12.9641 65.1215 Constraint 96 355 10.5335 13.1669 19.7503 65.0664 Constraint 122 429 8.0099 10.0124 15.0186 64.9382 Constraint 122 421 7.5370 9.4212 14.1319 64.9382 Constraint 113 421 10.3493 12.9367 19.4050 64.9382 Constraint 161 242 12.7284 15.9106 23.8658 64.8650 Constraint 113 429 11.0940 13.8675 20.8012 64.6382 Constraint 267 391 9.3004 11.6255 17.4382 64.5947 Constraint 292 360 7.8678 9.8347 14.7521 64.5166 Constraint 259 360 8.2129 10.2661 15.3991 64.5166 Constraint 136 237 11.6148 14.5185 21.7777 64.4923 Constraint 221 391 8.9070 11.1337 16.7006 64.3876 Constraint 136 226 13.2772 16.5965 24.8947 64.3809 Constraint 242 449 7.6374 9.5468 14.3201 64.3299 Constraint 250 391 7.6952 9.6190 14.4286 64.2508 Constraint 250 382 8.8522 11.0653 16.5979 64.2508 Constraint 226 429 12.6567 15.8208 23.7312 64.2288 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 153 292 11.0100 13.7624 20.6437 64.0452 Constraint 350 429 12.2870 15.3588 23.0382 63.9673 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 88 341 12.0230 15.0288 22.5432 63.7892 Constraint 136 442 11.2976 14.1220 21.1830 63.6986 Constraint 221 350 11.1655 13.9568 20.9352 63.6035 Constraint 242 368 9.4875 11.8593 17.7890 63.5710 Constraint 242 360 8.5295 10.6619 15.9929 63.5710 Constraint 122 330 12.5415 15.6769 23.5154 63.4931 Constraint 182 435 13.0496 16.3119 24.4679 63.4665 Constraint 161 442 10.4831 13.1039 19.6558 63.4584 Constraint 272 391 11.0453 13.8066 20.7100 63.3803 Constraint 104 279 12.4203 15.5253 23.2880 63.3715 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 113 442 11.6628 14.5785 21.8677 63.3048 Constraint 237 360 12.1154 15.1442 22.7164 63.3022 Constraint 210 360 10.1568 12.6961 19.0441 63.3022 Constraint 182 360 11.4909 14.3637 21.5455 63.3022 Constraint 267 355 12.3502 15.4377 23.1566 63.2539 Constraint 176 449 10.2896 12.8620 19.2931 63.1823 Constraint 210 382 12.2399 15.2999 22.9499 63.1732 Constraint 96 442 8.3633 10.4541 15.6811 63.1717 Constraint 153 226 11.1331 13.9164 20.8746 63.1384 Constraint 322 449 9.2477 11.5597 17.3395 63.0739 Constraint 104 259 11.6522 14.5653 21.8479 62.9673 Constraint 237 382 11.4164 14.2705 21.4057 62.8732 Constraint 226 391 11.2568 14.0710 21.1065 62.8731 Constraint 122 404 11.7453 14.6816 22.0224 62.8450 Constraint 169 399 13.0715 16.3393 24.5090 62.7696 Constraint 285 449 11.7768 14.7210 22.0815 62.7046 Constraint 250 375 12.3256 15.4070 23.1105 62.6962 Constraint 303 429 12.2164 15.2705 22.9057 62.6424 Constraint 303 375 12.0626 15.0782 22.6173 62.6193 Constraint 237 449 7.6898 9.6122 14.4183 62.6173 Constraint 201 449 8.9463 11.1829 16.7744 62.6173 Constraint 122 442 8.1662 10.2078 15.3117 62.6067 Constraint 88 421 8.3548 10.4436 15.6653 62.5032 Constraint 88 412 12.1980 15.2475 22.8712 62.5032 Constraint 122 435 9.9716 12.4645 18.6967 62.4487 Constraint 128 399 11.2077 14.0097 21.0145 62.4350 Constraint 221 382 12.1157 15.1446 22.7170 62.4039 Constraint 88 242 10.8569 13.5711 20.3567 62.3481 Constraint 113 221 13.2154 16.5192 24.7789 62.3093 Constraint 104 449 8.7198 10.8998 16.3496 62.3045 Constraint 221 449 9.7716 12.2145 18.3217 62.2755 Constraint 88 435 12.0064 15.0080 22.5120 62.2032 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 360 435 10.9784 13.7230 20.5845 62.0836 Constraint 136 314 11.3291 14.1614 21.2421 62.0557 Constraint 122 412 11.0200 13.7750 20.6625 61.8469 Constraint 267 360 10.4452 13.0565 19.5848 61.7237 Constraint 250 368 10.4329 13.0411 19.5617 61.6799 Constraint 250 360 10.9151 13.6439 20.4658 61.6799 Constraint 221 360 10.3388 12.9235 19.3853 61.5166 Constraint 153 322 10.9338 13.6673 20.5009 61.4742 Constraint 267 382 12.0801 15.1001 22.6502 61.3409 Constraint 210 461 10.1838 12.7297 19.0946 61.3064 Constraint 128 461 8.7765 10.9707 16.4560 61.3064 Constraint 128 449 5.9601 7.4502 11.1752 61.3064 Constraint 88 259 12.3856 15.4820 23.2229 61.2935 Constraint 122 303 13.2073 16.5092 24.7637 61.1851 Constraint 136 242 12.3310 15.4137 23.1206 61.1601 Constraint 122 399 10.1622 12.7028 19.0542 61.0578 Constraint 128 341 12.4006 15.5008 23.2512 61.0540 Constraint 88 350 11.5365 14.4206 21.6309 61.0501 Constraint 88 404 11.7046 14.6307 21.9461 60.9486 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 360 442 10.5877 13.2346 19.8519 60.7501 Constraint 104 350 10.9438 13.6798 20.5197 60.6307 Constraint 128 404 12.7079 15.8848 23.8273 60.5292 Constraint 153 242 10.5933 13.2416 19.8623 60.5287 Constraint 190 449 11.6085 14.5106 21.7659 60.5240 Constraint 201 330 13.8429 17.3037 25.9555 60.5188 Constraint 279 360 10.5269 13.1586 19.7380 60.5093 Constraint 272 360 11.6403 14.5503 21.8255 60.5093 Constraint 113 330 11.5500 14.4376 21.6563 60.5045 Constraint 136 449 9.2408 11.5510 17.3265 60.3358 Constraint 210 368 12.6567 15.8209 23.7313 60.3022 Constraint 221 368 12.2008 15.2510 22.8765 60.3022 Constraint 267 368 11.4474 14.3092 21.4638 60.2448 Constraint 404 467 8.3910 10.4888 15.7332 60.2295 Constraint 96 449 6.1214 7.6518 11.4777 60.2295 Constraint 201 391 12.6245 15.7807 23.6710 60.1734 Constraint 88 442 10.9088 13.6360 20.4540 60.1717 Constraint 96 250 12.2367 15.2959 22.9438 60.1627 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 136 330 11.7697 14.7122 22.0683 60.1610 Constraint 104 461 10.4363 13.0454 19.5680 60.1135 Constraint 297 368 12.5481 15.6851 23.5276 60.0484 Constraint 272 449 12.3659 15.4574 23.1862 59.9117 Constraint 279 399 13.0457 16.3071 24.4607 59.8669 Constraint 144 237 11.4153 14.2692 21.4038 59.8621 Constraint 303 449 12.6241 15.7801 23.6702 59.7595 Constraint 113 449 8.6070 10.7587 16.1380 59.6462 Constraint 292 375 12.3748 15.4685 23.2027 59.6194 Constraint 161 449 9.8436 12.3045 18.4568 59.5708 Constraint 104 412 13.0723 16.3404 24.5106 59.5129 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 297 11.5214 14.4017 21.6026 59.4573 Constraint 80 292 11.3872 14.2340 21.3511 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 80 182 11.9628 14.9535 22.4303 59.4573 Constraint 80 169 12.2715 15.3394 23.0090 59.4573 Constraint 96 467 10.5020 13.1274 19.6912 59.2132 Constraint 96 461 7.7945 9.7431 14.6146 59.2132 Constraint 144 429 11.4419 14.3024 21.4536 59.0374 Constraint 303 404 12.3945 15.4931 23.2396 58.8643 Constraint 226 404 13.2164 16.5205 24.7807 58.7953 Constraint 226 399 13.5569 16.9461 25.4191 58.7953 Constraint 113 237 12.2550 15.3188 22.9782 58.6871 Constraint 128 250 12.2828 15.3535 23.0302 58.6641 Constraint 122 461 6.0480 7.5600 11.3400 58.6481 Constraint 122 449 4.9350 6.1687 9.2531 58.6481 Constraint 113 461 9.2294 11.5368 17.3052 58.6481 Constraint 153 297 13.2021 16.5026 24.7539 58.6375 Constraint 153 272 12.9048 16.1310 24.1965 58.6375 Constraint 169 404 13.6135 17.0168 25.5253 58.5985 Constraint 399 467 8.8077 11.0096 16.5144 58.4423 Constraint 322 435 12.6898 15.8623 23.7935 58.4012 Constraint 314 461 11.5149 14.3937 21.5905 58.3946 Constraint 292 461 12.1906 15.2383 22.8574 58.3946 Constraint 169 461 10.0343 12.5428 18.8143 58.3946 Constraint 161 461 12.1350 15.1688 22.7532 58.3946 Constraint 136 461 11.0177 13.7722 20.6583 58.3946 Constraint 144 421 11.2760 14.0951 21.1426 58.3394 Constraint 128 467 12.0467 15.0584 22.5876 58.3160 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 322 461 11.6428 14.5535 21.8302 58.0202 Constraint 136 429 12.6711 15.8389 23.7583 58.0200 Constraint 272 399 13.3668 16.7085 25.0627 57.9929 Constraint 104 267 13.3741 16.7176 25.0764 57.7985 Constraint 250 449 11.0051 13.7564 20.6346 57.7746 Constraint 122 259 11.4567 14.3209 21.4814 57.7381 Constraint 122 467 9.0496 11.3120 16.9680 57.4567 Constraint 88 221 12.6088 15.7610 23.6414 57.2937 Constraint 113 435 13.5508 16.9386 25.4078 57.2801 Constraint 153 314 12.6157 15.7696 23.6544 57.2600 Constraint 279 368 12.2695 15.3368 23.0053 57.2555 Constraint 88 449 7.6931 9.6164 14.4245 57.2112 Constraint 80 350 11.3656 14.2070 21.3105 57.1495 Constraint 113 242 12.0876 15.1095 22.6642 56.9016 Constraint 190 391 12.7499 15.9374 23.9061 56.8841 Constraint 153 435 10.0615 12.5769 18.8654 56.8479 Constraint 153 429 9.8914 12.3643 18.5464 56.8479 Constraint 153 421 9.2888 11.6110 17.4165 56.8479 Constraint 153 412 11.8498 14.8122 22.2183 56.8479 Constraint 144 292 12.3246 15.4057 23.1085 56.7085 Constraint 210 467 12.9976 16.2470 24.3704 56.5193 Constraint 242 461 10.7287 13.4108 20.1162 56.4804 Constraint 279 442 13.1710 16.4638 24.6957 56.4787 Constraint 128 350 12.2854 15.3568 23.0352 56.4164 Constraint 88 461 7.4148 9.2686 13.9028 56.2132 Constraint 88 285 12.3939 15.4924 23.2386 56.0889 Constraint 88 355 11.4447 14.3058 21.4587 56.0778 Constraint 122 285 12.5335 15.6669 23.5004 55.6871 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 144 442 10.4807 13.1009 19.6514 55.5145 Constraint 113 399 12.2033 15.2541 22.8812 55.4848 Constraint 182 461 13.1677 16.4596 24.6894 55.3946 Constraint 350 449 12.9603 16.2004 24.3006 55.2869 Constraint 80 330 8.5588 10.6984 16.0477 55.2772 Constraint 144 461 8.9194 11.1493 16.7239 55.1406 Constraint 144 449 8.2009 10.2511 15.3766 55.1406 Constraint 80 421 11.0253 13.7817 20.6725 55.0475 Constraint 88 467 9.1462 11.4328 17.1492 55.0217 Constraint 226 449 10.2887 12.8609 19.2914 54.9531 Constraint 80 429 12.0165 15.0206 22.5310 54.9475 Constraint 80 399 11.6889 14.6111 21.9166 54.8724 Constraint 201 461 12.6930 15.8662 23.7993 54.7678 Constraint 382 449 11.8405 14.8006 22.2010 54.6424 Constraint 96 391 8.9912 11.2391 16.8586 54.3945 Constraint 113 467 11.5843 14.4804 21.7205 54.2900 Constraint 153 399 13.2178 16.5223 24.7834 54.2770 Constraint 88 201 12.9552 16.1940 24.2909 54.2065 Constraint 314 473 11.1432 13.9290 20.8935 54.2042 Constraint 144 221 13.3812 16.7265 25.0898 54.1375 Constraint 88 237 11.9449 14.9311 22.3966 53.9004 Constraint 144 435 12.6274 15.7842 23.6763 53.8480 Constraint 375 449 12.3317 15.4147 23.1220 53.6444 Constraint 421 480 10.3571 12.9464 19.4196 53.6219 Constraint 113 303 13.5273 16.9092 25.3638 53.4650 Constraint 176 461 13.7882 17.2353 25.8529 53.3014 Constraint 96 360 7.7682 9.7103 14.5654 53.2425 Constraint 96 382 12.3364 15.4205 23.1308 53.1801 Constraint 122 391 11.9677 14.9596 22.4394 53.1618 Constraint 144 314 12.9615 16.2019 24.3028 52.9231 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 104 435 13.4987 16.8734 25.3101 52.7184 Constraint 412 473 8.5329 10.6662 15.9993 52.3177 Constraint 404 473 5.4961 6.8701 10.3051 52.3177 Constraint 153 404 13.5884 16.9855 25.4782 52.2751 Constraint 322 473 12.8230 16.0288 24.0431 52.1110 Constraint 96 473 9.7923 12.2404 18.3606 52.1110 Constraint 237 461 10.7844 13.4805 20.2207 51.9310 Constraint 169 467 13.4393 16.7991 25.1986 51.9198 Constraint 153 461 7.8545 9.8182 14.7273 51.8559 Constraint 153 449 5.6971 7.1214 10.6821 51.8559 Constraint 412 480 12.2954 15.3692 23.0538 51.5286 Constraint 330 449 12.8437 16.0546 24.0820 51.4348 Constraint 153 467 11.7902 14.7378 22.1066 51.3782 Constraint 237 368 12.8820 16.1026 24.1538 51.3253 Constraint 226 360 13.2868 16.6086 24.9128 51.3119 Constraint 210 375 13.6052 17.0064 25.5097 51.2971 Constraint 80 176 13.7416 17.1770 25.7655 51.2496 Constraint 88 391 11.5825 14.4782 21.7173 51.1782 Constraint 368 449 12.8053 16.0066 24.0099 51.0734 Constraint 360 449 10.2016 12.7520 19.1280 51.0734 Constraint 267 404 13.2469 16.5587 24.8380 50.7914 Constraint 122 473 10.1174 12.6468 18.9702 50.7364 Constraint 96 480 11.1551 13.9439 20.9159 50.7287 Constraint 399 473 5.0505 6.3131 9.4697 50.5306 Constraint 96 368 11.4090 14.2612 21.3918 50.3091 Constraint 128 391 11.4778 14.3472 21.5209 50.1618 Constraint 144 242 12.3366 15.4208 23.1311 50.0864 Constraint 122 480 10.9696 13.7120 20.5680 49.9473 Constraint 399 480 8.2521 10.3151 15.4727 49.9190 Constraint 391 461 11.5202 14.4002 21.6004 49.6070 Constraint 404 480 9.1584 11.4480 17.1721 49.5142 Constraint 104 355 12.2454 15.3067 22.9601 49.4981 Constraint 122 360 11.2695 14.0869 21.1303 49.2928 Constraint 104 360 10.8225 13.5282 20.2923 49.2928 Constraint 104 467 13.1668 16.4586 24.6878 49.1397 Constraint 226 382 13.2220 16.5275 24.7912 49.1217 Constraint 250 350 12.4302 15.5377 23.3066 48.8840 Constraint 355 473 11.8557 14.8197 22.2295 48.7692 Constraint 88 480 9.3489 11.6861 17.5292 48.7267 Constraint 292 473 12.7214 15.9017 23.8526 48.6312 Constraint 210 473 12.0204 15.0255 22.5383 48.6312 Constraint 96 375 11.5136 14.3919 21.5879 48.6086 Constraint 242 467 12.6041 15.7551 23.6326 48.5385 Constraint 88 360 9.5884 11.9856 17.9783 48.5236 Constraint 144 467 12.0119 15.0149 22.5223 48.3782 Constraint 80 461 10.8516 13.5645 20.3468 48.2366 Constraint 80 449 10.5703 13.2129 19.8194 48.2366 Constraint 267 449 13.2592 16.5740 24.8610 48.1728 Constraint 314 480 13.0278 16.2848 24.4271 47.9832 Constraint 88 473 9.3919 11.7399 17.6098 47.9196 Constraint 322 382 12.9969 16.2461 24.3691 47.8978 Constraint 391 467 12.3405 15.4256 23.1383 47.8881 Constraint 382 461 12.7298 15.9123 23.8684 47.8881 Constraint 80 355 11.6339 14.5424 21.8136 47.8853 Constraint 104 473 12.9518 16.1897 24.2846 47.8216 Constraint 161 435 13.4266 16.7833 25.1749 47.5144 Constraint 80 285 13.2478 16.5597 24.8395 47.4891 Constraint 136 303 13.6459 17.0574 25.5861 47.4011 Constraint 113 480 12.5342 15.6677 23.5016 47.3763 Constraint 182 355 13.6131 17.0164 25.5246 47.2809 Constraint 169 391 12.5312 15.6641 23.4961 47.2226 Constraint 104 391 12.1456 15.1820 22.7729 47.1715 Constraint 136 259 13.4787 16.8483 25.2725 47.0752 Constraint 190 435 13.5508 16.9385 25.4078 46.9321 Constraint 176 435 13.4249 16.7812 25.1717 46.9225 Constraint 382 467 12.6018 15.7523 23.6284 46.8718 Constraint 375 467 11.3363 14.1703 21.2555 46.8718 Constraint 375 461 12.1905 15.2381 22.8571 46.8718 Constraint 153 259 12.5004 15.6255 23.4383 46.8556 Constraint 259 473 12.8836 16.1045 24.1568 46.8440 Constraint 314 467 13.2829 16.6037 24.9055 46.5579 Constraint 350 442 13.1384 16.4230 24.6345 46.5306 Constraint 80 360 10.9690 13.7112 20.5668 46.5210 Constraint 221 461 13.2198 16.5248 24.7872 45.9529 Constraint 113 341 13.2521 16.5651 24.8477 45.9244 Constraint 242 473 10.8299 13.5374 20.3061 45.8984 Constraint 190 350 13.7779 17.2224 25.8336 45.8447 Constraint 221 355 13.1653 16.4566 24.6849 45.1868 Constraint 113 473 12.4613 15.5766 23.3649 45.1633 Constraint 161 429 13.7144 17.1430 25.7144 45.0254 Constraint 161 297 13.4452 16.8064 25.2097 44.9419 Constraint 176 429 13.4437 16.8046 25.2069 44.6944 Constraint 169 360 13.2789 16.5986 24.8979 44.3516 Constraint 360 461 11.3768 14.2210 21.3316 44.3008 Constraint 201 399 13.7357 17.1696 25.7544 43.7955 Constraint 80 161 14.0163 17.5204 26.2806 43.4623 Constraint 88 375 12.3104 15.3880 23.0820 43.4550 Constraint 128 360 10.8967 13.6209 20.4313 43.3025 Constraint 259 461 12.8834 16.1042 24.1563 43.1161 Constraint 122 350 12.9316 16.1645 24.2468 42.6141 Constraint 237 473 12.7699 15.9624 23.9435 42.4306 Constraint 128 473 11.4979 14.3723 21.5585 41.8312 Constraint 88 368 12.8273 16.0342 24.0512 41.7361 Constraint 122 250 12.3989 15.4986 23.2479 41.6979 Constraint 360 467 12.1334 15.1668 22.7502 41.3008 Constraint 391 480 12.4265 15.5331 23.2997 41.1725 Constraint 297 429 11.6261 14.5326 21.7989 40.9958 Constraint 279 382 13.2757 16.5946 24.8919 40.9408 Constraint 350 473 12.2039 15.2549 22.8823 40.9141 Constraint 153 473 12.6315 15.7893 23.6840 40.8052 Constraint 237 467 12.9828 16.2286 24.3428 40.7870 Constraint 391 473 9.0502 11.3127 16.9690 40.7859 Constraint 113 190 13.5021 16.8776 25.3165 40.3427 Constraint 382 480 12.6289 15.7862 23.6792 40.1744 Constraint 375 480 10.0903 12.6129 18.9194 40.1744 Constraint 176 391 13.6149 17.0187 25.5280 40.1382 Constraint 80 442 13.3531 16.6913 25.0370 40.0143 Constraint 382 473 9.0358 11.2947 16.9421 39.7696 Constraint 375 473 7.0909 8.8636 13.2955 39.7696 Constraint 190 341 14.0131 17.5164 26.2746 39.6988 Constraint 272 368 13.1624 16.4530 24.6795 39.5300 