# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 17.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 176 314 11.6052 14.5065 21.7597 85.5352 Constraint 176 303 12.5532 15.6915 23.5372 85.4528 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 176 250 12.5547 15.6933 23.5400 82.1305 Constraint 292 429 10.4716 13.0895 19.6342 82.0719 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 297 421 9.8861 12.3577 18.5365 81.3738 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 259 330 11.3543 14.1929 21.2893 80.7315 Constraint 210 330 10.8810 13.6013 20.4019 80.1608 Constraint 267 330 11.1639 13.9549 20.9323 79.9388 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 221 330 11.1382 13.9227 20.8841 79.7317 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 237 322 11.6456 14.5569 21.8354 79.3604 Constraint 285 421 8.2255 10.2818 15.4227 79.3366 Constraint 259 341 11.0268 13.7834 20.6752 79.3021 Constraint 210 341 12.3263 15.4078 23.1118 78.7314 Constraint 182 341 10.8696 13.5870 20.3804 78.7314 Constraint 292 421 6.4405 8.0506 12.0760 78.6385 Constraint 279 341 8.7088 10.8860 16.3290 78.5094 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 210 429 9.1464 11.4330 17.1495 78.3386 Constraint 210 421 5.9486 7.4357 11.1536 78.3386 Constraint 182 421 9.1212 11.4015 17.1023 78.3386 Constraint 176 421 11.2097 14.0122 21.0183 78.3386 Constraint 285 350 7.2917 9.1146 13.6719 78.3081 Constraint 303 412 11.6331 14.5414 21.8121 78.2785 Constraint 285 404 11.5022 14.3777 21.5666 78.2739 Constraint 210 404 11.1018 13.8772 20.8158 78.2280 Constraint 226 303 12.9068 16.1335 24.2003 77.7886 Constraint 292 412 8.7352 10.9190 16.3786 77.5617 Constraint 190 330 12.4773 15.5966 23.3949 77.5025 Constraint 242 421 4.9975 6.2469 9.3703 77.3930 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 226 322 12.2059 15.2574 22.8861 77.3060 Constraint 242 404 8.1569 10.1961 15.2941 77.2824 Constraint 285 412 9.0053 11.2567 16.8850 77.2617 Constraint 242 330 12.7575 15.9468 23.9203 77.2150 Constraint 176 330 12.2190 15.2738 22.9107 77.1665 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 292 355 10.9572 13.6965 20.5447 76.8450 Constraint 169 285 12.1641 15.2051 22.8077 76.7448 Constraint 210 399 10.2282 12.7853 19.1780 76.7408 Constraint 242 429 8.1830 10.2287 15.3431 76.6039 Constraint 330 399 11.8157 14.7696 22.1544 76.5642 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 259 429 10.6363 13.2954 19.9431 76.3384 Constraint 259 421 6.8013 8.5016 12.7524 76.3384 Constraint 259 404 10.0638 12.5798 18.8697 76.2461 Constraint 259 412 6.7206 8.4008 12.6012 76.2453 Constraint 210 412 8.0514 10.0642 15.0963 76.2453 Constraint 272 341 11.1259 13.9073 20.8610 75.9385 Constraint 128 297 9.1674 11.4592 17.1888 75.9352 Constraint 104 303 10.3964 12.9955 19.4932 75.9352 Constraint 104 297 8.7302 10.9127 16.3690 75.9352 Constraint 242 399 8.2128 10.2660 15.3990 75.9001 Constraint 221 341 11.9404 14.9255 22.3882 75.7314 Constraint 237 421 7.4477 9.3096 13.9644 75.6803 Constraint 201 421 9.7702 12.2128 18.3192 75.6803 Constraint 190 421 11.1614 13.9518 20.9276 75.6803 Constraint 128 272 10.0105 12.5131 18.7697 75.6352 