Constraint 190 360 13.5846 16.9808 25.4712 39.3311 Constraint 80 480 12.5762 15.7202 23.5803 39.0452 Constraint 421 489 9.0995 11.3744 17.0615 38.3582 Constraint 80 467 12.8045 16.0056 24.0084 38.2084 Constraint 169 473 13.0995 16.3744 24.5616 38.1635 Constraint 237 350 13.7761 17.2201 25.8302 37.9519 Constraint 113 360 12.0817 15.1021 22.6532 37.7294 Constraint 113 350 13.0723 16.3404 24.5106 37.6140 Constraint 368 480 13.0563 16.3204 24.4805 37.6035 Constraint 360 480 11.4857 14.3571 21.5357 37.6035 Constraint 429 489 6.4851 8.1064 12.1596 37.3601 Constraint 368 473 9.9385 12.4231 18.6347 37.1987 Constraint 360 473 8.8089 11.0112 16.5167 37.1987 Constraint 144 297 14.0569 17.5711 26.3567 36.9696 Constraint 341 412 12.6499 15.8124 23.7185 36.9228 Constraint 80 473 12.7095 15.8869 23.8304 36.8770 Constraint 272 429 13.2387 16.5484 24.8226 36.6130 Constraint 210 355 13.1861 16.4826 24.7240 36.5896 Constraint 412 489 11.7543 14.6929 22.0393 36.2650 Constraint 144 473 13.0764 16.3454 24.5182 36.0063 Constraint 267 435 13.3177 16.6471 24.9707 35.9263 Constraint 221 375 13.5953 16.9941 25.4911 35.8444 Constraint 210 489 12.3674 15.4593 23.1889 35.8393 Constraint 128 489 10.7683 13.4604 20.1905 35.8393 Constraint 104 489 11.2055 14.0069 21.0104 35.8393 Constraint 368 461 13.6202 17.0253 25.5380 35.5522 Constraint 272 435 13.5865 16.9831 25.4747 35.4123 Constraint 128 480 13.2585 16.5732 24.8597 35.3840 Constraint 355 480 12.6532 15.8164 23.7247 35.3317 Constraint 435 497 8.8198 11.0247 16.5371 35.0892 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 421 497 6.3341 7.9177 11.8765 35.0892 Constraint 355 449 13.0988 16.3736 24.5603 35.0092 Constraint 153 250 13.0970 16.3712 24.5568 34.8759 Constraint 190 429 13.7187 17.1483 25.7225 34.7974 Constraint 297 382 13.2938 16.6173 24.9259 34.7681 Constraint 136 285 13.8966 17.3707 26.0560 34.5725 Constraint 399 489 8.5972 10.7465 16.1197 33.9528 Constraint 267 429 13.2046 16.5058 24.7587 33.8946 Constraint 322 489 12.0090 15.0112 22.5168 33.7461 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 272 355 13.2332 16.5415 24.8123 33.6264 Constraint 201 404 13.6839 17.1049 25.6574 33.6160 Constraint 341 429 12.4765 15.5956 23.3934 33.5840 Constraint 128 497 9.6045 12.0057 18.0085 33.5683 Constraint 104 497 9.6958 12.1198 18.1796 33.5683 Constraint 404 489 9.8426 12.3033 18.4549 33.5480 Constraint 399 497 5.7426 7.1782 10.7673 33.4007 Constraint 314 497 8.7608 10.9510 16.4265 33.2683 Constraint 292 497 10.7892 13.4866 20.2298 33.2683 Constraint 210 497 10.3590 12.9488 19.4232 33.2683 Constraint 169 497 11.7828 14.7286 22.0928 33.2683 Constraint 169 489 12.6526 15.8157 23.7236 33.1810 Constraint 122 489 7.9151 9.8939 14.8408 33.1810 Constraint 113 489 9.9260 12.4075 18.6113 33.1810 Constraint 80 242 12.8180 16.0225 24.0337 33.0701 Constraint 314 489 11.5366 14.4207 21.6311 33.0025 Constraint 412 497 9.1618 11.4522 17.1783 32.9959 Constraint 404 497 7.8585 9.8232 14.7347 32.9959 Constraint 136 489 12.6979 15.8724 23.8086 32.6281 Constraint 330 497 12.5936 15.7420 23.6129 32.4914 Constraint 355 497 10.0466 12.5583 18.8374 32.1914 Constraint 350 497 11.1960 13.9950 20.9925 32.1914 Constraint 237 375 13.4761 16.8451 25.2676 32.0139 Constraint 153 489 11.3241 14.1551 21.2327 31.9666 Constraint 144 489 10.7861 13.4827 20.2240 31.9666 Constraint 80 391 12.9605 16.2006 24.3010 31.9189 Constraint 322 497 9.5148 11.8935 17.8403 31.4751 Constraint 96 497 6.2746 7.8432 11.7648 31.4751 Constraint 259 497 11.9198 14.8997 22.3496 31.1751 Constraint 88 497 5.6890 7.1113 10.6669 31.1751 Constraint 88 382 13.3916 16.7395 25.1092 31.0451 Constraint 113 259 13.1076 16.3845 24.5768 30.8901 Constraint 182 497 12.7549 15.9436 23.9154 30.6951 Constraint 122 497 7.4785 9.3481 14.0222 30.6101 Constraint 113 497 9.4270 11.7838 17.6757 30.6101 Constraint 303 497 12.6233 15.7791 23.6687 30.4316 Constraint 297 497 12.9951 16.2439 24.3658 30.4316 Constraint 242 497 10.1556 12.6945 19.0417 30.2295 Constraint 330 412 13.0687 16.3359 24.5039 30.2078 Constraint 144 226 13.2305 16.5381 24.8072 30.1903 Constraint 136 435 13.9241 17.4051 26.1077 29.9764 Constraint 368 467 13.5308 16.9136 25.3703 29.8911 Constraint 144 399 13.5213 16.9017 25.3525 29.6867 Constraint 153 497 10.9887 13.7358 20.6037 29.3957 Constraint 221 497 12.6270 15.7838 23.6756 29.1783 Constraint 122 375 13.5553 16.9441 25.4161 28.8176 Constraint 153 391 13.5910 16.9888 25.4832 28.5555 Constraint 250 461 12.9241 16.1551 24.2326 28.5540 Constraint 80 497 9.3774 11.7218 17.5826 28.4674 Constraint 80 489 10.3060 12.8825 19.3238 28.4674 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 113 412 13.6338 17.0422 25.5634 28.3966 Constraint 285 497 12.4699 15.5873 23.3810 28.3384 Constraint 242 489 12.3850 15.4812 23.2218 28.3384 Constraint 201 360 13.2801 16.6001 24.9001 28.2770 Constraint 285 473 13.2408 16.5510 24.8265 28.0279 Constraint 182 404 13.1139 16.3924 24.5886 27.8892 Constraint 267 375 13.3633 16.7041 25.0562 27.5248 Constraint 128 355 13.4935 16.8669 25.3004 27.4467 Constraint 429 511 7.8729 9.8411 14.7616 27.4365 Constraint 292 489 12.9502 16.1877 24.2816 27.4316 Constraint 250 473 12.7471 15.9339 23.9008 27.3530 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 341 497 12.5546 15.6933 23.5399 27.0573 Constraint 113 391 13.2344 16.5430 24.8145 27.0385 Constraint 297 404 11.9863 14.9829 22.4743 26.9892 Constraint 144 480 12.9048 16.1310 24.1965 26.9783 Constraint 435 511 11.1449 13.9311 20.8966 26.7157 Constraint 412 511 11.3448 14.1811 21.2716 26.7157 Constraint 330 442 12.9798 16.2247 24.3371 26.6378 Constraint 250 497 13.2671 16.5838 24.8757 26.3416 Constraint 104 480 13.2690 16.5862 24.8793 26.2097 Constraint 399 511 6.6596 8.3245 12.4867 26.1224 Constraint 113 272 14.0239 17.5299 26.2949 26.0693 Constraint 341 404 11.8597 14.8246 22.2370 25.9184 Constraint 404 511 8.9594 11.1993 16.7990 25.7176 Constraint 113 285 13.6840 17.1051 25.6576 25.7069 Constraint 237 497 12.1425 15.1782 22.7672 25.6801 Constraint 322 511 12.2656 15.3320 22.9981 25.6157 Constraint 314 511 10.7236 13.4045 20.1068 25.6157 Constraint 96 511 9.5073 11.8841 17.8262 25.6157 Constraint 88 511 8.2671 10.3339 15.5008 25.6157 Constraint 355 442 13.8919 17.3649 26.0473 25.5058 Constraint 226 461 13.6073 17.0091 25.5137 25.4690 Constraint 355 511 9.6326 12.0407 18.0610 25.2986 Constraint 350 511 11.9267 14.9084 22.3626 25.2986 Constraint 122 341 13.0226 16.2782 24.4173 25.0898 Constraint 153 480 13.3385 16.6731 25.0096 24.9171 Constraint 250 355 13.4523 16.8154 25.2231 24.8493 Constraint 297 435 12.3412 15.4264 23.1397 24.8151 Constraint 80 511 11.4172 14.2715 21.4073 24.8061 Constraint 122 355 13.0187 16.2734 24.4100 24.7998 Constraint 136 360 13.6299 17.0374 25.5561 24.7699 Constraint 350 461 13.3812 16.7264 25.0897 24.6873 Constraint 136 497 11.1371 13.9213 20.8820 24.4841 Constraint 330 429 11.1084 13.8856 20.8283 24.2175 Constraint 391 489 11.9548 14.9435 22.4152 24.2082 Constraint 279 449 13.6162 17.0202 25.5304 24.1839 Constraint 161 259 14.1263 17.6578 26.4868 24.1525 Constraint 341 449 13.1055 16.3819 24.5729 23.9746 Constraint 144 497 10.3052 12.8815 19.3223 23.8226 Constraint 136 399 13.2962 16.6203 24.9304 23.6976 Constraint 391 497 9.1276 11.4095 17.1142 23.6561 Constraint 360 497 8.1803 10.2254 15.3380 23.3561 Constraint 355 489 12.0501 15.0626 22.5939 23.3548 Constraint 272 404 13.6576 17.0720 25.6080 23.3232 Constraint 375 489 11.4736 14.3421 21.5131 23.1918 Constraint 104 404 13.0315 16.2894 24.4341 23.1317 Constraint 355 467 13.7330 17.1662 25.7493 23.0574 Constraint 226 350 14.0217 17.5272 26.2908 22.9711 Constraint 122 511 10.6044 13.2554 19.8832 22.9575 Constraint 242 511 12.6218 15.7773 23.6659 22.7790 Constraint 88 190 12.9372 16.1716 24.2573 22.2784 Constraint 391 511 10.6548 13.3185 19.9778 22.2720 Constraint 80 259 13.1032 16.3790 24.5684 22.2567 Constraint 585 651 12.2057 15.2572 22.8858 22.1681 Constraint 355 461 13.1180 16.3974 24.5962 22.1273 Constraint 382 497 10.4700 13.0875 19.6312 21.9372 Constraint 80 221 13.3685 16.7106 25.0659 21.9150 Constraint 113 355 13.1420 16.4275 24.6412 21.7998 Constraint 242 480 13.4590 16.8238 25.2357 21.7685 Constraint 136 467 13.5612 16.9515 25.4272 21.6860 Constraint 375 497 8.9030 11.1287 16.6931 21.6372 Constraint 368 497 10.3320 12.9150 19.3725 21.6372 Constraint 182 368 13.5686 16.9608 25.4412 21.5845 Constraint 122 267 13.1216 16.4021 24.6031 20.8904 Constraint 360 489 10.7311 13.4139 20.1209 20.6209 Constraint 599 668 11.6152 14.5190 21.7785 20.5939 Constraint 272 382 13.5098 16.8872 25.3308 20.3492 Constraint 382 511 11.1877 13.9847 20.9770 20.2576 Constraint 382 489 12.9152 16.1440 24.2160 20.1918 Constraint 128 511 12.8132 16.0164 24.0247 20.0427 Constraint 104 511 12.3335 15.4168 23.1252 20.0427 Constraint 201 497 13.6539 17.0674 25.6010 20.0403 Constraint 375 511 8.3529 10.4411 15.6617 19.9576 Constraint 368 511 10.5415 13.1768 19.7652 19.9576 Constraint 360 511 8.8341 11.0427 16.5640 19.9576 Constraint 210 511 13.4467 16.8084 25.2126 19.9575 Constraint 297 375 12.7219 15.9024 23.8536 19.9051 Constraint 435 519 12.5598 15.6997 23.5496 19.7765 Constraint 421 519 10.8762 13.5952 20.3928 19.7765 Constraint 88 272 12.6495 15.8119 23.7178 19.7074 Constraint 590 657 11.6598 14.5748 21.8621 19.6092 Constraint 303 435 11.2954 14.1193 21.1789 19.5421 Constraint 557 629 11.8700 14.8374 22.2562 19.1335 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 221 473 13.3096 16.6370 24.9555 18.8648 Constraint 161 314 14.0092 17.5115 26.2672 18.7392 Constraint 122 382 13.4272 16.7841 25.1761 18.2018 Constraint 250 341 13.6845 17.1056 25.6584 18.1439 Constraint 449 519 10.5041 13.1301 19.6952 18.1430 Constraint 552 629 12.7584 15.9480 23.9220 18.1354 Constraint 237 489 13.5375 16.9218 25.3828 18.1103 Constraint 585 657 11.6698 14.5872 21.8808 17.8710 Constraint 322 467 12.8847 16.1058 24.1587 17.8196 Constraint 104 250 13.3608 16.7011 25.0516 17.7939 Constraint 604 676 11.5457 14.4321 21.6482 17.6035 Constraint 399 519 9.2768 11.5960 17.3940 17.4643 Constraint 350 489 13.0568 16.3210 24.4815 17.3417 Constraint 350 480 12.8409 16.0511 24.0766 17.3287 Constraint 330 404 11.8571 14.8214 22.2321 17.3067 Constraint 429 519 8.8613 11.0766 16.6149 17.0595 Constraint 590 668 12.9469 16.1837 24.2755 17.0516 Constraint 391 527 10.6418 13.3023 19.9534 16.9929 Constraint 544 622 12.7554 15.9442 23.9163 16.9604 Constraint 122 519 10.2606 12.8258 19.2386 16.9576 Constraint 113 519 11.4997 14.3746 21.5619 16.9576 Constraint 104 519 12.6142 15.7677 23.6516 16.9576 Constraint 96 519 9.7254 12.1568 18.2352 16.9576 Constraint 88 519 8.0895 10.1118 15.1677 16.9576 Constraint 292 511 13.1051 16.3813 24.5720 16.7790 Constraint 360 527 9.4450 11.8062 17.7093 16.6929 Constraint 341 604 12.4046 15.5057 23.2586 16.6115 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 176 360 13.7301 17.1626 25.7439 16.4403 Constraint 585 668 13.2791 16.5989 24.8984 16.2980 Constraint 399 527 8.1919 10.2399 15.3599 16.1833 Constraint 113 511 11.1552 13.9440 20.9160 16.1700 Constraint 80 519 10.9430 13.6788 20.5182 16.1480 Constraint 404 519 11.1843 13.9804 20.9706 16.0432 Constraint 429 604 8.2338 10.2923 15.4384 15.9828 Constraint 577 644 12.2712 15.3390 23.0086 15.9299 Constraint 279 429 12.2970 15.3712 23.0568 15.8629 Constraint 113 226 12.3935 15.4918 23.2377 15.8103 Constraint 435 527 10.5512 13.1890 19.7835 15.7785 Constraint 429 527 7.8000 9.7499 14.6249 15.7785 Constraint 421 527 8.1705 10.2131 15.3196 15.7785 Constraint 412 527 10.8851 13.6064 20.4096 15.7785 Constraint 314 629 11.9118 14.8897 22.3346 15.6922 Constraint 314 622 12.4714 15.5892 23.3839 15.6922 Constraint 285 461 13.7766 17.2207 25.8311 15.6474 Constraint 226 368 13.0714 16.3392 24.5088 15.6441 Constraint 330 511 13.7022 17.1277 25.6916 15.5474 Constraint 341 511 12.8169 16.0212 24.0318 15.4455 Constraint 442 527 10.3979 12.9974 19.4961 15.4431 Constraint 404 604 9.6054 12.0068 18.0102 15.4067 Constraint 404 613 10.4816 13.1020 19.6530 15.3945 Constraint 279 404 12.3961 15.4951 23.2427 15.3029 Constraint 322 480 12.7185 15.8981 23.8472 15.2545 Constraint 80 412 13.7097 17.1371 25.7057 15.1202 Constraint 314 604 9.5524 11.9404 17.9107 15.0970 Constraint 421 622 10.6083 13.2604 19.8906 14.9829 Constraint 153 527 11.9263 14.9079 22.3619 14.9576 Constraint 122 527 8.4902 10.6128 15.9192 14.9576 Constraint 113 527 9.8762 12.3452 18.5178 14.9576 Constraint 544 613 12.5163 15.6453 23.4680 14.9441 Constraint 314 599 9.6142 12.0177 18.0266 14.9297 Constraint 176 341 13.9082 17.3852 26.0778 14.9101 Constraint 449 535 10.9344 13.6680 20.5020 14.8266 Constraint 368 489 12.8111 16.0139 24.0208 14.7841 Constraint 128 382 13.5883 16.9854 25.4781 14.7727 Constraint 350 435 13.1847 16.4809 24.7214 14.5580 Constraint 153 330 13.6349 17.0436 25.5654 14.5558 Constraint 429 535 9.4476 11.8095 17.7143 14.4620 Constraint 421 535 9.3680 11.7101 17.5651 14.4620 Constraint 429 622 9.8179 12.2724 18.4085 14.4099 Constraint 429 613 9.0409 11.3012 16.9517 14.4099 Constraint 412 622 11.1359 13.9199 20.8799 14.4099 Constraint 404 622 10.2180 12.7725 19.1587 14.3782 Constraint 122 535 11.6157 14.5196 21.7794 14.2141 Constraint 279 375 12.7950 15.9938 23.9907 14.2004 Constraint 449 527 7.9650 9.9562 14.9343 14.1450 Constraint 571 636 12.1017 15.1271 22.6907 14.0630 Constraint 599 676 11.9622 14.9528 22.4291 14.0613 Constraint 404 527 9.9907 12.4884 18.7326 14.0596 Constraint 544 629 13.2309 16.5387 24.8080 14.0576 Constraint 360 604 11.0387 13.7983 20.6975 14.0326 Constraint 429 629 9.4424 11.8030 17.7045 13.9951 Constraint 412 629 10.7439 13.4298 20.1447 13.9951 Constraint 153 360 13.4609 16.8262 25.2393 13.9920 Constraint 421 629 9.7460 12.1825 18.2738 13.9829 Constraint 421 613 10.6867 13.3583 20.0375 13.9829 Constraint 421 604 8.6473 10.8092 16.2137 13.9829 Constraint 375 527 10.8839 13.6049 20.4074 13.9577 Constraint 375 519 11.3528 14.1910 21.2866 13.9577 Constraint 360 519 10.5757 13.2196 19.8294 13.9577 Constraint 210 527 10.9866 13.7332 20.5999 13.9577 Constraint 169 527 12.3848 15.4810 23.2214 13.9577 Constraint 128 527 10.4604 13.0755 19.6133 13.9577 Constraint 128 519 12.7221 15.9027 23.8540 13.9577 Constraint 96 527 7.5870 9.4838 14.2257 13.9577 Constraint 88 527 7.0190 8.7738 13.1607 13.9577 Constraint 322 599 9.9047 12.3809 18.5714 13.9297 Constraint 292 599 10.4744 13.0930 19.6396 13.9297 Constraint 285 599 12.1307 15.1633 22.7450 13.9297 Constraint 259 599 11.4431 14.3038 21.4557 13.9297 Constraint 391 622 11.9794 14.9742 22.4614 13.9252 Constraint 391 613 12.5038 15.6297 23.4446 13.9252 Constraint 382 613 12.8469 16.0586 24.0879 13.9252 Constraint 122 368 12.9691 16.2114 24.3171 13.9037 Constraint 461 535 9.7397 12.1747 18.2620 13.8285 Constraint 122 279 13.4035 16.7544 25.1317 13.7971 Constraint 104 368 12.9709 16.2136 24.3204 13.7405 Constraint 128 368 13.3830 16.7288 25.0931 13.7405 Constraint 404 629 9.8294 12.2868 18.4302 13.7400 Constraint 88 226 10.9559 13.6948 20.5422 13.7171 Constraint 330 527 11.6381 14.5477 21.8215 13.6405 Constraint 399 604 9.1751 11.4688 17.2032 13.5851 Constraint 80 375 12.7332 15.9165 23.8748 13.5639 Constraint 144 412 13.3041 16.6302 24.9452 13.5626 Constraint 161 412 13.5804 16.9754 25.4632 13.5533 Constraint 391 629 11.7446 14.6807 22.0211 13.5104 Constraint 480 599 9.8310 12.2888 18.4332 13.5008 Constraint 461 604 10.2357 12.7947 19.1920 13.4599 Constraint 242 629 10.7283 13.4103 20.1155 13.3750 Constraint 182 489 13.1925 16.4907 24.7360 13.3497 Constraint 391 535 9.8979 12.3724 18.5586 13.2832 Constraint 391 519 11.9113 14.8891 22.3336 13.2721 Constraint 210 535 12.6666 15.8332 23.7498 13.2141 Constraint 577 657 11.1525 13.9406 20.9109 13.2139 Constraint 144 259 13.4820 16.8525 25.2787 13.2094 Constraint 391 604 10.7728 13.4660 20.1990 13.1771 Constraint 144 511 12.9934 16.2417 24.3626 13.1701 Constraint 314 590 11.0100 13.7625 20.6437 13.1323 Constraint 322 590 11.7127 14.6409 21.9613 13.1201 Constraint 557 636 12.5667 15.7083 23.5625 13.0803 Constraint 480 604 8.3464 10.4330 15.6495 13.0738 Constraint 136 412 13.3403 16.6753 25.0130 13.0524 Constraint 136 341 11.6306 14.5383 21.8074 13.0340 Constraint 435 604 10.5279 13.1599 19.7399 13.0104 Constraint 399 613 10.1586 12.6983 19.0474 12.9958 Constraint 412 604 10.2213 12.7767 19.1650 12.9951 Constraint 613 687 12.0126 15.0157 22.5236 12.9380 Constraint 375 613 11.0879 13.8599 20.7898 12.9089 Constraint 461 599 10.2161 12.7702 19.1553 12.8870 Constraint 80 404 13.3470 16.6838 25.0257 12.8552 Constraint 161 497 13.1997 16.4996 24.7494 12.8260 Constraint 104 544 12.7601 15.9501 23.9251 12.8093 Constraint 399 535 7.5685 9.4606 14.1909 12.7736 Constraint 226 330 14.1476 17.6845 26.5267 12.7530 Constraint 303 599 11.7915 14.7394 22.1091 12.7153 Constraint 322 527 8.6280 10.7850 16.1775 12.6242 Constraint 314 527 8.5478 10.6848 16.0272 12.6242 Constraint 104 527 9.8768 12.3460 18.5189 12.6242 Constraint 242 599 9.0633 11.3292 16.9937 12.6125 Constraint 210 599 8.9713 11.2142 16.8213 12.6003 Constraint 355 435 13.8712 17.3390 26.0085 12.5894 Constraint 421 599 8.0975 10.1219 15.1828 12.5790 Constraint 622 698 11.9334 14.9168 22.3751 12.5471 Constraint 399 629 10.2922 12.8653 19.2979 12.5258 Constraint 429 599 8.1665 10.2081 15.3122 12.4451 Constraint 341 473 13.0656 16.3320 24.4980 12.3695 Constraint 435 535 11.4498 14.3122 21.4683 12.3688 Constraint 412 535 10.9853 13.7316 20.5974 12.3688 Constraint 297 461 12.0185 15.0231 22.5346 12.3678 Constraint 473 629 8.4392 10.5490 15.8235 12.3648 Constraint 473 613 9.9214 12.4018 18.6026 12.3648 Constraint 604 687 10.9956 13.7446 20.6168 12.3429 Constraint 303 577 10.1209 12.6511 18.9766 12.3419 Constraint 297 577 10.8821 13.6026 20.4039 12.3419 Constraint 279 577 11.5019 14.3773 21.5660 12.3419 Constraint 391 599 9.0141 11.2677 16.9015 12.1780 Constraint 613 698 13.1900 16.4875 24.7313 12.1423 Constraint 382 535 11.1169 13.8961 20.8441 12.1373 Constraint 182 577 11.8656 14.8320 22.2480 12.1352 Constraint 88 535 10.1420 12.6775 19.0163 12.1209 Constraint 429 585 10.3639 12.9548 19.4322 12.0940 Constraint 442 535 12.0263 15.0329 22.5493 12.0334 Constraint 435 629 10.3485 12.9356 19.4034 12.0105 Constraint 480 622 10.5285 13.1606 19.7409 11.9805 Constraint 153 285 13.1403 16.4254 24.6381 11.9784 Constraint 176 350 13.7874 17.2343 25.8514 11.9776 Constraint 136 350 12.5732 15.7165 23.5748 11.9776 Constraint 169 350 12.2658 15.3322 22.9983 11.9695 Constraint 360 535 7.8607 9.8259 14.7389 11.9497 Constraint 341 535 11.8770 14.8463 22.2694 11.9497 Constraint 382 604 11.5134 14.3918 21.5876 11.9374 Constraint 375 604 10.3701 12.9626 19.4439 11.9374 Constraint 368 604 11.8619 14.8273 22.2410 11.9374 Constraint 399 622 10.2993 12.8741 19.3111 11.9243 Constraint 292 604 9.3760 11.7200 17.5799 11.9163 Constraint 467 585 9.3127 11.6409 17.4613 11.8870 Constraint 461 590 11.6649 14.5812 21.8717 11.8870 Constraint 461 585 10.3285 12.9106 19.3659 11.8870 Constraint 292 535 11.8932 14.8665 22.2998 11.8807 Constraint 449 585 12.5875 15.7344 23.6015 11.8748 Constraint 80 368 13.3540 16.6925 25.0388 11.8450 Constraint 80 527 9.4109 11.7636 17.6454 11.8146 Constraint 599 687 10.8009 13.5011 20.2516 11.7699 Constraint 182 382 13.4907 16.8634 25.2951 11.7627 Constraint 341 577 10.3349 12.9186 19.3779 11.7007 Constraint 322 613 10.9337 13.6671 20.5006 11.6897 Constraint 88 599 11.4019 14.2524 21.3785 11.6548 Constraint 412 613 11.3439 14.1799 21.2698 11.6228 Constraint 242 604 9.6515 12.0644 18.0966 11.5952 Constraint 480 629 8.9723 11.2154 16.8231 11.5757 Constraint 604 698 11.3667 14.2084 21.3126 11.5471 Constraint 303 585 12.8375 16.0468 24.0702 11.5425 Constraint 360 599 9.1539 11.4424 17.1636 11.5113 Constraint 480 590 9.9864 12.4830 18.7246 11.5027 Constraint 341 599 12.5050 15.6313 23.4470 11.4911 Constraint 104 552 11.8974 14.8718 22.3077 11.4759 Constraint 404 585 10.8767 13.5959 20.3938 11.4451 Constraint 404 599 7.7848 9.7310 14.5966 11.4298 Constraint 404 590 9.2115 11.5144 17.2717 11.4298 Constraint 435 622 10.5055 13.1318 19.6978 11.4253 Constraint 144 330 14.0949 17.6186 26.4279 11.4097 Constraint 322 585 10.9783 13.7228 20.5842 11.3974 Constraint 314 585 11.2719 14.0898 21.1347 11.3974 Constraint 467 629 9.5932 11.9915 17.9872 11.3667 Constraint 467 622 11.1944 13.9930 20.9896 11.3667 Constraint 467 613 10.3868 12.9835 19.4752 11.3667 Constraint 473 604 7.2151 9.0188 13.5282 11.3648 Constraint 303 461 12.8762 16.0953 24.1429 11.3515 Constraint 285 577 11.7768 14.7210 22.0815 11.3256 Constraint 272 577 12.6576 15.8220 23.7330 11.3256 Constraint 404 535 9.4640 11.8300 17.7449 11.2228 Constraint 571 651 13.1690 16.4612 24.6919 11.2007 Constraint 629 706 11.0510 13.8137 20.7206 11.1424 Constraint 535 604 11.5048 14.3810 21.5714 11.1285 Constraint 242 535 11.4165 14.2707 21.4060 11.1209 Constraint 242 527 10.5146 13.1432 19.7148 11.1209 Constraint 96 535 9.9876 12.4845 18.7267 11.1209 Constraint 322 519 11.1186 13.8983 20.8475 11.1209 Constraint 314 519 10.1627 12.7034 19.0552 11.1209 Constraint 322 604 7.5479 9.4349 14.1524 11.1067 Constraint 368 599 9.7359 12.1698 18.2548 11.1065 Constraint 391 590 10.1335 12.6669 19.0003 11.0321 Constraint 382 599 9.8086 12.2608 18.3911 11.0321 Constraint 382 590 10.7665 13.4581 20.1871 11.0321 Constraint 442 629 9.8760 12.3450 18.5175 11.0105 Constraint 442 604 9.9066 12.3833 18.5749 10.9983 Constraint 421 636 12.5916 15.7395 23.6093 10.9942 Constraint 480 613 8.9412 11.1765 16.7647 10.9825 Constraint 136 279 14.2307 17.7884 26.6826 10.9303 Constraint 330 599 12.3801 15.4752 23.2127 10.9281 Constraint 473 585 8.4286 10.5357 15.8036 10.8707 Constraint 69 435 12.5818 15.7272 23.5908 10.8517 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 113 250 12.2716 15.3395 23.0092 10.8052 Constraint 88 279 12.2664 15.3330 22.9995 10.8052 Constraint 88 267 11.1444 13.9306 20.8958 10.8052 Constraint 88 250 8.5176 10.6469 15.9704 10.8052 Constraint 375 535 8.2071 10.2589 15.3883 10.8038 Constraint 368 535 9.0647 11.3308 16.9962 10.8038 Constraint 355 535 8.1668 10.2085 15.3127 10.8038 Constraint 350 535 9.9144 12.3929 18.5894 10.8038 Constraint 355 519 9.3970 11.7462 17.6194 10.8037 Constraint 350 519 11.4708 14.3386 21.5078 10.8037 Constraint 136 391 13.2901 16.6126 24.9189 10.8022 Constraint 435 585 12.3626 15.4532 23.1798 10.7940 Constraint 467 599 8.9105 11.1381 16.7071 10.7937 Constraint 473 599 7.6739 9.5923 14.3885 10.7919 Constraint 113 404 12.5035 15.6294 23.4441 10.7772 Constraint 429 590 8.8819 11.1024 16.6536 10.7452 Constraint 322 622 11.8177 14.7721 22.1581 10.6935 Constraint 190 399 13.9891 17.4864 26.2296 10.6934 Constraint 341 585 11.4938 14.3672 21.5508 10.6843 Constraint 355 527 9.1328 11.4160 17.1240 10.6405 Constraint 651 729 12.3755 15.4694 23.2041 10.6254 Constraint 442 599 10.8502 13.5628 20.3442 10.5943 Constraint 210 604 7.1220 8.9025 13.3537 10.5869 Constraint 201 604 9.4531 11.8164 17.7246 10.5869 Constraint 128 544 13.1859 16.4823 24.7235 10.5361 Constraint 330 585 12.1508 15.1885 22.7827 10.5262 Constraint 279 599 12.7629 15.9537 23.9305 10.5147 Constraint 292 622 11.6306 14.5382 21.8073 10.5032 Constraint 182 622 11.9171 14.8963 22.3445 10.5032 Constraint 176 613 12.5095 15.6368 23.4552 10.5032 Constraint 297 552 12.1297 15.1621 22.7431 10.4768 Constraint 350 467 13.1477 16.4346 24.6520 10.4580 Constraint 341 442 12.4915 15.6144 23.4216 10.4502 Constraint 421 590 9.7208 12.1511 18.2266 10.4452 Constraint 412 599 8.3951 10.4939 15.7409 10.4452 Constraint 412 590 10.6901 13.3626 20.0439 10.4452 Constraint 144 577 11.4683 14.3354 21.5031 10.4238 Constraint 467 604 7.5563 9.4454 14.1680 10.3667 Constraint 461 629 10.5382 13.1727 19.7591 10.3667 Constraint 375 599 8.7149 10.8937 16.3405 10.3653 Constraint 473 622 9.0539 11.3174 16.9761 10.3649 Constraint 449 604 10.9728 13.7160 20.5740 10.3546 Constraint 473 636 9.9436 12.4295 18.6442 10.3504 Constraint 449 552 12.0051 15.0064 22.5096 10.2535 Constraint 80 435 13.7075 17.1344 25.7015 10.1818 Constraint 210 629 7.8560 9.8200 14.7300 10.1105 Constraint 355 604 12.8113 16.0142 24.0213 10.0942 Constraint 480 585 7.2784 9.0980 13.6470 10.0816 Constraint 399 599 7.1324 8.9155 13.3732 10.0475 Constraint 399 590 8.6471 10.8089 16.2133 10.0475 Constraint 375 590 9.1344 11.4180 17.1270 10.0157 Constraint 360 590 9.7844 12.2305 18.3457 10.0157 Constraint 259 467 13.7611 17.2013 25.8020 9.9911 Constraint 535 613 12.2123 15.2654 22.8980 9.9826 Constraint 80 552 11.9155 14.8943 22.3415 9.9778 Constraint 368 590 10.2515 12.8144 19.2216 9.9605 Constraint 382 622 11.0153 13.7691 20.6537 9.9320 Constraint 360 613 11.7280 14.6599 21.9899 9.9320 Constraint 303 604 10.9403 13.6754 20.5131 9.9310 Constraint 221 604 10.2058 12.7573 19.1359 9.9202 Constraint 210 622 8.3573 10.4466 15.6699 9.9202 Constraint 210 613 9.1312 11.4140 17.1209 9.9202 Constraint 182 604 8.8883 11.1104 16.6656 9.9202 Constraint 176 604 9.6657 12.0822 18.1232 9.9202 Constraint 314 613 10.6129 13.2661 19.8992 9.9147 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 421 544 12.1256 15.1570 22.7355 9.8870 Constraint 303 511 13.3452 16.6815 25.0223 9.8725 Constraint 285 511 13.5427 16.9284 25.3926 9.8725 Constraint 259 511 13.5246 16.9058 25.3587 9.8725 Constraint 279 435 12.6429 15.8037 23.7055 9.8371 Constraint 69 497 5.1329 6.4161 9.6242 9.8353 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 467 10.9775 13.7219 20.5829 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 449 9.2700 11.5876 17.3813 9.8353 Constraint 69 442 11.6979 14.6224 21.9336 9.8353 Constraint 69 169 13.0591 16.3239 24.4859 9.8353 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 69 144 12.3422 15.4278 23.1417 9.8353 Constraint 69 136 11.9365 14.9207 22.3810 9.8353 Constraint 657 735 11.3058 14.1323 21.1985 9.7954 Constraint 651 735 12.7198 15.8997 23.8496 9.7954 Constraint 467 590 9.9819 12.4773 18.7160 9.7938 Constraint 360 585 10.5687 13.2108 19.8163 9.7886 Constraint 322 535 10.2675 12.8344 19.2515 9.7875 Constraint 314 535 8.6973 10.8716 16.3074 9.7875 Constraint 292 527 9.7505 12.1881 18.2821 9.7875 Constraint 449 599 10.1028 12.6285 18.9427 9.7816 Constraint 330 435 12.7931 15.9914 23.9871 9.7521 Constraint 297 604 10.0270 12.5338 18.8006 9.7221 Constraint 322 629 10.0994 12.6242 18.9363 9.7057 Constraint 292 629 10.1011 12.6264 18.9396 9.7057 Constraint 350 577 13.0897 16.3622 24.5432 9.7045 Constraint 88 604 10.5911 13.2388 19.8582 9.6548 Constraint 88 590 12.8798 16.0998 24.1496 9.6548 Constraint 644 720 11.8615 14.8268 22.2403 9.6273 Constraint 442 519 11.3932 14.2415 21.3622 9.6064 Constraint 237 604 8.8217 11.0272 16.5408 9.5991 Constraint 330 535 12.0328 15.0410 22.5615 9.5894 Constraint 480 636 9.0982 11.3728 17.0592 9.5613 Constraint 330 577 10.4785 13.0981 19.6471 9.5384 Constraint 279 571 13.5219 16.9023 25.3535 9.5384 Constraint 190 604 11.1065 13.8831 20.8247 9.5154 Constraint 292 467 12.4178 15.5223 23.2834 9.4741 Constraint 429 636 10.6506 13.3133 19.9700 9.4289 Constraint 144 527 9.5083 11.8854 17.8281 9.3846 Constraint 449 629 10.8969 13.6211 20.4317 9.3546 Constraint 259 604 10.6200 13.2749 19.9124 9.3195 Constraint 489 599 10.5323 13.1653 19.7480 9.3187 Constraint 599 698 11.1823 13.9778 20.9667 9.3075 Constraint 136 544 13.4108 16.7635 25.1453 9.2997 Constraint 467 552 11.0322 13.7902 20.6853 9.2555 Constraint 412 519 11.5519 14.4399 21.6599 9.2209 Constraint 88 629 12.1291 15.1613 22.7420 9.1785 Constraint 303 473 12.3234 15.4043 23.1065 9.1590 Constraint 382 527 10.5327 13.1658 19.7488 9.1373 Constraint 355 585 12.3753 15.4692 23.2037 9.1218 Constraint 489 577 10.8886 13.6108 20.4161 9.0631 Constraint 473 552 10.5132 13.1415 19.7123 9.0469 Constraint 449 577 11.3366 14.1708 21.2562 9.0407 Constraint 80 544 12.8724 16.0905 24.1358 8.9778 Constraint 153 350 14.0008 17.5010 26.2515 8.9776 Constraint 169 341 12.7732 15.9664 23.9497 8.9746 Constraint 404 636 10.9809 13.7261 20.5892 8.9596 Constraint 237 341 13.7201 17.1501 25.7252 8.9462 Constraint 237 330 14.0997 17.6246 26.4368 8.9322 Constraint 330 604 10.0545 12.5682 18.8522 8.9147 Constraint 285 604 10.8666 13.5833 20.3749 8.9147 Constraint 629 720 11.7344 14.6680 22.0020 8.9027 Constraint 629 713 10.9956 13.7445 20.6167 8.9027 Constraint 461 577 9.6313 12.0391 18.0587 8.8966 Constraint 535 622 11.7169 14.6461 21.9692 8.8893 Constraint 303 489 12.4041 15.5051 23.2577 8.8807 Constraint 297 489 11.7847 14.7309 22.0964 8.8807 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 80 201 13.5697 16.9622 25.4432 8.8357 Constraint 242 613 9.5926 11.9908 17.9862 8.7997 Constraint 237 629 7.4425 9.3031 13.9546 8.7895 Constraint 467 636 10.3582 12.9478 19.4216 8.7775 Constraint 267 497 14.0342 17.5428 26.3142 8.7706 Constraint 421 585 10.9619 13.7024 20.5535 8.7606 Constraint 429 552 11.3633 14.2042 21.3062 8.7430 Constraint 429 544 11.7930 14.7412 22.1118 8.7411 Constraint 104 375 13.1417 16.4271 24.6406 8.7270 Constraint 272 622 13.1157 16.3946 24.5919 8.7160 Constraint 190 622 11.5982 14.4977 21.7465 8.7160 Constraint 182 613 11.8267 14.7834 22.1751 8.7160 Constraint 176 622 10.8960 13.6200 20.4301 8.7160 Constraint 297 629 11.8784 14.8479 22.2719 8.7057 Constraint 221 629 10.0603 12.5754 18.8631 8.7057 Constraint 201 629 7.2126 9.0158 13.5237 8.7057 Constraint 182 629 9.3341 11.6676 17.5015 8.7057 Constraint 176 629 8.6640 10.8300 16.2450 8.7057 Constraint 226 497 13.9481 17.4351 26.1527 8.6855 Constraint 391 585 10.8900 13.6125 20.4188 8.6426 Constraint 382 585 11.7329 14.6662 21.9993 8.6426 Constraint 375 585 10.0254 12.5317 18.7976 8.6426 Constraint 368 585 11.3496 14.1870 21.2805 8.6426 Constraint 153 535 11.1620 13.9524 20.9287 8.6411 Constraint 144 535 10.0409 12.5512 18.8268 8.6411 Constraint 113 535 10.7988 13.4985 20.2477 8.6411 Constraint 201 599 8.8273 11.0341 16.5512 8.6100 Constraint 303 535 12.3765 15.4707 23.2060 8.5730 Constraint 571 657 12.1986 15.2483 22.8725 8.5538 Constraint 497 585 11.2464 14.0580 21.0870 8.5503 Constraint 136 552 12.9816 16.2270 24.3405 8.5363 Constraint 341 527 10.0273 12.5341 18.8012 8.5064 Constraint 201 382 13.9542 17.4428 26.1642 8.4849 Constraint 182 544 12.4253 15.5316 23.2974 8.4759 Constraint 435 599 9.5751 11.9689 17.9533 8.4606 Constraint 412 585 12.6860 15.8575 23.7863 8.4606 Constraint 382 519 12.2648 15.3310 22.9965 8.4209 Constraint 153 519 12.5801 15.7251 23.5877 8.3846 Constraint 341 552 10.8863 13.6079 20.4118 8.3836 Constraint 497 604 10.2062 12.7577 19.1366 8.3821 Constraint 322 552 12.4544 15.5680 23.3521 8.3673 Constraint 461 622 11.3586 14.1982 21.2973 8.3668 Constraint 461 613 11.1871 13.9838 20.9758 8.3668 Constraint 182 473 10.8789 13.5986 20.3979 8.3494 Constraint 489 590 12.0122 15.0152 22.5228 8.3207 Constraint 461 544 11.3727 14.2159 21.3238 8.2555 Constraint 449 544 11.8040 14.7551 22.1326 8.2536 Constraint 461 552 10.0295 12.5369 18.8053 8.2391 Constraint 153 552 12.6634 15.8292 23.7439 8.2363 Constraint 144 552 10.5911 13.2389 19.8584 8.2363 Constraint 113 552 11.1573 13.9466 20.9199 8.2363 Constraint 210 585 11.4220 14.2775 21.4162 8.2167 Constraint 552 636 13.0096 16.2620 24.3930 8.2065 Constraint 144 519 11.4747 14.3434 21.5151 8.1702 Constraint 250 622 10.5164 13.1454 19.7182 8.1330 Constraint 242 622 8.2205 10.2756 15.4134 8.1330 Constraint 237 622 5.5461 6.9326 10.3989 8.1330 Constraint 237 613 8.2910 10.3637 15.5456 8.1330 Constraint 226 622 9.3212 11.6516 17.4773 8.1330 Constraint 221 622 10.4835 13.1044 19.6566 8.1330 Constraint 201 622 7.8336 9.7921 14.6881 8.1330 Constraint 577 668 13.2242 16.5302 24.7953 8.1287 Constraint 368 519 11.6604 14.5755 21.8632 8.1209 Constraint 292 519 11.9132 14.8915 22.3372 8.1209 Constraint 242 519 11.6734 14.5918 21.8877 8.1209 Constraint 