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 272 421 10.4808 13.1010 19.6515 75.5457 Constraint 267 421 10.5227 13.1533 19.7300 75.5457 Constraint 314 435 11.3778 14.2223 21.3334 75.4752 Constraint 169 421 8.9666 11.2082 16.8123 75.4127 Constraint 292 435 11.2621 14.0776 21.1164 75.3701 Constraint 221 421 7.8416 9.8020 14.7031 75.3386 Constraint 242 412 4.3429 5.4286 8.1429 75.2997 Constraint 292 442 8.3884 10.4854 15.7282 75.0205 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 259 399 9.2037 11.5046 17.2569 74.8455 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 210 435 9.1089 11.3861 17.0792 74.5667 Constraint 104 272 11.4856 14.3570 21.5355 74.4437 Constraint 285 442 10.6672 13.3340 20.0009 74.3537 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 285 355 9.2698 11.5872 17.3808 73.8564 Constraint 221 399 11.4017 14.2521 21.3781 73.8456 Constraint 250 421 8.5927 10.7409 16.1113 73.7146 Constraint 242 435 7.1243 8.9054 13.3581 73.6212 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 297 399 11.8579 14.8224 22.2336 73.4870 Constraint 272 412 11.7845 14.7306 22.0960 73.4525 Constraint 267 412 10.5789 13.2236 19.8354 73.4525 Constraint 182 412 11.5585 14.4481 21.6722 73.2454 Constraint 221 412 8.6476 10.8094 16.2142 73.2453 Constraint 210 442 5.2837 6.6046 9.9069 73.2333 Constraint 237 404 10.4282 13.0353 19.5529 72.7845 Constraint 237 399 11.2735 14.0919 21.1379 72.7845 Constraint 250 404 9.8798 12.3497 18.5246 72.6060 Constraint 279 350 8.9905 11.2381 16.8572 72.6034 Constraint 259 442 8.0525 10.0656 15.0984 72.5666 Constraint 259 435 10.2455 12.8068 19.2102 72.5666 Constraint 169 429 10.8522 13.5653 20.3480 72.3489 Constraint 242 442 4.8649 6.0811 9.1216 72.2877 Constraint 314 442 9.7151 12.1439 18.2159 72.1086 Constraint 259 355 11.4792 14.3489 21.5234 71.8562 Constraint 237 429 9.4887 11.8608 17.7913 71.7999 Constraint 237 412 6.7497 8.4371 12.6557 71.7999 Constraint 250 412 6.0105 7.5132 11.2697 71.6214 Constraint 279 421 11.4527 14.3158 21.4738 71.5700 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 182 442 9.5712 11.9640 17.9460 71.1401 Constraint 176 442 9.9076 12.3845 18.5768 71.1401 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 226 421 9.7619 12.2024 18.3036 70.8931 Constraint 341 421 11.3069 14.1336 21.2004 70.8771 Constraint 96 279 11.8742 14.8427 22.2640 70.8477 Constraint 96 272 10.8590 13.5738 20.3607 70.8477 Constraint 104 190 11.5748 14.4685 21.7028 70.5880 Constraint 128 226 10.2273 12.7841 19.1762 70.5726 Constraint 169 412 11.2741 14.0926 21.1389 70.5617 Constraint 161 292 12.1774 15.2218 22.8327 70.4950 Constraint 250 399 10.7429 13.4286 20.1429 70.4399 Constraint 259 350 9.6072 12.0090 18.0135 70.4074 Constraint 122 242 9.8082 12.2603 18.3904 70.3561 Constraint 221 429 11.5306 14.4133 21.6199 70.3465 Constraint 322 442 10.6765 13.3457 20.0185 70.3154 Constraint 221 442 7.8447 9.8058 14.7087 70.2333 Constraint 285 382 10.1808 12.7260 19.0890 70.1228 Constraint 104 429 11.3951 14.2438 21.3657 70.0317 Constraint 169 250 11.8896 14.8619 22.2929 69.9686 Constraint 267 341 10.6974 13.3718 20.0577 69.9556 Constraint 128 303 11.3513 14.1892 21.2838 69.9448 Constraint 237 435 7.3795 9.2244 13.8366 69.8153 Constraint 272 442 11.0855 13.8569 20.7853 69.7737 Constraint 128 285 11.0992 13.8740 20.8110 69.6448 Constraint 128 259 10.3596 12.9495 19.4242 69.6448 Constraint 221 435 11.1630 13.9538 20.9307 69.5666 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 96 259 9.7272 12.1590 18.2386 69.4432 Constraint 128 429 9.8799 12.3498 18.5247 69.3154 Constraint 201 303 13.1697 16.4621 24.6931 68.9598 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 201 412 10.8227 13.5283 20.2925 68.8000 Constraint 226 412 9.3911 11.7388 17.6082 68.7999 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 104 330 8.0211 10.0264 15.0396 68.7223 Constraint 169 435 10.6645 13.3307 19.9960 68.5771 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 237 442 4.1481 5.1852 7.7777 68.4818 Constraint 201 442 7.2475 9.0593 13.5890 68.4818 Constraint 122 237 9.3698 11.7122 17.5684 68.4650 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 297 11.9830 14.9787 22.4681 68.4377 Constraint 88 182 11.4595 14.3244 21.4866 68.4377 Constraint 259 382 9.1736 11.4670 17.2005 68.4039 Constraint 292 391 7.6735 9.5919 14.3879 68.3856 Constraint 122 221 10.9826 13.7282 20.5923 68.3017 Constraint 182 350 11.2331 14.0413 21.0620 68.3009 Constraint 113 292 11.1929 13.9912 20.9868 68.2996 Constraint 161 322 12.3244 15.4055 23.1082 68.2503 Constraint 169 442 6.8572 8.5715 12.8573 68.2142 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 96 190 11.3884 14.2355 21.3532 68.1895 Constraint 279 355 11.6886 14.6107 21.9161 68.1517 Constraint 96 242 8.6009 10.7511 16.1266 67.9269 Constraint 169 267 12.3430 15.4288 23.1431 67.9124 Constraint 122 297 11.9677 14.9597 22.4395 67.8823 Constraint 190 442 10.0260 12.5325 18.7988 67.8151 Constraint 88 303 12.1422 15.1778 22.7666 67.6523 Constraint 250 442 7.7335 9.6669 14.5003 67.6366 Constraint 250 435 9.1265 11.4081 17.1122 67.6366 Constraint 104 421 9.2382 11.5478 17.3216 67.5965 Constraint 259 391 6.1361 7.6701 11.5051 67.3876 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 136 221 11.9638 14.9547 22.4321 67.1767 Constraint 242 375 10.9715 13.7144 20.5716 67.1583 Constraint 292 449 8.9764 11.2205 16.8308 67.0627 Constraint 210 449 6.3314 7.9142 11.8713 67.0627 Constraint 182 449 9.9070 12.3837 18.5756 67.0627 Constraint 250 429 11.0214 13.7768 20.6652 67.0503 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 201 429 12.2403 15.3003 22.9505 66.7998 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 96 350 9.3577 11.6971 17.5457 66.6210 Constraint 128 421 7.5439 9.4299 14.1448 66.5984 Constraint 182 399 12.6002 15.7503 23.6254 66.4789 Constraint 297 442 11.8094 14.7617 22.1426 66.4664 Constraint 242 391 5.9528 7.4410 11.1615 66.4420 Constraint 242 382 8.3401 10.4252 15.6377 66.4420 Constraint 104 442 11.0401 13.8001 20.7002 66.2630 Constraint 221 404 12.0744 15.0930 22.6394 66.2573 Constraint 237 391 9.6347 12.0434 18.0651 66.1731 Constraint 210 391 9.1127 11.3908 17.0862 66.1731 Constraint 182 391 11.4140 14.2675 21.4012 66.1731 Constraint 128 330 10.3698 12.9623 19.4434 66.1514 Constraint 136 297 11.3659 14.2074 21.3110 65.9853 