237 535 13.0638 16.3297 24.4946 8.1209 Constraint 237 527 11.9324 14.9155 22.3732 8.1209 Constraint 210 519 11.9483 14.9353 22.4030 8.1209 Constraint 480 577 9.5271 11.9088 17.8633 8.1056 Constraint 161 489 13.0825 16.3531 24.5296 8.0932 Constraint 144 585 11.4481 14.3101 21.4651 8.0906 Constraint 489 613 11.5214 14.4018 21.6027 8.0840 Constraint 489 604 9.8481 12.3102 18.4653 8.0821 Constraint 489 571 11.2271 14.0339 21.0508 8.0631 Constraint 88 585 10.6407 13.3008 19.9512 8.0586 Constraint 136 527 11.2814 14.1017 21.1526 8.0511 Constraint 69 267 13.8696 17.3370 26.0055 8.0149 Constraint 527 599 9.8904 12.3630 18.5445 8.0082 Constraint 480 657 10.4689 13.0862 19.6293 7.9884 Constraint 480 651 12.2055 15.2569 22.8853 7.9884 Constraint 480 644 11.4068 14.2585 21.3878 7.9884 Constraint 330 571 12.2936 15.3669 23.0504 7.9652 Constraint 297 599 10.3996 12.9994 19.4992 7.9432 Constraint 292 590 11.4477 14.3097 21.4645 7.9432 Constraint 272 599 10.6818 13.3523 20.0284 7.9432 Constraint 221 599 8.7764 10.9705 16.4557 7.9432 Constraint 190 599 10.1463 12.6829 19.0243 7.9432 Constraint 182 599 8.6422 10.8027 16.2041 7.9432 Constraint 182 590 12.2717 15.3396 23.0094 7.9432 Constraint 176 599 9.4077 11.7596 17.6394 7.9432 Constraint 122 577 10.2511 12.8138 19.2207 7.9263 Constraint 330 629 13.1089 16.3861 24.5791 7.9186 Constraint 303 629 13.5068 16.8835 25.3252 7.9186 Constraint 285 629 12.4653 15.5816 23.3724 7.9186 Constraint 259 629 11.0755 13.8444 20.7666 7.9186 Constraint 330 613 13.1013 16.3766 24.5649 7.9064 Constraint 303 613 13.5159 16.8949 25.3423 7.9064 Constraint 297 613 12.8784 16.0980 24.1469 7.9064 Constraint 292 613 10.6269 13.2836 19.9254 7.9064 Constraint 272 613 13.8888 17.3610 26.0415 7.9064 Constraint 604 706 12.2199 15.2749 22.9123 7.9046 Constraint 577 698 13.3141 16.6427 24.9640 7.9046 Constraint 113 368 14.1058 17.6322 26.4483 7.9038 Constraint 467 577 8.9345 11.1681 16.7521 7.8967 Constraint 473 577 9.1363 11.4203 17.1305 7.8948 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 250 467 14.3018 17.8772 26.8158 7.8098 Constraint 368 527 9.1837 11.4796 17.2195 7.8038 Constraint 350 527 8.2521 10.3151 15.4726 7.8038 Constraint 489 622 11.3558 14.1947 21.2921 7.7985 Constraint 473 651 10.5814 13.2268 19.8402 7.7756 Constraint 473 644 10.3382 12.9228 19.3842 7.7756 Constraint 285 622 13.3523 16.6903 25.0355 7.7282 Constraint 272 604 10.6690 13.3363 20.0045 7.7282 Constraint 259 622 11.0070 13.7588 20.6382 7.7282 Constraint 250 613 12.2132 15.2665 22.8997 7.7282 Constraint 226 613 11.8197 14.7747 22.1620 7.7282 Constraint 221 613 11.6133 14.5166 21.7749 7.7282 Constraint 201 613 9.8964 12.3705 18.5558 7.7282 Constraint 190 613 13.1999 16.4998 24.7497 7.7282 Constraint 322 636 10.9063 13.6329 20.4494 7.7211 Constraint 176 636 10.7271 13.4089 20.1134 7.7211 Constraint 297 544 11.9613 14.9516 22.4274 7.6663 Constraint 297 535 12.9470 16.1837 24.2756 7.6663 Constraint 96 604 11.7655 14.7068 22.0603 7.6587 Constraint 96 599 10.6787 13.3484 20.0226 7.6587 Constraint 399 585 8.6944 10.8680 16.3020 7.6580 Constraint 169 535 12.2047 15.2558 22.8837 7.6411 Constraint 128 535 10.6300 13.2875 19.9312 7.6411 Constraint 169 613 10.4593 13.0742 19.6112 7.6331 Constraint 169 604 8.1601 10.2001 15.3001 7.6331 Constraint 237 599 6.7417 8.4272 12.6408 7.6222 Constraint 210 590 9.7861 12.2327 18.3490 7.6222 Constraint 421 577 10.2350 12.7938 19.1907 7.5829 Constraint 527 604 11.1622 13.9527 20.9290 7.5812 Constraint 350 552 13.0806 16.3507 24.5261 7.5740 Constraint 303 552 10.3788 12.9735 19.4602 7.5740 Constraint 279 552 11.9216 14.9020 22.3530 7.5740 Constraint 629 729 12.8289 16.0361 24.0541 7.5692 Constraint 355 629 12.0916 15.1145 22.6717 7.5675 Constraint 330 557 12.8464 16.0580 24.0870 7.5557 Constraint 360 629 10.0980 12.6225 18.9338 7.5511 Constraint 176 590 12.8367 16.0459 24.0689 7.5384 Constraint 128 552 12.3366 15.4208 23.1311 7.5363 Constraint 144 599 11.7466 14.6832 22.0249 7.4993 Constraint 435 651 13.5753 16.9691 25.4536 7.4443 Constraint 429 644 12.9091 16.1364 24.2046 7.4443 Constraint 435 577 10.7906 13.4883 20.2324 7.4350 Constraint 435 613 9.2540 11.5675 17.3512 7.4350 Constraint 144 544 11.0208 13.7760 20.6641 7.4267 Constraint 136 535 11.9324 14.9155 22.3732 7.4267 Constraint 292 585 11.6770 14.5962 21.8944 7.4071 Constraint 144 604 10.9273 13.6591 20.4886 7.4022 Constraint 341 544 13.1870 16.4838 24.7257 7.3990 Constraint 497 613 10.7565 13.4456 20.1683 7.3822 Constraint 272 552 13.8971 17.3713 26.0570 7.3673 Constraint 182 552 12.5357 15.6697 23.5045 7.3673 Constraint 421 651 12.8163 16.0204 24.0306 7.3505 Constraint 330 461 11.5586 14.4483 21.6724 7.2919 Constraint 467 544 10.0366 12.5457 18.8186 7.2555 Constraint 96 585 12.8507 16.0634 24.0951 7.2539 Constraint 449 571 13.0527 16.3159 24.4739 7.2535 Constraint 442 577 10.9793 13.7241 20.5862 7.2475 Constraint 636 720 12.8155 16.0194 24.0290 7.2378 Constraint 636 713 11.9933 14.9916 22.4875 7.2378 Constraint 144 557 11.1781 13.9727 20.9590 7.2343 Constraint 104 382 13.1912 16.4890 24.7335 7.2099 Constraint 153 511 12.2299 15.2874 22.9310 7.1702 Constraint 590 676 13.0580 16.3225 24.4837 7.1548 Constraint 355 599 9.2812 11.6015 17.4023 7.1526 Constraint 226 604 10.4012 13.0015 19.5022 7.1452 Constraint 88 552 9.8091 12.2614 18.3921 7.1430 Constraint 210 636 9.8083 12.2604 18.3906 7.1381 Constraint 341 571 11.5852 14.4815 21.7223 7.1276 Constraint 355 651 12.0369 15.0461 22.5691 7.1241 Constraint 391 657 12.8339 16.0424 24.0636 7.1209 Constraint 391 644 13.5702 16.9628 25.4441 7.1209 Constraint 360 657 12.6424 15.8030 23.7045 7.1209 Constraint 360 644 12.5741 15.7176 23.5764 7.1209 Constraint 480 557 11.0056 13.7570 20.6355 7.0468 Constraint 480 571 9.6566 12.0708 18.1062 7.0449 Constraint 80 250 12.0620 15.0775 22.6162 7.0153 Constraint 80 237 11.0143 13.7679 20.6519 7.0153 Constraint 442 622 7.2932 9.1165 13.6748 7.0079 Constraint 442 613 8.6592 10.8240 16.2360 7.0079 Constraint 382 629 8.9664 11.2079 16.8119 7.0067 Constraint 467 657 11.7063 14.6329 21.9494 6.9903 Constraint 644 729 12.6377 15.7972 23.6957 6.9759 Constraint 412 636 13.0977 16.3721 24.5581 6.9750 Constraint 169 622 9.2775 11.5969 17.3953 6.9663 Constraint 341 557 12.3312 15.4141 23.1211 6.9381 Constraint 330 590 12.8800 16.1000 24.1500 6.9378 Constraint 314 636 12.7145 15.8932 23.8397 6.9340 Constraint 136 577 10.8025 13.5032 20.2547 6.9264 Constraint 113 577 10.6878 13.3598 20.0396 6.9264 Constraint 285 613 12.7572 15.9464 23.9197 6.9186 Constraint 279 604 11.9374 14.9217 22.3826 6.9186 Constraint 272 629 10.5541 13.1926 19.7889 6.9186 Constraint 267 629 12.8427 16.0534 24.0802 6.9186 Constraint 267 604 12.0117 15.0146 22.5219 6.9186 Constraint 259 613 11.4374 14.2967 21.4451 6.9186 Constraint 190 629 8.8907 11.1133 16.6700 6.9186 Constraint 421 557 12.1352 15.1690 22.7535 6.8890 Constraint 421 552 10.9939 13.7423 20.6135 6.8890 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 297 12.4181 15.5226 23.2839 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 58 210 13.4081 16.7601 25.1401 6.8531 Constraint 169 629 8.2924 10.3655 15.5483 6.8235 Constraint 449 590 11.7748 14.7185 22.0778 6.7939 Constraint 182 467 11.8010 14.7512 22.1269 6.7922 Constraint 341 519 10.6890 13.3612 20.0418 6.7875 Constraint 341 489 11.9272 14.9090 22.3635 6.7875 Constraint 330 519 11.0490 13.8113 20.7169 6.7875 Constraint 330 489 10.9966 13.7458 20.6187 6.7875 Constraint 303 527 9.4890 11.8612 17.7918 6.7875 Constraint 303 519 11.9943 14.9929 22.4893 6.7875 Constraint 297 527 9.9482 12.4353 18.6530 6.7875 Constraint 297 519 13.0113 16.2641 24.3961 6.7875 Constraint 285 527 10.0309 12.5387 18.8080 6.7875 Constraint 285 519 13.1150 16.3937 24.5906 6.7875 Constraint 279 527 12.9570 16.1963 24.2944 6.7875 Constraint 272 527 12.5725 15.7157 23.5735 6.7875 Constraint 267 527 12.8076 16.0095 24.0142 6.7875 Constraint 259 535 10.9586 13.6982 20.5474 6.7875 Constraint 259 527 9.4405 11.8006 17.7010 6.7875 Constraint 259 519 12.8745 16.0931 24.1396 6.7875 Constraint 259 489 12.6617 15.8271 23.7406 6.7875 Constraint 250 535 12.6318 15.7897 23.6846 6.7875 Constraint 250 527 12.0037 15.0046 22.5069 6.7875 Constraint 226 527 12.7838 15.9797 23.9695 6.7875 Constraint 221 535 12.7837 15.9797 23.9695 6.7875 Constraint 221 527 9.9513 12.4391 18.6587 6.7875 Constraint 221 489 12.4876 15.6095 23.4143 6.7875 Constraint 201 527 13.0146 16.2683 24.4024 6.7875 Constraint 182 527 11.1923 13.9903 20.9855 6.7875 Constraint 473 590 6.7083 8.3854 12.5781 6.7775 Constraint 467 644 12.7249 15.9061 23.8592 6.7775 Constraint 461 636 11.6594 14.5742 21.8614 6.7775 Constraint 429 651 11.9034 14.8793 22.3189 6.7775 Constraint 412 651 12.8396 16.0495 24.0743 6.7775 Constraint 314 577 7.2042 9.0052 13.5078 6.7525 Constraint 314 651 13.6530 17.0663 25.5994 6.7442 Constraint 297 585 12.0699 15.0874 22.6311 6.7403 Constraint 322 651 11.1283 13.9103 20.8655 6.7365 Constraint 297 590 12.7287 15.9108 23.8662 6.7288 Constraint 341 435 11.7937 14.7421 22.1131 6.6727 Constraint 136 599 11.6718 14.5897 21.8846 6.6644 Constraint 122 599 10.2735 12.8419 19.2629 6.6644 Constraint 113 599 11.0690 13.8363 20.7545 6.6644 Constraint 399 552 12.0783 15.0978 22.6468 6.6498 Constraint 169 599 8.7472 10.9340 16.4010 6.6408 Constraint 169 590 11.9971 14.9964 22.4947 6.6408 Constraint 497 599 10.0075 12.5094 18.7641 6.6188 Constraint 88 577 10.2739 12.8423 19.2635 6.5929 Constraint 330 544 11.3600 14.2000 21.3000 6.5894 Constraint 489 629 9.1735 11.4668 17.2003 6.5841 Constraint 644 735 12.3048 15.3810 23.0715 6.5711 Constraint 636 729 13.3792 16.7240 25.0859 6.5711 Constraint 519 599 10.7400 13.4251 20.1376 6.5622 Constraint 322 577 7.2363 9.0453 13.5680 6.5622 Constraint 292 577 8.4433 10.5542 15.8313 6.5622 Constraint 259 577 10.1894 12.7368 19.1052 6.5622 Constraint 242 577 9.5870 11.9837 17.9756 6.5622 Constraint 237 577 11.1710 13.9638 20.9456 6.5622 Constraint 221 577 10.5515 13.1893 19.7840 6.5622 Constraint 210 577 8.7197 10.8996 16.3495 6.5622 Constraint 210 651 12.6651 15.8313 23.7470 6.5583 Constraint 330 552 9.5099 11.8874 17.8310 6.5576 Constraint 497 577 9.6883 12.1104 18.1655 6.5535 Constraint 360 636 12.3198 15.3998 23.0996 6.5511 Constraint 297 473 10.5982 13.2478 19.8717 6.4513 Constraint 176 473 11.9324 14.9154 22.3732 6.4513 Constraint 136 473 11.5766 14.4707 21.7061 6.4513 Constraint 96 552 11.8397 14.7996 22.1995 6.4431 Constraint 429 577 8.9522 11.1902 16.7854 6.4369 Constraint 322 544 13.8319 17.2898 25.9347 6.3827 Constraint 250 604 10.9091 13.6363 20.4545 6.3356 Constraint 104 535 10.0305 12.5381 18.8072 6.3076 Constraint 461 557 12.0065 15.0081 22.5122 6.2391 Constraint 144 571 10.9867 13.7333 20.6000 6.2362 Constraint 153 557 12.3576 15.4470 23.1706 6.2343 Constraint 292 480 11.8497 14.8121 22.2182 6.2038 Constraint 144 272 13.8229 17.2786 25.9179 6.1990 Constraint 144 250 13.3771 16.7214 25.0821 6.1990 Constraint 267 599 11.0915 13.8643 20.7965 6.1561 Constraint 226 599 8.2691 10.3363 15.5045 6.1561 Constraint 210 657 12.1406 15.1758 22.7637 6.1535 Constraint 350 599 11.6677 14.5847 21.8770 6.1526 Constraint 122 552 9.7530 12.1913 18.2869 6.1430 Constraint 399 657 10.9192 13.6490 20.4735 6.1363 Constraint 391 651 11.6528 14.5660 21.8490 6.1363 Constraint 368 651 9.5549 11.9436 17.9154 6.1363 Constraint 368 644 11.7228 14.6536 21.9803 6.1363 Constraint 360 651 11.3627 14.2034 21.3050 6.1363 Constraint 519 604 12.0702 15.0877 22.6316 6.1352 Constraint 461 571 11.9751 14.9689 22.4533 6.1095 Constraint 489 585 9.9037 12.3796 18.5694 6.1063 Constraint 80 272 14.2721 17.8402 26.7602 6.0999 Constraint 144 590 12.4242 15.5302 23.2953 6.0945 Constraint 473 571 10.8164 13.5205 20.2807 6.0469 Constraint 473 557 10.7444 13.4305 20.1458 6.0469 Constraint 161 577 11.0215 13.7769 20.6654 6.0235 Constraint 69 279 13.0596 16.3245 24.4867 6.0150 Constraint 69 272 13.9362 17.4203 26.1305 6.0150 Constraint 355 590 9.8167 12.2709 18.4063 6.0067 Constraint 350 590 13.2355 16.5444 24.8166 6.0067 Constraint 399 636 10.0824 12.6031 18.9046 5.9904 Constraint 382 636 11.8288 14.7860 22.1790 5.9904 Constraint 375 636 8.4615 10.5769 15.8654 5.9904 Constraint 375 629 5.0053 6.2566 9.3849 5.9904 Constraint 375 622 5.3508 6.6885 10.0328 5.9904 Constraint 368 629 8.6082 10.7602 16.1404 5.9904 Constraint 368 622 8.1084 10.1355 15.2032 5.9904 Constraint 368 613 11.2037 14.0046 21.0069 5.9904 Constraint 360 622 9.0011 11.2513 16.8770 5.9904 Constraint 355 622 10.5374 13.1717 19.7576 5.9904 Constraint 355 613 12.7703 15.9629 23.9443 5.9904 Constraint 144 404 13.2705 16.5882 24.8822 5.9901 Constraint 201 350 14.2540 17.8175 26.7263 5.9890 Constraint 144 350 14.0060 17.5075 26.2613 5.9890 Constraint 153 303 14.0103 17.5129 26.2693 5.9886 Constraint 153 267 13.5587 16.9483 25.4225 5.9886 Constraint 473 657 8.6288 10.7860 16.1791 5.9884 Constraint 153 341 12.6217 15.7771 23.6657 5.9828 Constraint 489 657 12.1785 15.2231 22.8347 5.9726 Constraint 303 590 12.2908 15.3635 23.0453 5.9500 Constraint 412 577 10.6866 13.3583 20.0374 5.9475 Constraint 297 636 12.1898 15.2372 22.8559 5.9340 Constraint 292 636 11.4139 14.2674 21.4011 5.9340 Constraint 272 636 13.0596 16.3245 24.4868 5.9340 Constraint 190 636 11.8889 14.8611 22.2916 5.9340 Constraint 182 636 10.2565 12.8206 19.2309 5.9340 Constraint 250 629 10.5993 13.2492 19.8738 5.9308 Constraint 226 629 7.5958 9.4948 14.2422 5.9308 Constraint 88 613 12.3477 15.4347 23.1520 5.8549 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 480 12.6846 15.8557 23.7836 5.8367 Constraint 58 473 12.4000 15.5000 23.2500 5.8367 Constraint 58 467 14.1825 17.7281 26.5921 5.8367 Constraint 58 461 12.3920 15.4900 23.2350 5.8367 Constraint 58 449 11.9904 14.9880 22.4819 5.8367 Constraint 58 429 12.2980 15.3725 23.0587 5.8367 Constraint 58 421 11.1855 13.9819 20.9728 5.8367 Constraint 58 182 13.7661 17.2077 25.8115 5.8367 Constraint 58 144 12.5389 15.6736 23.5104 5.8367 Constraint 58 136 11.9186 14.8983 22.3474 5.8367 Constraint 58 128 11.0615 13.8269 20.7403 5.8367 Constraint 169 636 8.8854 11.1067 16.6601 5.8357 Constraint 242 590 7.1438 8.9298 13.3946 5.8350 Constraint 237 590 7.5759 9.4699 14.2049 5.8350 Constraint 176 399 13.4771 16.8463 25.2695 5.8344 Constraint 497 590 10.2965 12.8706 19.3059 5.8092 Constraint 435 590 10.8722 13.5903 20.3854 5.8037 Constraint 519 622 10.8433 13.5541 20.3312 5.8017 Constraint 412 552 12.0799 15.0999 22.6499 5.7938 Constraint 404 577 8.4977 10.6221 15.9332 5.7881 Constraint 557 644 12.5251 15.6564 23.4846 5.7620 Constraint 182 651 11.1059 13.8824 20.8235 5.7590 Constraint 190 590 12.9235 16.1543 24.2315 5.7513 Constraint 136 604 9.1653 11.4567 17.1850 5.6645 Constraint 128 604 8.7007 10.8759 16.3138 5.6645 Constraint 128 599 9.6290 12.0363 18.0544 5.6645 Constraint 128 590 11.6310 14.5388 21.8082 5.6645 Constraint 122 604 8.7890 10.9862 16.4794 5.6645 Constraint 113 604 9.0652 11.3315 16.9972 5.6645 Constraint 104 604 8.9112 11.1389 16.7084 5.6645 Constraint 435 636 12.3627 15.4533 23.1800 5.6571 Constraint 399 544 12.1619 15.2023 22.8035 5.6498 Constraint 80 599 12.3419 15.4274 23.1411 5.5866 Constraint 169 651 11.7107 14.6383 21.9575 5.5737 Constraint 341 461 13.8524 17.3154 25.9732 5.5730 Constraint 303 544 12.4717 15.5897 23.3845 5.5730 Constraint 285 535 11.1821 13.9776 20.9664 5.5730 Constraint 279 544 12.2520 15.3150 22.9725 5.5730 Constraint 272 544 13.5493 16.9366 25.4049 5.5730 Constraint 267 535 14.2425 17.8031 26.7047 5.5730 Constraint 226 375 14.2353 17.7942 26.6913 5.5730 Constraint 176 544 13.8175 17.2718 25.9078 5.5730 Constraint 412 657 12.5054 15.6318 23.4477 5.5633 Constraint 382 657 10.4582 13.0727 19.6091 5.5633 Constraint 375 657 8.1899 10.2374 15.3561 5.5633 Constraint 368 657 11.4627 14.3284 21.4925 5.5633 Constraint 182 585 11.6123 14.5153 21.7730 5.5538 Constraint 176 585 12.0601 15.0751 22.6127 5.5538 Constraint 442 552 11.1960 13.9951 20.9926 5.5536 Constraint 237 355 14.1605 17.7006 26.5509 5.4851 Constraint 96 544 11.3083 14.1354 21.2031 5.4431 Constraint 242 585 10.7567 13.4459 20.1689 5.4417 Constraint 136 571 13.3969 16.7461 25.1192 5.4228 Constraint 314 668 13.0258 16.2823 24.4234 5.3644 Constraint 449 622 8.7214 10.9017 16.3526 5.3643 Constraint 449 613 9.6041 12.0052 18.0078 5.3643 Constraint 322 644 9.8755 12.3443 18.5165 5.3542 Constraint 272 651 13.1903 16.4878 24.7318 5.3542 Constraint 182 644 9.3390 11.6737 17.5105 5.3542 Constraint 237 636 10.0150 12.5187 18.7781 5.3510 Constraint 201 636 8.7188 10.8985 16.3478 5.3510 Constraint 527 613 11.0129 13.7662 20.6493 5.3256 Constraint 182 375 12.8574 16.0718 24.1077 5.3062 Constraint 144 391 12.7798 15.9747 23.9620 5.2920 Constraint 136 585 9.6829 12.1037 18.1555 5.2597 Constraint 128 585 9.3195 11.6494 17.4740 5.2597 Constraint 122 585 9.7205 12.1507 18.2260 5.2597 Constraint 113 585 10.0465 12.5581 18.8372 5.2597 Constraint 467 557 11.9071 14.8839 22.3258 5.2391 Constraint 161 613 11.7941 14.7426 22.1139 5.2391 Constraint 153 571 11.6138 14.5172 21.7759 5.2363 Constraint 153 544 11.1909 13.9886 20.9829 5.2363 Constraint 201 585 12.1342 15.1677 22.7516 5.2327 Constraint 272 497 13.4534 16.8167 25.2251 5.2057 Constraint 210 480 12.1621 15.2026 22.8039 5.2057 Constraint 80 604 12.8246 16.0308 24.0461 5.1818 Constraint 80 590 13.6122 17.0152 25.5228 5.1818 Constraint 201 644 10.0204 12.5255 18.7882 5.1760 Constraint 176 644 8.6263 10.7829 16.1743 5.1760 Constraint 169 657 11.2965 14.1206 21.1809 5.1689 Constraint 259 590 9.5860 11.9825 17.9738 5.1683 Constraint 250 599 7.7196 9.6494 14.4742 5.1683 Constraint 250 590 9.0578 11.3222 16.9833 5.1683 Constraint 226 590 10.5378 13.1722 19.7583 5.1683 Constraint 221 590 10.3070 12.8837 19.3256 5.1683 Constraint 201 590 10.4825 13.1031 19.6546 5.1683 Constraint 399 577 9.6134 12.0168 18.0252 5.1468 Constraint 122 544 9.8603 12.3254 18.4880 5.1431 Constraint 113 544 10.9310 13.6637 20.4956 5.1431 Constraint 88 544 8.8191 11.0239 16.5359 5.1431 Constraint 122 571 12.7976 15.9970 23.9955 5.1392 Constraint 391 577 7.6385 9.5482 14.3222 5.1315 Constraint 360 577 8.7455 10.9319 16.3978 5.1315 Constraint 360 571 9.4810 11.8513 17.7769 5.1315 Constraint 355 577 10.5520 13.1901 19.7851 5.1315 Constraint 242 571 9.5435 11.9293 17.8940 5.1123 Constraint 467 571 11.3331 14.1664 21.2496 5.1095 Constraint 341 668 12.3669 15.4586 23.1879 5.1075 Constraint 341 644 13.9623 17.4529 26.1793 5.1075 Constraint 668 742 9.3796 11.7244 17.5867 5.0954 Constraint 657 742 11.4732 14.3415 21.5123 5.0954 Constraint 350 604 13.1787 16.4733 24.7100 5.0876 Constraint 221 467 12.8741 16.0926 24.1388 5.0051 Constraint 201 467 11.4873 14.3591 21.5386 5.0051 Constraint 176 467 12.5177 15.6471 23.4707 5.0051 Constraint 104 599 8.5214 10.6518 15.9777 4.9977 Constraint 622 706 11.0613 13.8267 20.7400 4.9963 Constraint 527 629 9.3628 11.7035 17.5553 4.9921 Constraint 511 629 11.0937 13.8672 20.8007 4.9921 Constraint 511 604 10.6081 13.2601 19.8902 4.9921 Constraint 144 360 12.8692 16.0864 24.1297 4.9920 Constraint 467 651 12.6493 15.8116 23.7174 4.9904 Constraint 435 657 11.9924 14.9905 22.4857 4.9904 Constraint 429 657 10.8751 13.5938 20.3907 4.9904 Constraint 404 657 8.2415 10.3018 15.4527 4.9904 Constraint 404 651 8.5264 10.6580 15.9870 4.9904 Constraint 404 644 10.8862 13.6078 20.4116 4.9904 Constraint 399 651 9.4730 11.8412 17.7618 4.9904 Constraint 399 644 10.8733 13.5916 20.3875 4.9904 Constraint 391 636 12.8801 16.1001 24.1501 4.9904 Constraint 382 651 8.6567 10.8208 16.2312 4.9904 Constraint 382 644 11.8674 14.8342 22.2513 4.9904 Constraint 375 651 5.6128 7.0160 10.5241 4.9904 Constraint 375 644 8.0069 10.0087 15.0130 4.9904 Constraint 368 636 11.6961 14.6201 21.9301 4.9904 Constraint 350 622 13.5836 16.9795 25.4692 4.9904 Constraint 497 622 9.1902 11.4878 17.2316 4.9890 Constraint 480 668 11.2368 14.0460 21.0689 4.9884 Constraint 473 668 10.5373 13.1716 19.7574 4.9884 Constraint 322 571 10.2019 12.7523 19.1285 4.9654 Constraint 314 571 8.1418 10.1773 15.2659 4.9654 Constraint 303 571 10.3347 12.9183 19.3775 4.9654 Constraint 292 571 10.8359 13.5449 20.3174 4.9654 Constraint 285 571 10.8206 13.5257 20.2886 4.9654 Constraint 259 571 10.8061 13.5077 20.2615 4.9654 Constraint 322 657 10.6507 13.3133 19.9700 4.9596 Constraint 360 557 10.8354 13.5443 20.3164 4.9565 Constraint 330 651 10.0868 12.6085 18.9128 4.9494 Constraint 330 644 10.0074 12.5092 18.7638 4.9494 Constraint 297 651 10.9259 13.6574 20.4861 4.9494 Constraint 297 644 10.3033 12.8791 19.3187 4.9494 Constraint 292 651 12.8065 16.0081 24.0122 4.9494 Constraint 272 644 11.9259 14.9074 22.3611 4.9494 Constraint 226 636 12.1506 15.1882 22.7823 4.9462 Constraint 221 636 12.0514 15.0643 22.5964 4.9462 Constraint 272 590 12.8088 16.0110 24.0165 4.9416 Constraint 201 473 12.1583 15.1978 22.7968 4.9300 Constraint 421 657 12.4963 15.6204 23.4307 4.9254 Constraint 201 368 13.7072 17.1341 25.7011 4.9120 Constraint 128 571 13.0851 16.3563 24.5345 4.8990 Constraint 128 577 8.1456 10.1820 15.2730 4.8929 Constraint 169 382 14.1976 17.7469 26.6204 4.8711 Constraint 519 590 11.6174 14.5217 21.7826 4.8623 Constraint 511 590 12.3730 15.4663 23.1995 4.8623 Constraint 113 613 11.1766 13.9708 20.9562 4.8549 Constraint 113 590 12.1861 15.2326 22.8490 4.8549 Constraint 153 585 12.0631 15.0789 22.6183 4.8060 Constraint 527 622 8.5746 10.7183 16.0775 4.8018 Constraint 429 557 12.0210 15.0263 22.5394 4.7957 Constraint 421 571 10.8541 13.5676 20.3514 4.7957 Constraint 412 557 11.9867 14.9834 22.4751 4.7957 Constraint 341 480 10.7568 13.4460 20.1690 4.7834 Constraint 297 622 13.2585 16.5731 24.8597 4.7744 Constraint 421 644 13.3308 16.6635 24.9952 4.7718 Constraint 201 651 12.0911 15.1139 22.6709 4.7712 Constraint 176 651 10.2825 12.8532 19.2798 4.7712 Constraint 190 585 13.8956 17.3695 26.0542 4.7442 Constraint 96 613 12.4256 15.5320 23.2981 4.6683 Constraint 80 585 11.9049 14.8811 22.3217 4.6571 Constraint 161 604 8.7642 10.9552 16.4328 4.6561 Constraint 161 599 10.1930 12.7413 19.1119 4.6561 Constraint 435 552 11.1850 13.9813 20.9720 4.6479 Constraint 404 544 13.5238 16.9047 25.3571 4.6335 Constraint 104 577 7.7838 9.7297 14.5946 4.5929 Constraint 497 629 7.3720 9.2149 13.8224 4.5842 Constraint 161 622 12.0635 15.0793 22.6190 4.5724 Constraint 489 636 11.0236 13.7795 20.6693 4.5697 Constraint 226 577 11.4860 14.3575 21.5363 4.5660 Constraint 201 577 9.6781 12.0976 18.1464 4.5660 Constraint 190 577 10.8965 13.6206 20.4309 4.5660 Constraint 176 577 9.5913 11.9891 17.9837 4.5660 Constraint 382 668 13.1645 16.4556 24.6834 4.5633 Constraint 375 668 10.5819 13.2273 19.8410 4.5633 Constraint 511 599 11.0722 13.8402 20.7603 4.5623 Constraint 341 629 13.0854 16.3568 24.5352 4.5569 Constraint 421 668 13.7582 17.1977 25.7966 4.5499 Constraint 442 571 11.5692 14.4615 21.6922 4.4603 Constraint 136 613 11.1040 13.8800 20.8200 4.4501 Constraint 113 636 11.3574 14.1967 21.2951 4.4501 Constraint 104 585 8.4940 10.6175 15.9262 4.4501 Constraint 341 590 11.0609 13.8261 20.7391 4.3856 Constraint 322 668 9.1989 11.4986 17.2479 4.3664 Constraint 297 668 8.9684 11.2105 16.8158 4.3664 Constraint 292 668 10.4137 13.0171 19.5257 4.3664 Constraint 292 657 11.8200 14.7750 22.1624 4.3664 Constraint 292 644 10.7353 13.4191 20.1287 4.3664 Constraint 285 668 13.9483 17.4354 26.1531 4.3664 Constraint 272 676 12.5646 15.7057 23.5586 4.3664 Constraint 272 668 10.3027 12.8783 19.3175 4.3664 Constraint 221 668 11.6433 14.5541 21.8312 4.3664 Constraint 210 668 10.2023 12.7528 19.1292 4.3664 Constraint 210 644 9.3205 11.6506 17.4760 4.3664 Constraint 201 668 10.4398 13.0498 19.5746 4.3664 Constraint 201 657 11.6135 14.5168 21.7753 4.3664 Constraint 190 668 9.8535 12.3169 18.4754 4.3664 Constraint 190 657 11.4202 14.2752 21.4128 4.3664 Constraint 190 651 12.7624 15.9530 23.9295 4.3664 Constraint 190 644 10.6077 13.2596 19.8894 4.3664 Constraint 182 676 9.7358 12.1698 18.2547 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 182 657 9.1175 11.3968 17.0953 4.3664 Constraint 176 676 10.6182 13.2728 19.9092 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 176 657 9.2254 11.5317 17.2976 4.3664 Constraint 242 636 11.4442 14.3052 21.4578 4.3587 Constraint 190 404 13.4222 16.7777 25.1666 4.3581 Constraint 176 404 12.9003 16.1253 24.1880 4.3581 Constraint 136 519 13.1321 16.4151 24.6227 4.3335 Constraint 590 687 11.8648 14.8310 22.2466 4.3301 Constraint 303 480 11.8692 14.8365 22.2547 4.3057 Constraint 297 480 10.9284 13.6605 20.4907 4.3057 Constraint 285 480 12.9121 16.1401 24.2102 4.3057 Constraint 128 375 14.2095 17.7618 26.6428 4.2899 Constraint 169 585 10.7208 13.4010 20.1015 4.2513 Constraint 161 585 9.9082 12.3853 18.5780 4.2513 Constraint 449 557 11.8186 14.7732 22.1599 4.2392 Constraint 169 571 13.7851 17.2314 25.8471 4.2363 Constraint 169 552 12.9210 16.1513 24.2269 4.2363 Constraint 169 544 11.8440 14.8050 22.2075 4.2363 Constraint 161 552 13.1064 16.3829 24.5744 4.2363 Constraint 153 599 10.8111 13.5139 20.2709 4.2146 Constraint 169 644 9.0752 11.3440 17.0160 4.1914 Constraint 88 657 11.7365 14.6706 22.0059 4.1901 Constraint 113 644 12.5386 15.6733 23.5099 4.1881 Constraint 113 629 9.9252 12.4066 18.6098 4.1881 Constraint 113 622 12.0632 15.0790 22.6184 4.1881 Constraint 104 622 10.2392 12.7990 19.1985 4.1881 Constraint 104 613 10.1453 12.6817 19.0225 4.1881 Constraint 104 590 10.0764 12.5955 18.8933 4.1881 Constraint 237 644 11.9856 14.9821 22.4731 4.1837 Constraint 391 557 9.3917 11.7396 17.6094 4.1469 Constraint 355 557 11.3817 14.2271 21.3406 4.1469 Constraint 153 577 10.9067 13.6333 20.4500 4.1430 Constraint 341 657 11.2228 14.0285 21.0428 4.1209 Constraint 80 382 13.9626 17.4532 26.1799 4.1163 Constraint 237 571 10.3461 12.9326 19.3990 4.1123 Constraint 391 552 8.9278 11.1598 16.7397 4.1105 Constraint 69 250 13.7359 17.1699 25.7548 4.0163 Constraint 58 285 12.5878 15.7347 23.6021 4.0163 Constraint 58 242 13.6345 17.0431 25.5646 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 341 13.7194 17.1492 25.7238 4.0163 Constraint 51 330 12.6862 15.8578 23.7866 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 292 13.4736 16.8420 25.2630 4.0163 Constraint 51 128 12.1092 15.1365 22.7047 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 41 360 14.0288 17.5361 26.3041 4.0163 Constraint 41 314 13.6431 17.0538 25.5807 4.0163 Constraint 41 113 12.3966 15.4958 23.2437 4.0163 Constraint 613 706 12.3901 15.4877 23.2315 3.9983 Constraint 519 629 9.8585 12.3232 18.4848 3.9921 Constraint 272 461 13.5180 16.8975 25.3462 3.9913 Constraint 176 497 12.9738 16.2173 24.3259 3.9913 Constraint 404 668 11.9346 14.9182 22.3773 3.9904 Constraint 391 571 6.0137 7.5172 11.2758 3.9855 Constraint 382 577 8.3938 10.4923 15.7385 3.9855 Constraint 382 571 7.2942 9.1178 13.6767 3.9855 Constraint 375 577 8.5375 10.6719 16.0079 3.9855 Constraint 375 571 8.2427 10.3034 15.4551 3.9855 Constraint 368 577 8.4518 10.5648 15.8472 3.9855 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 355 571 10.2479 12.8099 19.2149 3.9855 Constraint 350 571 11.7574 14.6968 22.0452 3.9855 Constraint 557 657 11.6926 14.6158 21.9237 3.9807 Constraint 341 706 11.5132 14.3915 21.5873 3.9750 Constraint 330 706 9.2476 11.5595 17.3392 3.9750 Constraint 330 698 11.2860 14.1075 21.1613 3.9750 Constraint 322 706 11.3874 14.2342 21.3514 3.9750 Constraint 322 698 12.7758 15.9698 23.9547 3.9750 Constraint 314 706 12.9270 16.1588 24.2381 3.9750 Constraint 303 706 11.9031 14.8788 22.3183 3.9750 Constraint 292 706 12.3381 15.4227 23.1340 3.9750 Constraint 279 698 13.2400 16.5500 24.8250 3.9750 Constraint 314 657 11.8044 14.7555 22.1333 3.9750 Constraint 314 676 12.8425 16.0531 24.0796 3.9673 Constraint 297 571 11.5842 14.4803 21.7204 3.9654 Constraint 285 585 11.5974 14.4968 21.7452 3.9654 Constraint 267 577 10.7662 13.4577 20.1865 3.9654 Constraint 259 585 11.6190 14.5238 21.7857 3.9654 Constraint 330 636 10.9837 13.7296 20.5944 3.9647 Constraint 341 676 12.1263 15.1579 22.7368 3.9616 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 330 668 8.4725 10.5907 15.8860 3.9616 Constraint 330 657 9.6266 12.0333 18.0499 3.9616 Constraint 322 676 9.2293 11.5366 17.3049 3.9616 Constraint 314 644 12.5000 15.6250 23.4376 3.9616 Constraint 303 668 12.8489 16.0611 24.0916 3.9616 Constraint 297 676 9.3739 11.7173 17.5760 3.9616 Constraint 297 657 10.0349 12.5436 18.8155 3.9616 Constraint 279 668 12.0012 15.0015 22.5023 3.9616 Constraint 272 657 11.6877 14.6096 21.9144 3.9616 Constraint 303 644 13.6301 17.0377 25.5565 3.9570 Constraint 279 644 13.3906 16.7382 25.1073 3.9570 Constraint 285 590 10.2577 12.8222 19.2333 3.9538 Constraint 279 590 14.0630 17.5787 26.3680 3.9538 Constraint 267 590 12.4954 15.6193 23.4289 3.9538 Constraint 259 636 13.6067 17.0083 25.5125 3.9538 Constraint 279 629 12.8200 16.0249 24.0374 3.9416 Constraint 136 557 10.5052 13.1315 19.6973 3.9009 Constraint 128 557 10.8112 13.5139 20.2709 3.9009 Constraint 113 557 11.6337 14.5422 21.8132 3.9009 Constraint 104 557 10.1808 12.7260 19.0889 3.9009 Constraint 303 467 10.9854 13.7318 20.5976 3.8804 Constraint 297 467 8.9438 11.1797 16.7696 3.8804 Constraint 161 473 8.9584 11.1980 16.7970 3.8804 Constraint 651 742 12.5722 15.7152 23.5728 3.8557 Constraint 644 742 10.9852 13.7315 20.5972 3.8557 Constraint 69 552 13.5063 16.8829 25.3244 3.8531 Constraint 58 404 13.7628 17.2035 25.8052 3.8531 Constraint 58 375 11.6794 14.5992 21.8989 3.8531 Constraint 382 552 9.6106 12.0133 18.0199 3.8105 Constraint 375 552 9.2928 11.6160 17.4240 3.8105 Constraint 360 552 9.0246 11.2808 16.9211 3.8105 Constraint 375 544 13.5737 16.9672 25.4507 3.8096 Constraint 360 544 12.9376 16.1720 24.2580 3.8096 Constraint 88 571 10.6174 13.2718 19.9077 3.8058 Constraint 519 613 11.8128 14.7660 22.1489 3.8018 Constraint 435 557 11.3454 14.1818 21.2727 3.7957 Constraint 322 557 10.8606 13.5757 20.3636 3.7923 Constraint 314 557 9.9164 12.3955 18.5933 3.7923 Constraint 267 622 13.9006 17.3757 26.0635 3.7866 Constraint 136 590 11.5408 14.4260 21.6390 3.7833 Constraint 104 636 10.7379 13.4224 20.1336 3.7833 Constraint 104 629 8.1346 10.1682 15.2523 3.7833 Constraint 210 571 10.3119 12.8899 19.3348 3.7788 Constraint 442 590 9.3094 11.6367 17.4551 3.7702 Constraint 442 585 10.3145 12.8931 19.3397 3.7702 Constraint 535 629 9.3602 11.7003 17.5504 3.7192 Constraint 128 613 10.2138 12.7672 19.1509 3.6683 Constraint 122 622 10.7926 13.4907 20.2361 3.6683 Constraint 122 613 10.6434 13.3043 19.9565 3.6683 Constraint 122 590 10.5325 13.1656 19.7484 3.6683 Constraint 96 590 10.9836 13.7294 20.5942 3.6683 Constraint 435 571 11.1491 13.9364 20.9046 3.6498 Constraint 429 571 10.9505 13.6881 20.5322 3.6498 Constraint 404 557 12.4398 15.5498 23.3247 3.6498 Constraint 404 552 11.0995 13.8743 20.8115 3.6498 Constraint 412 544 11.9468 14.9335 22.4003 3.6479 Constraint 571 644 11.8069 14.7586 22.1379 3.6161 Constraint 96 577 10.1302 12.6627 18.9941 3.5968 Constraint 161 590 11.5457 14.4321 21.6481 3.5846 Constraint 136 250 14.0948 17.6185 26.4277 3.5843 Constraint 330 480 12.2428 15.3035 22.9552 3.5690 Constraint 341 687 13.6788 17.0986 25.6478 3.5557 Constraint 399 557 11.6315 14.5394 21.8091 3.4623 Constraint 442 557 11.0769 13.8461 20.7691 3.4603 Constraint 442 544 10.3820 12.9775 19.4662 3.4603 Constraint 391 544 13.2945 16.6181 24.9272 3.4594 Constraint 237 585 9.6966 12.1207 18.1811 3.4456 Constraint 161 629 10.8461 13.5576 20.3364 3.4417 Constraint 201 535 13.5447 16.9308 25.3963 3.4267 Constraint 161 571 11.7167 14.6459 21.9689 3.4267 Constraint 161 544 9.7700 12.2125 18.3188 3.4267 Constraint 161 535 9.1285 11.4106 17.1159 3.4267 Constraint 80 535 7.0981 8.8727 13.3090 3.4048 Constraint 242 657 12.5782 15.7227 23.5841 3.3875 Constraint 297 698 11.0704 13.8380 20.7571 3.3818 Constraint 272 698 11.9642 14.9552 22.4328 3.3818 Constraint 267 