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 113 314 10.6360 13.2950 19.9425 65.8167 Constraint 161 237 10.1946 12.7433 19.1150 65.7435 Constraint 128 435 11.0254 13.7817 20.6726 65.7027 Constraint 242 350 11.0769 13.8461 20.7692 65.6809 Constraint 279 391 10.7529 13.4411 20.1617 65.6110 Constraint 96 435 10.5164 13.1455 19.7182 65.5215 Constraint 96 421 5.7540 7.1924 10.7887 65.5215 Constraint 96 412 9.6791 12.0989 18.1483 65.5215 Constraint 226 442 7.4966 9.3707 14.0561 65.4818 Constraint 272 350 11.0273 13.7842 20.6762 65.3891 Constraint 297 412 12.0565 15.0707 22.6060 65.3795 Constraint 128 442 7.7734 9.7168 14.5752 65.2649 Constraint 314 449 9.2482 11.5602 17.3404 65.1489 Constraint 267 442 11.5104 14.3879 21.5819 65.1095 Constraint 96 341 9.9222 12.4028 18.6042 65.0664 Constraint 128 279 12.2866 15.3583 23.0374 64.9806 Constraint 113 421 10.3493 12.9367 19.4050 64.9382 Constraint 169 279 12.9444 16.1805 24.2708 64.8864 Constraint 259 375 11.4219 14.2774 21.4161 64.8229 Constraint 201 435 11.1300 13.9124 20.8687 64.8151 Constraint 226 435 10.8956 13.6195 20.4293 64.8151 Constraint 267 391 9.3004 11.6255 17.4382 64.5947 Constraint 292 360 7.8678 9.8347 14.7521 64.5166 Constraint 259 368 9.1158 11.3947 17.0921 64.5166 Constraint 221 391 8.9070 11.1337 16.7006 64.3876 Constraint 104 285 11.2841 14.1051 21.1577 64.3718 Constraint 285 429 11.6149 14.5186 21.7780 64.3429 Constraint 242 449 7.6374 9.5468 14.3201 64.3299 Constraint 250 391 7.6952 9.6190 14.4286 64.2508 Constraint 250 382 8.8522 11.0653 16.5979 64.2508 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 136 292 10.3396 12.9245 19.3868 63.9969 Constraint 122 421 7.4323 9.2904 13.9355 63.9402 Constraint 128 412 10.9801 13.7252 20.5877 63.9094 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 88 330 10.8321 13.5401 20.3102 63.7501 Constraint 242 368 9.4875 11.8593 17.7890 63.5710 Constraint 242 360 8.5295 10.6619 15.9929 63.5710 Constraint 88 429 8.6276 10.7845 16.1768 63.5196 Constraint 161 442 10.4831 13.1039 19.6558 63.4584 Constraint 136 442 11.2857 14.1071 21.1606 63.3986 Constraint 272 391 11.0453 13.8066 20.7100 63.3803 Constraint 161 421 12.6824 15.8530 23.7796 63.3500 Constraint 169 449 6.7166 8.3958 12.5937 63.3343 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 297 360 9.5225 11.9032 17.8548 63.3022 Constraint 292 368 10.6044 13.2555 19.8832 63.3022 Constraint 237 360 12.1154 15.1442 22.7164 63.3022 Constraint 210 360 10.1568 12.6961 19.0441 63.3022 Constraint 182 360 11.4909 14.3637 21.5455 63.3022 Constraint 176 449 10.2896 12.8620 19.2931 63.1823 Constraint 96 442 8.3633 10.4541 15.6811 63.1717 Constraint 322 449 9.2477 11.5597 17.3395 63.0739 Constraint 104 259 11.6522 14.5653 21.8479 62.9673 Constraint 226 391 11.2568 14.0710 21.1065 62.8731 Constraint 122 429 7.8180 9.7725 14.6588 62.8450 Constraint 190 412 12.1667 15.2083 22.8125 62.8109 Constraint 259 449 10.1094 12.6367 18.9551 62.7046 Constraint 96 267 11.8947 14.8684 22.3026 62.7037 Constraint 285 375 11.3900 14.2374 21.3562 62.6193 Constraint 88 161 13.0225 16.2781 24.4171 62.6115 Constraint 297 449 11.7872 14.7341 22.1011 62.5962 Constraint 113 429 10.9982 