668 13.8478 17.3097 25.9646 3.3818 Constraint 190 698 12.0980 15.1225 22.6838 3.3818 Constraint 182 698 10.4633 13.0791 19.6187 3.3818 Constraint 182 687 11.9522 14.9402 22.4103 3.3818 Constraint 176 698 10.9787 13.7234 20.5851 3.3818 Constraint 176 687 12.3863 15.4829 23.2244 3.3818 Constraint 169 698 13.2887 16.6109 24.9163 3.3818 Constraint 169 687 13.7257 17.1572 25.7358 3.3818 Constraint 169 676 11.2641 14.0801 21.1202 3.3818 Constraint 169 668 9.4042 11.7552 17.6328 3.3818 Constraint 330 473 12.1335 15.1668 22.7502 3.3806 Constraint 292 676 11.4543 14.3178 21.4767 3.3740 Constraint 226 668 13.0505 16.3132 24.4698 3.3740 Constraint 226 644 12.3075 15.3844 23.0765 3.3740 Constraint 221 644 11.0297 13.7871 20.6807 3.3740 Constraint 210 676 11.5051 14.3814 21.5721 3.3740 Constraint 201 676 12.3335 15.4169 23.1253 3.3740 Constraint 190 676 12.1710 15.2138 22.8207 3.3740 Constraint 449 657 12.5303 15.6628 23.4943 3.3601 Constraint 449 636 11.2641 14.0802 21.1202 3.3601 Constraint 412 571 10.6953 13.3691 20.0537 3.3498 Constraint 33 360 14.1610 17.7012 26.5518 3.3388 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 622 713 10.2080 12.7600 19.1400 3.3296 Constraint 577 687 11.2277 14.0346 21.0520 3.3296 Constraint 571 698 12.5180 15.6475 23.4713 3.3296 Constraint 571 687 11.6965 14.6206 21.9309 3.3296 Constraint 557 706 13.3322 16.6653 24.9979 3.3296 Constraint 279 480 13.5020 16.8775 25.3162 3.3076 Constraint 272 489 12.1729 15.2161 22.8242 3.3076 Constraint 272 480 11.9792 14.9740 22.4610 3.3076 Constraint 221 480 11.9320 14.9150 22.3726 3.3076 Constraint 182 535 12.2220 15.2775 22.9162 3.3076 Constraint 182 480 10.4188 13.0235 19.5353 3.3076 Constraint 442 657 13.2245 16.5306 24.7959 3.2320 Constraint 442 636 12.3668 15.4585 23.1878 3.2320 Constraint 153 590 12.2661 15.3326 22.9990 3.2146 Constraint 96 636 11.6166 14.5207 21.7811 3.1920 Constraint 96 629 8.9311 11.1639 16.7458 3.1920 Constraint 88 636 11.8169 14.7711 22.1566 3.1920 Constraint 88 622 11.5499 14.4374 21.6561 3.1920 Constraint 122 668 12.9830 16.2288 24.3432 3.1901 Constraint 122 657 10.9685 13.7106 20.5659 3.1901 Constraint 113 668 11.8192 14.7740 22.1610 3.1901 Constraint 104 668 11.4116 14.2645 21.3968 3.1901 Constraint 355 644 11.9016 14.8770 22.3156 3.1459 Constraint 122 557 11.1585 13.9481 20.9221 3.1412 Constraint 350 651 12.1581 15.1976 22.7965 3.1337 Constraint 341 651 13.4774 16.8468 25.2701 3.1306 Constraint 242 552 10.3386 12.9232 19.3848 3.1277 Constraint 279 497 13.8873 17.3591 26.0386 3.1125 Constraint 190 497 13.8692 17.3365 26.0048 3.1125 Constraint 136 480 11.2838 14.1047 21.1571 3.0913 Constraint 80 226 13.1256 16.4070 24.6105 3.0886 Constraint 144 622 12.3255 15.4069 23.1103 3.0726 Constraint 144 613 11.2804 14.1005 21.1508 3.0726 Constraint 442 651 11.9971 14.9964 22.4945 3.0269 Constraint 161 644 12.0042 15.0053 22.5079 3.0016 Constraint 128 622 8.7995 10.9994 16.4991 3.0016 Constraint 96 622 9.7228 12.1535 18.2303 3.0016 Constraint 404 571 7.6716 9.5895 14.3843 3.0009 Constraint 399 571 6.9044 8.6306 12.9458 3.0009 Constraint 382 557 8.8518 11.0648 16.5972 3.0009 Constraint 375 557 8.8090 11.0112 16.5169 3.0009 Constraint 368 557 8.5536 10.6920 16.0380 3.0009 Constraint 368 552 7.6438 9.5547 14.3321 3.0009 Constraint 355 552 9.3676 11.7095 17.5642 3.0009 Constraint 350 557 12.8424 16.0530 24.0795 3.0009 Constraint 161 527 13.3984 16.7480 25.1220 3.0000 Constraint 69 237 13.5123 16.8904 25.3356 3.0000 Constraint 58 153 14.3567 17.9459 26.9188 3.0000 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 467 12.1656 15.2071 22.8106 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 449 11.4549 14.3187 21.4780 3.0000 Constraint 51 429 11.6845 14.6056 21.9084 3.0000 Constraint 51 421 11.7813 14.7266 22.0899 3.0000 Constraint 51 355 10.7311 13.4139 20.1209 3.0000 Constraint 51 350 13.6796 17.0995 25.6492 3.0000 Constraint 51 153 13.6447 17.0559 25.5838 3.0000 Constraint 51 144 11.2868 14.1084 21.1627 3.0000 Constraint 51 136 12.0319 15.0399 22.5599 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 473 12.5906 15.7383 23.6075 3.0000 Constraint 41 467 14.1381 17.6726 26.5089 3.0000 Constraint 41 461 13.9501 17.4376 26.1565 3.0000 Constraint 41 429 14.3138 17.8923 26.8384 3.0000 Constraint 41 399 13.2985 16.6232 24.9347 3.0000 Constraint 41 355 11.5988 14.4986 21.7478 3.0000 Constraint 41 322 13.8643 17.3304 25.9956 3.0000 Constraint 41 122 13.3352 16.6690 25.0036 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 489 13.0759 16.3449 24.5173 3.0000 Constraint 33 355 11.4914 14.3642 21.5463 3.0000 Constraint 33 350 14.2217 17.7772 26.6657 3.0000 Constraint 33 341 12.9148 16.1436 24.2153 3.0000 Constraint 33 330 12.2735 15.3418 23.0128 3.0000 Constraint 33 322 12.0182 15.0227 22.5341 3.0000 Constraint 33 122 13.4578 16.8222 25.2333 3.0000 Constraint 33 113 10.9570 13.6962 20.5443 3.0000 Constraint 33 104 11.2225 14.0281 21.0421 3.0000 Constraint 153 382 14.3747 17.9684 26.9526 2.9983 Constraint 552 651 12.6876 15.8595 23.7893 2.9980 Constraint 144 341 11.0042 13.7552 20.6328 2.9942 Constraint 511 622 9.9739 12.4674 18.7011 2.9922 Constraint 113 375 13.6765 17.0956 25.6434 2.9918 Constraint 169 355 12.4567 15.5709 23.3563 2.9886 Constraint 161 350 13.1662 16.4577 24.6866 2.9886 Constraint 153 279 13.7664 17.2081 25.8121 2.9886 Constraint 350 585 13.2171 16.5214 24.7821 2.9855 Constraint 341 613 11.0596 13.8245 20.7368 2.9840 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 322 713 11.3366 14.1708 21.2561 2.9827 Constraint 314 713 12.6796 15.8496 23.7743 2.9827 Constraint 303 720 13.2566 16.5707 24.8561 2.9827 Constraint 303 713 12.0239 15.0298 22.5447 2.9827 Constraint 285 706 13.0641 16.3302 24.4953 2.9827 Constraint 330 687 10.2735 12.8419 19.2629 2.9769 Constraint 322 687 12.3680 15.4600 23.1900 2.9769 Constraint 297 706 8.3589 10.4487 15.6730 2.9769 Constraint 297 687 11.5783 14.4729 21.7094 2.9769 Constraint 279 706 10.7316 13.4146 20.1218 2.9769 Constraint 272 706 10.4848 13.1060 19.6590 2.9769 Constraint 272 687 13.9658 17.4573 26.1859 2.9769 Constraint 210 706 13.5422 16.9278 25.3917 2.9769 Constraint 190 706 11.9135 14.8919 22.3378 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 176 706 10.9944 13.7431 20.6146 2.9769 Constraint 497 668 10.1778 12.7222 19.0834 2.9759 Constraint 527 657 9.2490 11.5613 17.3419 2.9758 Constraint 527 651 10.0309 12.5387 18.8080 2.9758 Constraint 527 644 11.3009 14.1261 21.1892 2.9758 Constraint 519 657 10.9086 13.6358 20.4536 2.9758 Constraint 519 651 12.1509 15.1886 22.7830 2.9758 Constraint 303 676 12.4503 15.5629 23.3444 2.9692 Constraint 226 341 14.2941 17.8676 26.8015 2.9634 Constraint 201 341 14.1970 17.7463 26.6194 2.9634 Constraint 272 585 12.6818 15.8522 23.7783 2.9570 Constraint 80 279 14.2905 17.8632 26.7947 2.9367 Constraint 226 467 12.7699 15.9624 23.9436 2.9118 Constraint 190 368 13.7761 17.2202 25.8303 2.9118 Constraint 169 557 12.4250 15.5313 23.2970 2.9028 Constraint 161 557 12.5584 15.6980 23.5471 2.9028 Constraint 153 604 9.3096 11.6370 17.4555 2.8811 Constraint 122 636 10.1716 12.7145 19.0718 2.8587 Constraint 122 629 8.2557 10.3197 15.4795 2.8587 Constraint 636 742 13.5613 16.9516 25.4274 2.8576 Constraint 636 735 14.3819 17.9774 26.9661 2.8576 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 69 201 14.0545 17.5682 26.3523 2.8367 Constraint 58 557 14.1313 17.6641 26.4962 2.8367 Constraint 58 552 12.3955 15.4944 23.2416 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 285 552 11.3594 14.1993 21.2989 2.8105 Constraint 88 557 10.0176 12.5220 18.7830 2.8077 Constraint 113 571 12.2045 15.2557 22.8835 2.8058 Constraint 104 571 10.0498 12.5622 18.8433 2.8058 Constraint 314 552 9.2462 11.5578 17.3367 2.7942 Constraint 292 557 11.6106 14.5133 21.7699 2.7923 Constraint 461 657 12.5785 15.7231 23.5846 2.7872 Constraint 461 651 11.5621 14.4527 21.6790 2.7872 Constraint 461 644 11.1264 13.9080 20.8620 2.7872 Constraint 136 657 9.6010 12.0013 18.0020 2.7852 Constraint 113 657 8.6297 10.7871 16.1806 2.7852 Constraint 104 657 8.1524 10.1905 15.2858 2.7852 Constraint 511 585 12.4887 15.6109 23.4164 2.7794 Constraint 226 585 12.4520 15.5650 23.3475 2.7788 Constraint 221 585 11.4626 14.3282 21.4924 2.7788 Constraint 590 698 12.7987 15.9983 23.9975 2.7363 Constraint 272 375 12.3650 15.4562 23.1844 2.7352 Constraint 622 720 12.2213 15.2766 22.9148 2.6629 Constraint 604 720 12.9714 16.2143 24.3214 2.6629 Constraint 604 713 10.7473 13.4341 20.1511 2.6629 Constraint 599 713 8.7654 10.9568 16.4352 2.6629 Constraint 435 544 9.2267 11.5334 17.3000 2.6315 Constraint 169 577 7.4066 9.2583 13.8874 2.5968 Constraint 161 651 12.6817 15.8521 23.7781 2.5968 Constraint 136 622 10.2673 12.8342 19.2513 2.5968 Constraint 128 651 9.8717 12.3396 18.5094 2.5968 Constraint 80 577 13.0842 16.3552 24.5328 2.5963 Constraint 497 657 8.0800 10.1001 15.1501 2.5710 Constraint 497 651 10.3117 12.8897 19.3345 2.5710 Constraint 497 644 9.9589 12.4487 18.6730 2.5710 Constraint 497 636 9.6923 12.1154 18.1730 2.5698 Constraint 341 698 12.2058 15.2572 22.8858 2.5634 Constraint 341 636 13.4569 16.8211 25.2317 2.5531 Constraint 250 511 12.1895 15.2368 22.8552 2.5479 Constraint 237 519 10.2084 12.7605 19.1408 2.5479 Constraint 237 511 10.0855 12.6069 18.9103 2.5479 Constraint 226 511 12.5971 15.7464 23.6196 2.5479 Constraint 221 511 11.8550 14.8188 22.2281 2.5479 Constraint 201 519 12.3622 15.4528 23.1792 2.5479 Constraint 169 519 11.4646 14.3308 21.4961 2.5479 Constraint 442 644 13.0400 16.3000 24.4499 2.4539 Constraint 161 636 9.9328 12.4160 18.6240 2.4539 Constraint 136 636 7.8595 9.8244 14.7366 2.4539 Constraint 136 629 7.2136 9.0169 13.5254 2.4539 Constraint 489 698 10.4019 13.0024 19.5036 2.4029 Constraint 489 668 10.0708 12.5886 18.8828 2.4029 Constraint 489 644 11.6504 14.5630 21.8445 2.4029 Constraint 292 698 12.0891 15.1114 22.6671 2.3952 Constraint 285 698 12.4884 15.6105 23.4158 2.3952 Constraint 267 698 13.1375 16.4219 24.6329 2.3952 Constraint 259 668 13.8421 17.3026 25.9540 2.3894 Constraint 221 676 12.6438 15.8047 23.7071 2.3894 Constraint 259 657 13.2749 16.5936 24.8904 2.3875 Constraint 242 668 13.0411 16.3014 24.4521 2.3875 Constraint 226 657 12.8221 16.0276 24.0414 2.3817 Constraint 221 657 11.0941 13.8676 20.8014 2.3817 Constraint 449 651 10.1478 12.6847 19.0271 2.3601 Constraint 599 706 6.5315 8.1644 12.2466 2.3315 Constraint 590 706 10.2211 12.7763 19.1645 2.3315 Constraint 585 706 12.0782 15.0977 22.6465 2.3315 Constraint 585 687 11.4713 14.3391 21.5087 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 571 706 8.9503 11.1879 16.7818 2.3315 Constraint 535 706 13.1382 16.4227 24.6341 2.3315 Constraint 144 668 12.3647 15.4559 23.1838 2.2630 Constraint 144 657 11.0792 13.8490 20.7735 2.2630 Constraint 144 644 11.4335 14.2918 21.4378 2.2630 Constraint 144 636 9.3843 11.7304 17.5955 2.2630 Constraint 144 629 9.0009 11.2511 16.8766 2.2630 Constraint 161 668 13.3221 16.6526 24.9789 2.1920 Constraint 161 657 11.9614 14.9518 22.4277 2.1920 Constraint 136 668 10.3614 12.9517 19.4276 2.1920 Constraint 136 651 9.5354 11.9192 17.8788 2.1920 Constraint 136 644 9.3581 11.6976 17.5464 2.1920 Constraint 128 676 11.9492 14.9365 22.4048 2.1920 Constraint 128 668 10.7631 13.4539 20.1808 2.1920 Constraint 128 657 8.9382 11.1728 16.7592 2.1920 Constraint 128 644 9.0555 11.3194 16.9791 2.1920 Constraint 128 636 7.8317 9.7897 14.6845 2.1920 Constraint 128 629 5.9891 7.4863 11.2295 2.1920 Constraint 122 651 10.2654 12.8318 19.2477 2.1920 Constraint 122 644 10.8924 13.6155 20.4233 2.1920 Constraint 113 651 9.6136 12.0169 18.0254 2.1920 Constraint 104 676 11.4357 14.2946 21.4419 2.1920 Constraint 104 644 9.4783 11.8479 17.7718 2.1920 Constraint 96 657 10.3054 12.8818 19.3226 2.1920 Constraint 96 651 9.4922 11.8653 17.7979 2.1920 Constraint 96 644 10.9546 13.6932 20.5398 2.1920 Constraint 88 651 11.0264 13.7831 20.6746 2.1920 Constraint 88 644 12.8799 16.0998 24.1498 2.1920 Constraint 80 636 11.9829 14.9787 22.4680 2.1914 Constraint 80 629 9.7710 12.2138 18.3207 2.1914 Constraint 80 622 11.2755 14.0944 21.1416 2.1914 Constraint 80 613 12.1994 15.2493 22.8739 2.1914 Constraint 136 404 11.3887 14.2359 21.3538 2.1895 Constraint 421 687 13.8678 17.3348 26.0021 2.1687 Constraint 360 668 12.0318 15.0397 22.5596 2.1459 Constraint 355 657 9.8707 12.3384 18.5076 2.1459 Constraint 242 544 10.3918 12.9898 19.4847 2.1431 Constraint 237 544 11.3781 14.2227 21.3340 2.1431 Constraint 210 544 11.6162 14.5202 21.7803 2.1431 Constraint 201 544 13.2133 16.5166 24.7749 2.1431 Constraint 350 657 11.6358 14.5448 21.8171 2.1305 Constraint 285 467 11.5887 14.4858 21.7288 2.0932 Constraint 279 473 12.0329 15.0411 22.5616 2.0932 Constraint 279 467 10.8279 13.5349 20.3024 2.0932 Constraint 279 461 13.7077 17.1346 25.7019 2.0932 Constraint 272 473 9.3970 11.7463 17.6194 2.0932 Constraint 272 467 9.3005 11.6257 17.4385 2.0932 Constraint 267 473 12.9154 16.1442 24.2164 2.0932 Constraint 267 467 12.8439 16.0548 24.0823 2.0932 Constraint 226 473 12.6510 15.8138 23.7207 2.0932 Constraint 201 480 12.4214 15.5267 23.2901 2.0932 Constraint 190 480 12.6240 15.7800 23.6699 2.0932 Constraint 190 473 10.7726 13.4658 20.1987 2.0932 Constraint 190 467 12.4015 15.5019 23.2529 2.0932 Constraint 176 535 12.3723 15.4653 23.1980 2.0932 Constraint 176 480 10.9418 13.6773 20.5159 2.0932 Constraint 169 480 8.8303 11.0378 16.5568 2.0932 Constraint 161 480 7.1619 8.9524 13.4285 2.0932 Constraint 161 467 9.9677 12.4596 18.6894 2.0932 Constraint 169 368 13.8800 17.3500 26.0250 2.0002 Constraint 489 651 11.7178 14.6472 21.9708 1.9981 Constraint 480 706 12.2829 15.3536 23.0304 1.9981 Constraint 480 698 9.8229 12.2786 18.4179 1.9981 Constraint 480 687 12.0985 15.1231 22.6847 1.9981 Constraint 480 676 12.1720 15.2150 22.8225 1.9981 Constraint 473 706 11.2505 14.0631 21.0947 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 687 10.3057 12.8821 19.3231 1.9981 Constraint 473 676 10.3858 12.9822 19.4733 1.9981 Constraint 557 651 9.6751 12.0939 18.1408 1.9980 Constraint 544 657 11.3592 14.1990 21.2985 1.9980 Constraint 544 651 11.5427 14.4283 21.6425 1.9980 Constraint 544 644 13.3011 16.6264 24.9395 1.9980 Constraint 535 651 10.7091 13.3864 20.0796 1.9980 Constraint 622 729 11.3391 14.1739 21.2609 1.9962 Constraint 613 729 13.4003 16.7504 25.1256 1.9962 Constraint 613 720 13.4091 16.7613 25.1420 1.9962 Constraint 613 713 10.6418 13.3023 19.9534 1.9962 Constraint 604 729 12.8099 16.0123 24.0185 1.9962 Constraint 585 676 13.8476 17.3095 25.9642 1.9962 Constraint 571 676 14.2406 17.8007 26.7011 1.9962 Constraint 557 713 11.0265 13.7831 20.6747 1.9962 Constraint 557 698 12.2378 15.2973 22.9460 1.9962 Constraint 557 687 11.4506 14.3133 21.4699 1.9962 Constraint 341 622 11.9782 14.9728 22.4591 1.9962 Constraint 314 698 11.8576 14.8220 22.2331 1.9904 Constraint 303 698 11.8475 14.8093 22.2140 1.9904 Constraint 355 636 12.5132 15.6416 23.4623 1.9878 Constraint 350 629 11.9662 14.9577 22.4366 1.9878 Constraint 421 676 13.4269 16.7836 25.1754 1.9846 Constraint 355 720 13.9462 17.4327 26.1491 1.9846 Constraint 350 720 12.5830 15.7287 23.5931 1.9846 Constraint 350 713 13.7189 17.1486 25.7229 1.9846 Constraint 350 676 14.2953 17.8691 26.8036 1.9846 Constraint 341 720 10.9728 13.7160 20.5740 1.9846 Constraint 330 735 14.3219 17.9024 26.8536 1.9846 Constraint 330 729 13.7593 17.1991 25.7986 1.9846 Constraint 330 720 9.5377 11.9221 17.8831 1.9846 Constraint 322 720 13.0323 16.2904 24.4355 1.9846 Constraint 297 720 10.5132 13.1415 19.7122 1.9846 Constraint 297 713 9.0889 11.3611 17.0417 1.9846 Constraint 292 713 12.8152 16.0190 24.0285 1.9846 Constraint 285 676 13.6662 17.0828 25.6241 1.9846 Constraint 279 720 12.1029 15.1287 22.6930 1.9846 Constraint 279 713 12.1520 15.1899 22.7849 1.9846 Constraint 279 676 11.6259 14.5324 21.7986 1.9846 Constraint 272 720 13.5825 16.9782 25.4672 1.9846 Constraint 272 713 12.4496 15.5619 23.3429 1.9846 Constraint 267 706 13.2206 16.5258 24.7886 1.9846 Constraint 267 676 14.2774 17.8468 26.7701 1.9846 Constraint 250 636 14.3066 17.8833 26.8249 1.9846 Constraint 221 706 12.8252 16.0316 24.0473 1.9846 Constraint 201 706 13.6475 17.0593 25.5890 1.9846 Constraint 190 713 14.0991 17.6239 26.4358 1.9846 Constraint 182 720 13.0729 16.3411 24.5117 1.9846 Constraint 182 713 10.7340 13.4174 20.1262 1.9846 Constraint 176 713 12.8130 16.0163 24.0244 1.9846 Constraint 169 706 13.2235 16.5294 24.7941 1.9846 Constraint 552 657 10.4087 13.0109 19.5164 1.9827 Constraint 552 644 12.4627 15.5783 23.3675 1.9827 Constraint 303 557 10.7445 13.4307 20.1460 1.9827 Constraint 297 557 12.3798 15.4748 23.2122 1.9827 Constraint 285 557 11.9176 14.8970 22.3455 1.9827 Constraint 303 636 12.3672 15.4590 23.1885 1.9801 Constraint 279 636 12.5267 15.6583 23.4875 1.9801 Constraint 527 636 11.8476 14.8095 22.2142 1.9777 Constraint 303 657 11.7038 14.6297 21.9446 1.9769 Constraint 285 657 12.7154 15.8943 23.8414 1.9769 Constraint 279 657 11.4814 14.3518 21.5277 1.9769 Constraint 267 657 13.2406 16.5507 24.8260 1.9769 Constraint 527 676 11.2431 14.0539 21.0809 1.9759 Constraint 527 668 9.2554 11.5693 17.3539 1.9759 Constraint 519 668 11.0903 13.8628 20.7942 1.9759 Constraint 519 644 11.9898 14.9872 22.4808 1.9759 Constraint 511 668 10.9288 13.6611 20.4916 1.9759 Constraint 511 657 9.9054 12.3817 18.5726 1.9759 Constraint 511 613 9.6097 12.0121 18.0181 1.9759 Constraint 303 651 12.7939 15.9924 23.9886 1.9724 Constraint 279 585 12.8895 16.1118 24.1677 1.9692 Constraint 272 571 10.9814 13.7267 20.5900 1.9692 Constraint 267 585 12.4279 15.5349 23.3023 1.9692 Constraint 267 571 9.7471 12.1839 18.2759 1.9692 Constraint 250 585 10.4917 13.1147 19.6720 1.9692 Constraint 250 577 7.4155 9.2694 13.9041 1.9692 Constraint 250 571 5.3243 6.6553 9.9830 1.9692 Constraint 226 571 9.2552 11.5690 17.3535 1.9692 Constraint 221 571 8.3847 10.4809 15.7213 1.9692 Constraint 201 571 11.0086 13.7608 20.6411 1.9692 Constraint 190 571 12.3536 15.4420 23.1630 1.9692 Constraint 182 571 11.4098 14.2622 21.3934 1.9692 Constraint 176 571 13.5089 16.8862 25.3293 1.9692 Constraint 136 267 13.8653 17.3316 25.9974 1.9412 Constraint 190 461 13.9369 17.4211 26.1316 1.8981 Constraint 153 644 11.1258 13.9072 20.8608 1.8812 Constraint 153 622 10.9588 13.6985 20.5478 1.8812 Constraint 153 613 10.5444 13.1805 19.7707 1.8812 Constraint 96 571 11.2767 14.0959 21.1438 1.8096 Constraint 292 552 8.9778 11.2222 16.8333 1.7942 Constraint 267 552 12.3316 15.4145 23.1218 1.7942 Constraint 259 557 10.9337 13.6671 20.5006 1.7942 Constraint 259 552 9.0173 11.2716 16.9074 1.7942 Constraint 250 557 11.5779 14.4724 21.7086 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 242 557 8.7726 10.9657 16.4486 1.7942 Constraint 237 651 11.4341 14.2926 21.4390 1.7942 Constraint 237 557 10.8597 13.5747 20.3620 1.7942 Constraint 237 552 9.7078 12.1348 18.2022 1.7942 Constraint 226 651 13.2206 16.5258 24.7886 1.7942 Constraint 226 557 13.5689 16.9611 25.4416 1.7942 Constraint 226 552 12.0298 15.0373 22.5559 1.7942 Constraint 221 557 11.8019 14.7524 22.1286 1.7942 Constraint 221 552 9.9863 12.4829 18.7243 1.7942 Constraint 210 557 9.6891 12.1114 18.1671 1.7942 Constraint 210 552 8.3974 10.4968 15.7451 1.7942 Constraint 201 557 13.4240 16.7800 25.1700 1.7942 Constraint 201 552 12.2026 15.2533 22.8799 1.7942 Constraint 182 557 12.9128 16.1410 24.2115 1.7942 Constraint 461 676 13.5810 16.9762 25.4643 1.7872 Constraint 449 676 12.2674 15.3343 23.0014 1.7872 Constraint 449 668 14.3342 17.9178 26.8766 1.7872 Constraint 449 644 9.9363 12.4204 18.6306 1.7872 Constraint 104 651 6.5019 8.1274 12.1911 1.7872 Constraint 599 729 10.2283 12.7854 19.1781 1.6648 Constraint 599 720 9.1563 11.4453 17.1680 1.6648 Constraint 590 720 12.4041 15.5051 23.2577 1.6648 Constraint 590 713 9.0496 11.3120 16.9680 1.6648 Constraint 577 729 12.8341 16.0426 24.0639 1.6648 Constraint 577 720 11.4410 14.3012 21.4518 1.6648 Constraint 577 713 8.9813 11.2266 16.8399 1.6648 Constraint 571 729 10.5821 13.2276 19.8414 1.6648 Constraint 571 720 10.6241 13.2801 19.9202 1.6648 Constraint 571 713 7.6358 9.5447 14.3171 1.6648 Constraint 544 713 13.2374 16.5468 24.8201 1.6648 Constraint 535 729 13.5030 16.8787 25.3181 1.6648 Constraint 144 651 11.2104 14.0130 21.0195 1.5963 Constraint 136 676 10.9746 13.7182 20.5773 1.5963 Constraint 113 676 12.0039 15.0049 22.5073 1.5963 Constraint 113 687 12.7264 15.9080 23.8621 1.5938 Constraint 104 687 11.5848 14.4810 21.7215 1.5938 Constraint 88 687 12.5816 15.7270 23.5905 1.5938 Constraint 412 668 13.4197 16.7746 25.1620 1.5730 Constraint 399 668 11.0051 13.7564 20.6345 1.5730 Constraint 391 687 12.1075 15.1344 22.7015 1.5730 Constraint 391 668 11.9947 14.9934 22.4901 1.5730 Constraint 368 687 11.2921 14.1152 21.1727 1.5730 Constraint 368 668 10.6373 13.2966 19.9449 1.5730 Constraint 360 698 13.7527 17.1909 25.7864 1.5730 Constraint 360 687 12.0772 15.0966 22.6448 1.5730 Constraint 355 687 12.7945 15.9931 23.9897 1.5730 Constraint 629 735 8.8340 11.0425 16.5637 1.5710 Constraint 527 687 8.7485 10.9357 16.4035 1.5710 Constraint 511 651 11.8954 14.8692 22.3039 1.5710 Constraint 511 644 11.0996 13.8746 20.8118 1.5710 Constraint 350 668 12.4299 15.5373 23.3060 1.5653 Constraint 153 651 12.1423 15.1779 22.7668 1.4763 Constraint 80 571 12.8119 16.0149 24.0224 1.4048 Constraint 80 557 12.1466 15.1832 22.7749 1.4048 Constraint 535 668 9.0224 11.2780 16.9169 1.4029 Constraint 535 657 7.2637 9.0797 13.6195 1.4029 Constraint 535 644 9.3864 11.7330 17.5995 1.4029 Constraint 527 698 8.2675 10.3344 15.5016 1.4029 Constraint 519 698 9.4958 11.8698 17.8047 1.4029 Constraint 519 687 11.3195 14.1493 21.2240 1.4029 Constraint 519 676 13.2702 16.5878 24.8817 1.4029 Constraint 259 698 11.0879 13.8598 20.7897 1.4029 Constraint 250 698 12.3882 15.4852 23.2279 1.4029 Constraint 242 698 11.5124 14.3905 21.5857 1.4029 Constraint 88 668 11.8055 14.7569 22.1354 1.4029 Constraint 221 698 11.7979 14.7474 22.1211 1.3971 Constraint 210 698 11.5166 14.3957 21.5936 1.3971 Constraint 201 698 11.0506 13.8132 20.7198 1.3971 Constraint 190 687 13.1060 16.3825 24.5737 1.3971 Constraint 259 644 11.4020 14.2524 21.3787 1.3894 Constraint 242 651 13.2507 16.5634 24.8450 1.3894 Constraint 242 644 9.4810 11.8513 17.7769 1.3894 Constraint 237 668 11.1739 13.9674 20.9511 1.3894 Constraint 237 657 10.3496 12.9370 19.4055 1.3894 Constraint 221 651 12.7821 15.9776 23.9665 1.3894 Constraint 552 706 13.7154 17.1443 25.7164 1.3335 Constraint 544 706 11.9397 14.9246 22.3869 1.3335 Constraint 201 511 10.1508 12.6885 19.0328 1.3335 Constraint 190 511 13.6668 17.0836 25.6253 1.3335 Constraint 182 511 12.4573 15.5716 23.3574 1.3335 Constraint 176 511 12.4200 15.5250 23.2875 1.3335 Constraint 169 511 8.0333 10.0416 15.0624 1.3335 Constraint 161 706 12.9910 16.2388 24.3582 1.3335 Constraint 161 519 11.4665 14.3332 21.4998 1.3335 Constraint 161 511 9.9317 12.4146 18.6219 1.3335 Constraint 153 706 13.9148 17.3935 26.0902 1.3335 Constraint 144 706 14.3802 17.9752 26.9628 1.3335 Constraint 136 511 10.4618 13.0772 19.6158 1.3335 Constraint 113 382 11.1513 13.9391 20.9086 1.2981 Constraint 285 489 7.0351 8.7938 13.1908 1.2144 Constraint 279 489 10.8972 13.6215 20.4322 1.2144 Constraint 272 519 13.0663 16.3329 24.4994 1.2144 Constraint 267 519 12.3521 15.4401 23.1601 1.2144 Constraint 267 489 9.3743 11.7178 17.5767 1.2144 Constraint 267 480 11.7432 14.6791 22.0186 1.2144 Constraint 259 480 8.0609 10.0761 15.1141 1.2144 Constraint 250 519 7.1876 8.9845 13.4767 1.2144 Constraint 250 489 6.4126 8.0157 12.0236 1.2144 Constraint 250 480 7.1196 8.8995 13.3492 1.2144 Constraint 237 480 11.8127 14.7659 22.1488 1.2144 Constraint 226 519 9.6801 12.1001 18.1502 1.2144 Constraint 226 489 9.3572 11.6965 17.5447 1.2144 Constraint 226 480 11.7837 14.7296 22.0944 1.2144 Constraint 221 519 8.2803 10.3504 15.5256 1.2144 Constraint 201 489 11.4107 14.2634 21.3951 1.2144 Constraint 190 527 11.7078 14.6347 21.9520 1.2144 Constraint 190 519 12.2729 15.3412 23.0117 1.2144 Constraint 190 489 10.9236 13.6545 20.4817 1.2144 Constraint 182 519 11.4567 14.3208 21.4813 1.2144 Constraint 176 527 12.6839 15.8549 23.7823 1.2144 Constraint 176 519 14.2989 17.8737 26.8105 1.2144 Constraint 176 489 13.6267 17.0334 25.5501 1.2144 Constraint 80 676 11.5458 14.4323 21.6484 1.1914 Constraint 80 668 12.2359 15.2948 22.9423 1.1914 Constraint 80 657 8.6727 10.8409 16.2613 1.1914 Constraint 80 651 7.3178 9.1473 13.7209 1.1914 Constraint 80 644 11.2896 14.1120 21.1680 1.1914 Constraint 442 687 14.1465 17.6832 26.5247 1.1687 Constraint 355 668 9.6082 12.0102 18.0153 1.1459 Constraint 350 644 12.7607 15.9509 23.9263 1.1459 Constraint 237 729 12.8077 16.0096 24.0145 1.0715 Constraint 201 735 12.3761 15.4701 23.2051 1.0715 Constraint 201 729 11.2525 14.0656 21.0984 1.0715 Constraint 176 742 11.9922 14.9902 22.4853 1.0715 Constraint 176 735 12.4912 15.6140 23.4210 1.0715 Constraint 176 729 12.3370 15.4212 23.1319 1.0715 Constraint 169 729 11.8301 14.7876 22.1815 1.0715 Constraint 169 720 12.9801 16.2251 24.3377 1.0715 Constraint 161 742 11.0485 13.8107 20.7160 1.0715 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 161 720 10.3047 12.8809 19.3214 1.0715 Constraint 153 729 11.8672 14.8340 22.2509 1.0715 Constraint 153 720 12.0457 15.0571 22.5857 1.0715 Constraint 153 657 12.1059 15.1323 22.6985 1.0715 Constraint 153 636 10.4342 13.0427 19.5641 1.0715 Constraint 153 629 10.0957 12.6196 18.9294 1.0715 Constraint 355 544 11.2518 14.0647 21.0971 1.0163 Constraint 350 544 9.6767 12.0958 18.1437 1.0163 Constraint 69 577 13.9825 17.4781 26.2171 1.0163 Constraint 58 382 12.4270 15.5338 23.3007 1.0163 Constraint 58 259 11.9272 14.9090 22.3636 1.0163 Constraint 58 250 13.9829 17.4786 26.2179 1.0163 Constraint 51 404 14.3975 17.9969 26.9954 1.0163 Constraint 51 382 13.7682 17.2103 25.8154 1.0163 Constraint 51 375 10.0852 12.6065 18.9097 1.0163 Constraint 51 368 13.4918 16.8647 25.2971 1.0163 Constraint 51 303 11.0510 13.8137 20.7206 1.0163 Constraint 51 297 13.8344 17.2929 25.9394 1.0163 Constraint 51 285 9.7781 12.2226 18.3339 1.0163 Constraint 51 279 13.9507 17.4384 26.1576 1.0163 Constraint 51 267 12.8363 16.0454 24.0681 1.0163 Constraint 51 259 9.1874 11.4842 17.2263 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 242 8.0307 10.0384 15.0575 1.0163 Constraint 51 237 11.5867 14.4834 21.7251 1.0163 Constraint 51 226 14.0355 17.5444 26.3166 1.0163 Constraint 51 221 12.1783 15.2229 22.8343 1.0163 Constraint 51 210 11.2287 14.0358 21.0537 1.0163 Constraint 51 182 14.2975 17.8719 26.8078 1.0163 Constraint 51 169 14.2008 17.7511 26.6266 1.0163 Constraint 41 375 13.3894 16.7368 25.1052 1.0163 Constraint 41 285 12.9875 16.2344 24.3516 1.0163 Constraint 41 259 11.8259 14.7823 22.1735 1.0163 Constraint 41 250 11.3244 14.1556 21.2333 1.0163 Constraint 41 242 10.4645 13.0807 19.6210 1.0163 Constraint 41 237 13.6592 17.0740 25.6110 1.0163 Constraint 128 687 13.1704 16.4630 24.6945 1.0005 Constraint 122 676 11.8824 14.8530 22.2794 1.0005 Constraint 96 687 14.0483 17.5604 26.3406 1.0005 Constraint 96 676 11.1770 13.9712 20.9568 1.0005 Constraint 96 668 9.9528 12.4410 18.6615 1.0005 Constraint 467 698 11.4986 14.3733 21.5599 1.0000 Constraint 467 687 13.2135 16.5168 24.7752 1.0000 Constraint 467 676 13.0097 16.2622 24.3933 1.0000 Constraint 467 668 9.2723 11.5904 17.3856 1.0000 Constraint 461 668 12.7285 15.9106 23.8659 1.0000 Constraint 435 698 12.6245 15.7806 23.6709 1.0000 Constraint 435 687 13.4996 16.8745 25.3117 1.0000 Constraint 435 668 12.8660 16.0825 24.1238 1.0000 Constraint 429 698 11.7026 14.6283 21.9424 1.0000 Constraint 429 687 12.2809 15.3511 23.0266 1.0000 Constraint 429 676 13.3391 16.6739 25.0108 1.0000 Constraint 429 668 10.5215 13.1518 19.7277 1.0000 Constraint 412 698 13.2225 16.5282 24.7923 1.0000 Constraint 412 687 12.5515 15.6893 23.5340 1.0000 Constraint 412 644 14.2178 17.7723 26.6584 1.0000 Constraint 404 706 12.6616 15.8270 23.7404 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 687 8.6870 10.8587 16.2881 1.0000 Constraint 404 676 10.9343 13.6678 20.5017 1.0000 Constraint 399 706 14.0172 17.5215 26.2822 1.0000 Constraint 399 698 11.3454 14.1818 21.2726 1.0000 Constraint 399 687 10.0466 12.5582 18.8373 1.0000 Constraint 399 676 11.0780 13.8474 20.7712 1.0000 Constraint 391 698 13.8469 17.3087 25.9630 1.0000 Constraint 391 676 13.9218 17.4023 26.1034 1.0000 Constraint 382 706 13.8797 17.3496 26.0244 1.0000 Constraint 382 698 10.8883 13.6103 20.4155 1.0000 Constraint 382 687 8.7387 10.9234 16.3851 1.0000 Constraint 382 676 11.7533 14.6916 22.0374 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 687 5.9127 7.3909 11.0863 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 368 698 12.6523 15.8153 23.7230 1.0000 Constraint 368 676 11.3301 14.1626 21.2439 1.0000 Constraint 360 676 12.8172 16.0216 24.0323 1.0000 Constraint 355 676 14.3783 17.9728 26.9593 1.0000 Constraint 629 742 7.6822 9.6027 14.4041 0.9981 Constraint 622 742 11.4098 14.2622 21.3933 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 604 742 8.0595 10.0744 15.1116 0.9981 Constraint 604 735 8.8596 11.0744 16.6117 0.9981 Constraint 599 742 11.4013 14.2516 21.3774 0.9981 Constraint 599 735 10.9187 13.6484 20.4725 0.9981 Constraint 590 742 13.6744 17.0930 25.6395 0.9981 Constraint 590 735 13.3750 16.7187 25.0781 0.9981 Constraint 590 729 10.3165 12.8956 19.3434 0.9981 Constraint 585 742 12.4589 15.5736 23.3604 0.9981 Constraint 585 735 13.6112 17.0140 25.5210 0.9981 Constraint 585 729 13.9763 17.4704 26.2057 0.9981 Constraint 585 720 13.7889 17.2361 25.8541 0.9981 Constraint 585 713 9.0195 11.2744 16.9116 0.9981 Constraint 585 698 11.7576 14.6970 22.0455 0.9981 Constraint 577 676 11.9189 14.8986 22.3479 0.9981 Constraint 571 735 13.5507 16.9384 25.4076 0.9981 Constraint 571 668 12.2194 15.2742 22.9114 0.9981 Constraint 557 735 12.2675 15.3343 23.0015 0.9981 Constraint 557 729 13.6105 17.0131 25.5197 0.9981 Constraint 557 720 14.2375 17.7969 26.6954 0.9981 Constraint 557 676 11.4879 14.3598 21.5397 0.9981 Constraint 557 668 10.3037 12.8796 19.3194 0.9981 Constraint 552 735 13.8193 17.2741 25.9111 0.9981 Constraint 552 713 13.4750 16.8438 25.2657 0.9981 Constraint 552 698 10.9559 13.6949 20.5423 0.9981 Constraint 552 687 10.8262 13.5327 20.2990 0.9981 Constraint 552 676 13.7563 17.1954 25.7931 0.9981 Constraint 552 668 12.1345 15.1682 22.7522 0.9981 Constraint 544 735 12.5709 15.7136 23.5704 0.9981 Constraint 544 698 11.5817 14.4771 21.7156 0.9981 Constraint 544 687 12.4372 15.5465 23.3198 0.9981 Constraint 544 668 11.6643 14.5804 21.8706 0.9981 Constraint 535 742 11.6473 14.5592 21.8388 0.9981 Constraint 535 735 8.9201 11.1501 16.7251 0.9981 Constraint 535 720 13.9781 17.4726 26.2089 0.9981 Constraint 535 713 9.7139 12.1424 18.2135 0.9981 Constraint 535 698 8.6861 10.8576 16.2864 0.9981 Constraint 535 687 9.2070 11.5087 17.2631 0.9981 Constraint 535 676 10.4339 13.0423 19.5635 0.9981 Constraint 527 742 13.5141 16.8926 25.3389 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 729 13.5009 16.8761 25.3142 0.9981 Constraint 527 720 13.3832 16.7289 25.0934 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 527 706 10.1745 12.7181 19.0772 0.9981 Constraint 519 735 11.1465 13.9331 20.8997 0.9981 Constraint 519 729 14.3587 17.9484 26.9226 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 519 706 12.2041 15.2551 22.8827 0.9981 Constraint 511 742 11.6193 14.5241 21.7861 0.9981 Constraint 511 735 8.6213 10.7766 16.1649 0.9981 Constraint 511 729 11.9658 14.9573 22.4360 0.9981 Constraint 511 720 13.7507 17.1884 25.7825 0.9981 Constraint 511 713 9.0139 11.2673 16.9010 0.9981 Constraint 511 706 12.4253 15.5316 23.2974 0.9981 Constraint 511 698 8.7420 10.9275 16.3912 0.9981 Constraint 511 687 11.0652 13.8315 20.7473 0.9981 Constraint 511 676 12.2781 15.3476 23.0214 