13.7478 20.6217 62.5450 Constraint 259 360 8.0304 10.0380 15.0570 62.5164 Constraint 88 421 8.3548 10.4436 15.6653 62.5032 Constraint 267 350 9.7208 12.1510 18.2264 62.4005 Constraint 210 350 11.5238 14.4047 21.6071 62.3606 Constraint 88 242 10.8569 13.5711 20.3567 62.3481 Constraint 122 442 8.1363 10.1704 15.2556 62.3067 Constraint 113 442 11.6243 14.5304 21.7956 62.3067 Constraint 104 449 8.7198 10.8998 16.3496 62.3045 Constraint 221 449 9.7716 12.2145 18.3217 62.2755 Constraint 350 412 11.4016 14.2520 21.3780 62.2633 Constraint 292 382 11.2146 14.0183 21.0274 62.1319 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 122 412 11.0200 13.7750 20.6625 61.8469 Constraint 250 368 10.4329 13.0411 19.5617 61.6799 Constraint 250 360 10.9151 13.6439 20.4658 61.6799 Constraint 113 297 12.2895 15.3618 23.0427 61.6090 Constraint 96 226 12.0189 15.0236 22.5355 61.6022 Constraint 221 360 10.3388 12.9235 19.3853 61.5166 Constraint 153 322 10.9338 13.6673 20.5009 61.4742 Constraint 153 292 10.8870 13.6088 20.4132 61.4742 Constraint 104 242 10.8741 13.5926 20.3890 61.4510 Constraint 210 461 10.1838 12.7297 19.0946 61.3064 Constraint 128 461 8.7765 10.9707 16.4560 61.3064 Constraint 128 449 5.9601 7.4502 11.1752 61.3064 Constraint 153 237 8.6397 10.7996 16.1993 61.2084 Constraint 182 429 12.1580 15.1975 22.7962 61.1810 Constraint 360 435 10.9216 13.6519 20.4779 61.0672 Constraint 122 399 10.1622 12.7028 19.0542 61.0578 Constraint 104 341 9.9979 12.4974 18.7460 61.0540 Constraint 88 404 11.7046 14.6307 21.9461 60.9486 Constraint 250 322 13.0521 16.3151 24.4727 60.9201 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 104 279 12.3596 15.4494 23.1742 60.6363 Constraint 221 350 11.0231 13.7789 20.6683 60.6266 Constraint 153 242 10.5933 13.2416 19.8623 60.5287 Constraint 237 449 7.4832 9.3540 14.0310 60.5240 Constraint 201 449 8.7607 10.9509 16.4264 60.5240 Constraint 190 449 11.6085 14.5106 21.7659 60.5240 Constraint 279 360 10.5269 13.1586 19.7380 60.5093 Constraint 272 360 11.6403 14.5503 21.8255 60.5093 Constraint 267 360 10.3694 12.9618 19.4427 60.5093 Constraint 113 330 11.5500 14.4376 21.6563 60.5045 Constraint 104 399 11.4456 14.3069 21.4604 60.4610 Constraint 122 435 9.8239 12.2798 18.4198 60.3555 Constraint 136 237 11.4648 14.3310 21.4965 60.2875 Constraint 404 467 8.3910 10.4888 15.7332 60.2295 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 242 341 12.3827 15.4784 23.2176 59.9984 Constraint 136 314 11.2359 14.0449 21.0673 59.9624 Constraint 237 382 11.3043 14.1303 21.1955 59.8962 Constraint 88 442 10.8937 13.6171 20.4257 59.8717 Constraint 136 449 9.1917 11.4896 17.2344 59.7401 Constraint 360 442 10.5240 13.1550 19.7325 59.7338 Constraint 144 322 11.0398 13.7998 20.6996 59.7106 Constraint 355 429 12.2103 15.2629 22.8943 59.6537 Constraint 113 449 8.6070 10.7587 16.1380 59.6462 Constraint 136 421 11.1206 13.9008 20.8512 59.6374 Constraint 122 226 11.8465 14.8081 22.2122 59.4746 Constraint 104 237 11.7034 14.6293 21.9439 59.4725 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 169 330 12.7279 15.9099 23.8648 59.2359 Constraint 96 467 10.5020 13.1274 19.6912 59.2132 Constraint 96 461 7.7945 9.7431 14.