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 497 706 8.3556 10.4446 15.6668 0.9981 Constraint 497 698 4.7218 5.9023 8.8534 0.9981 Constraint 497 687 7.2198 9.0248 13.5372 0.9981 Constraint 497 676 8.1861 10.2326 15.3489 0.9981 Constraint 489 742 12.8183 16.0229 24.0343 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 720 11.4156 14.2695 21.4043 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 489 706 8.2414 10.3018 15.4527 0.9981 Constraint 489 687 8.4643 10.5803 15.8705 0.9981 Constraint 489 676 10.6549 13.3186 19.9779 0.9981 Constraint 480 742 12.9188 16.1485 24.2228 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 720 13.4710 16.8388 25.2581 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 314 720 13.7885 17.2356 25.8534 0.9981 Constraint 314 687 12.0074 15.0093 22.5140 0.9981 Constraint 303 687 14.1499 17.6873 26.5310 0.9981 Constraint 285 713 13.1019 16.3773 24.5660 0.9981 Constraint 285 687 14.1882 17.7353 26.6029 0.9981 Constraint 259 706 13.1192 16.3990 24.5985 0.9981 Constraint 144 382 13.9315 17.4144 26.1215 0.9981 Constraint 136 382 9.9465 12.4331 18.6497 0.9981 Constraint 113 698 13.9365 17.4206 26.1309 0.9981 Constraint 104 713 11.7284 14.6605 21.9907 0.9981 Constraint 104 706 13.1073 16.3842 24.5762 0.9981 Constraint 104 698 11.8313 14.7891 22.1837 0.9981 Constraint 88 713 12.7865 15.9832 23.9747 0.9981 Constraint 88 706 12.6872 15.8590 23.7885 0.9981 Constraint 88 698 10.4801 13.1001 19.6501 0.9981 Constraint 88 676 13.2697 16.5872 24.8807 0.9981 Constraint 442 668 14.3893 17.9867 26.9800 0.9923 Constraint 350 706 12.8779 16.0974 24.1461 0.9923 Constraint 279 687 14.2609 17.8262 26.7393 0.9923 Constraint 350 636 11.6266 14.5332 21.7999 0.9878 Constraint 330 622 11.2743 14.0928 21.1393 0.9878 Constraint 303 622 14.0167 17.5208 26.2812 0.9878 Constraint 285 651 13.9175 17.3969 26.0953 0.9878 Constraint 285 636 13.7950 17.2438 25.8657 0.9878 Constraint 279 651 10.4253 13.0316 19.5474 0.9878 Constraint 279 622 13.2206 16.5257 24.7886 0.9878 Constraint 267 651 13.5224 16.9030 25.3545 0.9878 Constraint 285 644 11.1386 13.9233 20.8849 0.9846 Constraint 279 557 13.8901 17.3627 26.0440 0.9846 Constraint 272 557 13.8066 17.2582 25.8873 0.9846 Constraint 267 644 12.3450 15.4313 23.1469 0.9846 Constraint 267 557 12.7585 15.9481 23.9222 0.9846 Constraint 259 651 14.3365 17.9206 26.8809 0.9846 Constraint 250 644 12.1492 15.1865 22.7797 0.9846 Constraint 519 636 9.9181 12.3977 18.5965 0.9778 Constraint 113 279 13.0300 16.2875 24.4312 0.8957 Constraint 113 267 12.2920 15.3649 23.0474 0.8957 Constraint 382 544 13.3153 16.6441 24.9662 0.8096 Constraint 314 544 12.4478 15.5597 23.3396 0.8096 Constraint 292 544 13.0130 16.2662 24.3993 0.8096 Constraint 259 544 12.5763 15.7204 23.5806 0.8096 Constraint 250 544 11.6904 14.6130 21.9195 0.8096 Constraint 226 544 13.4433 16.8042 25.2062 0.8096 Constraint 221 544 12.2386 15.2983 22.9475 0.8096 Constraint 190 552 11.9564 14.9455 22.4183 0.8096 Constraint 176 557 14.1181 17.6476 26.4715 0.8096 Constraint 176 552 12.4742 15.5927 23.3891 0.8096 Constraint 96 557 5.1863 6.4829 9.7244 0.8096 Constraint 544 729 12.9019 16.1274 24.1911 0.6667 Constraint 544 720 12.6604 15.8255 23.7383 0.6667 Constraint 435 644 12.3877 15.4846 23.2269 0.6667 Constraint 237 742 12.1392 15.1740 22.7609 0.6667 Constraint 237 735 14.2288 17.7860 26.6790 0.6667 Constraint 226 742 12.6866 15.8582 23.7873 0.6667 Constraint 201 742 10.2861 12.8577 19.2865 0.6667 Constraint 190 742 12.8160 16.0200 24.0300 0.6667 Constraint 169 742 11.2226 14.0283 21.0425 0.6667 Constraint 169 735 11.7239 14.6549 21.9823 0.6667 Constraint 161 735 8.4692 10.5866 15.8798 0.6667 Constraint 161 713 12.5922 15.7403 23.6104 0.6667 Constraint 153 742 12.1154 15.1443 22.7164 0.6667 Constraint 153 735 11.9781 14.9726 22.4588 0.6667 Constraint 153 713 14.0784 17.5981 26.3971 0.6667 Constraint 144 735 13.9828 17.4785 26.2178 0.6667 Constraint 144 729 13.7368 17.1710 25.7565 0.6667 Constraint 144 720 12.8521 16.0651 24.0977 0.6667 Constraint 136 735 13.6536 17.0670 25.6005 0.6667 Constraint 136 720 13.9665 17.4581 26.1872 0.6667 Constraint 449 687 12.4188 15.5235 23.2852 0.5957 Constraint 136 687 11.5428 14.4285 21.6427 0.5957 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 511 636 8.4084 10.5105 15.7658 0.5730 Constraint 391 742 12.6700 15.8375 23.7562 0.5730 Constraint 391 735 13.3728 16.7159 25.0739 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 735 13.3124 16.6405 24.9608 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 360 735 12.5408 15.6760 23.5140 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 355 698 11.0780 13.8475 20.7712 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 350 735 12.6027 15.7534 23.6301 0.5730 Constraint 350 698 13.0269 16.2837 24.4255 0.5730 Constraint 350 687 13.7045 17.1306 25.6959 0.5730 Constraint 341 742 12.2541 15.3177 22.9765 0.5730 Constraint 341 735 13.4893 16.8616 25.2924 0.5730 Constraint 535 636 12.6563 15.8204 23.7306 0.4048 Constraint 272 729 14.0280 17.5351 26.3026 0.4048 Constraint 250 687 14.1963 17.7454 26.6180 0.4048 Constraint 250 668 11.3309 14.1636 21.2454 0.4048 Constraint 250 657 12.2311 15.2888 22.9332 0.4048 Constraint 242 687 13.4638 16.8297 25.2446 0.4048 Constraint 242 676 13.3076 16.6345 24.9518 0.4048 Constraint 237 720 13.4446 16.8058 25.2087 0.4048 Constraint 237 698 4.3036 5.3795 8.0693 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 237 676 8.4658 10.5822 15.8733 0.4048 Constraint 226 729 12.1941 15.2426 22.8639 0.4048 Constraint 226 698 6.4367 8.0458 12.0687 0.4048 Constraint 226 687 10.6659 13.3324 19.9986 0.4048 Constraint 226 676 10.9952 13.7440 20.6159 0.4048 Constraint 221 687 12.9314 16.1643 24.2465 0.4048 Constraint 210 729 13.2184 16.5230 24.7844 0.4048 Constraint 210 687 10.0080 12.5100 18.7650 0.4048 Constraint 201 720 11.4116 14.2645 21.3968 0.4048 Constraint 201 687 8.3711 10.4639 15.6959 0.4048 Constraint 190 729 11.2529 14.0661 21.0991 0.4048 Constraint 182 729 13.8402 17.3002 25.9503 0.4048 Constraint 176 720 12.3195 15.3993 23.0990 0.4048 Constraint 161 698 11.5867 14.4834 21.7251 0.4048 Constraint 161 687 12.2665 15.3331 22.9997 0.4048 Constraint 161 676 8.0481 10.0601 15.0902 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 153 668 6.2813 7.8517 11.7775 0.4048 Constraint 144 698 13.7421 17.1776 25.7664 0.4048 Constraint 144 687 13.5342 16.9178 25.3767 0.4048 Constraint 144 676 9.6590 12.0738 18.1107 0.4048 Constraint 136 698 14.0537 17.5672 26.3508 0.4048 Constraint 128 729 14.1043 17.6304 26.4456 0.4048 Constraint 128 698 10.4838 13.1047 19.6570 0.4048 Constraint 122 698 11.9680 14.9599 22.4399 0.4048 Constraint 122 687 12.3092 15.3865 23.0797 0.4048 Constraint 96 698 12.6741 15.8426 23.7640 0.4048 Constraint 33 382 13.4922 16.8653 25.2979 0.3388 Constraint 33 375 11.0191 13.7738 20.6608 0.3388 Constraint 33 368 13.2850 16.6062 24.9093 0.3388 Constraint 33 303 12.1803 15.2254 22.8380 0.3388 Constraint 33 292 13.1632 16.4540 24.6810 0.3388 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 279 13.8904 17.3630 26.0445 0.3388 Constraint 33 267 12.1135 15.1419 22.7129 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 33 237 13.1593 16.4492 24.6737 0.3388 Constraint 33 221 13.0255 16.2819 24.4228 0.3388 Constraint 33 210 13.7334 17.1667 25.7501 0.3388 Constraint 161 399 13.4901 16.8626 25.2939 0.3000 Constraint 161 391 13.3985 16.7481 25.1222 0.3000 Constraint 80 267 12.3518 15.4397 23.1595 0.1000 Constraint 80 190 12.5895 15.7368 23.6053 0.1000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 735 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 742 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 742 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 720 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 742 0.8000 1.0000 1.5000 0.0000 Constraint 544 676 0.8000 1.0000 1.5000 0.0000 Constraint 544 636 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 742 0.8000 1.0000 1.5000 0.0000 Constraint 519 720 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 706 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 698 0.8000 1.0000 1.5000 0.0000 Constraint 461 687 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 676 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 676 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 706 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 742 0.8000 1.0000 1.5000 0.0000 Constraint 421 735 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 706 0.8000 1.0000 1.5000 0.0000 Constraint 421 698 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 676 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 742 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 742 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 742 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 706 0.8000 1.0000 1.5000 0.0000 Constraint 368 544 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 706 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 713 0.8000 1.0000 1.5000 0.0000 Constraint 355 706 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 613 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 729 0.8000 1.0000 1.5000 0.0000 Constraint 341 467 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 467 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 729 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 729 0.8000 1.0000 1.5000 0.0000 Constraint 297 511 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 720 0.8000 1.0000 1.5000 0.0000 Constraint 292 687 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 720 0.8000 1.0000 1.5000 0.0000 Constraint 285 544 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 729 0.8000 1.0000 1.5000 0.0000 Constraint 279 613 0.8000 1.0000 1.5000 0.0000 Constraint 279 535 0.8000 1.0000 1.5000 0.0000 Constraint 279 519 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 535 0.8000 1.0000 1.5000 0.0000 Constraint 272 511 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 720 0.8000 1.0000 1.5000 0.0000 Constraint 267 713 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 636 0.8000 1.0000 1.5000 0.0000 Constraint 267 613 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 511 0.8000 1.0000 1.5000 0.0000 Constraint 267 461 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 713 0.8000 1.0000 1.5000 0.0000 Constraint 259 687 0.8000 1.0000 1.5000 0.0000 Constraint 259 676 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 676 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 330 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 742 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 713 0.8000 1.0000 1.5000 0.0000 Constraint 242 706 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 735 0.8000 1.0000 1.5000 0.0000 Constraint 226 720 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 706 0.8000 1.0000 1.5000 0.0000 Constraint 226 535 0.8000 1.0000 1.5000 0.0000 Constraint 226 355 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 742 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 729 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 713 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 742 0.8000 1.0000 1.5000 0.0000 Constraint 210 735 0.8000 1.0000 1.5000 0.0000 Constraint 210 720 0.8000 1.0000 1.5000 0.0000 Constraint 210 713 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 355 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 735 0.8000 1.0000 1.5000 0.0000 Constraint 190 720 0.8000 1.0000 1.5000 0.0000 Constraint 190 557 0.8000 1.0000 1.5000 0.0000 Constraint 190 544 0.8000 1.0000 1.5000 0.0000 Constraint 190 535 0.8000 1.0000 1.5000 0.0000 Constraint 190 382 0.8000 1.0000 1.5000 0.0000 Constraint 190 375 0.8000 1.0000 1.5000 0.0000 Constraint 190 355 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 742 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 382 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 368 0.8000 1.0000 1.5000 0.0000 Constraint 176 355 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 713 0.8000 1.0000 1.5000 0.0000 Constraint 169 375 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 404 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 360 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 341 0.8000 1.0000 1.5000 0.0000 Constraint 161 330 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 285 0.8000 1.0000 1.5000 0.0000 Constraint 161 279 0.8000 1.0000 1.5000 0.0000 Constraint 161 267 0.8000 1.0000 1.5000 0.0000 Constraint 161 250 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 375 0.8000 1.0000 1.5000 0.0000 Constraint 153 368 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 742 0.8000 1.0000 1.5000 0.0000 Constraint 144 713 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 368 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 303 0.8000 1.0000 1.5000 0.0000 Constraint 144 285 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 267 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 742 0.8000 1.0000 1.5000 0.0000 Constraint 136 729 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 355 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 742 0.8000 1.0000 1.5000 0.0000 Constraint 128 735 0.8000 1.0000 1.5000 0.0000 Constraint 128 720 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 713 0.8000 1.0000 1.5000 0.0000 Constraint 113 706 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 544 0.8000 1.0000 1.5000 0.0000 Constraint 69 535 0.8000 1.0000 1.5000 0.0000 Constraint 69 226 0.8000 1.0000 1.5000 0.0000 Constraint 69 190 0.8000 1.0000 1.5000 0.0000 Constraint 69 176 0.8000 1.0000 1.5000 0.0000 Constraint 69 161 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 585 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 535 0.8000 1.0000 1.5000 0.0000 Constraint 58 442 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 412 0.8000 1.0000 1.5000 0.0000 Constraint 58 279 0.8000 1.0000 1.5000 0.0000 Constraint 58 272 0.8000 1.0000 1.5000 0.0000 Constraint 58 267 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 221 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 169 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 442 0.8000 1.0000 1.5000 0.0000 Constraint 51 435 0.8000 1.0000 1.5000 0.0000 Constraint 51 412 0.8000 1.0000 1.5000 0.0000 Constraint 51 391 0.8000 1.0000 1.5000 0.0000 Constraint 51 272 0.8000 1.0000 1.5000 0.0000 Constraint 51 201 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 449 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 421 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 368 0.8000 1.0000 1.5000 0.0000 Constraint 41 350 0.8000 1.0000 1.5000 0.0000 Constraint 41 341 0.8000 1.0000 1.5000 0.0000 Constraint 41 330 0.8000 1.0000 1.5000 0.0000 Constraint 41 303 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 292 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 267 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 221 0.8000 1.0000 1.5000 0.0000 Constraint 41 210 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 144 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 480 0.8000 1.0000 1.5000 0.0000 Constraint 33 473 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 461 0.8000 1.0000 1.5000 0.0000 Constraint 33 449 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 429 0.8000 1.0000 1.5000 0.0000 Constraint 33 421 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 404 0.8000 1.0000 1.5000 0.0000 Constraint 33 399 0.8000 1.0000 1.5000 0.0000 Constraint 33 391 0.8000 1.0000 1.5000 0.0000 Constraint 33 297 0.8000 1.0000 1.5000 0.0000 Constraint 33 272 0.8000 1.0000 1.5000 0.0000 Constraint 33 226 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 144 0.8000 1.0000 1.5000 0.0000 Constraint 33 136 0.8000 1.0000 1.5000 0.0000 Constraint 33 128 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: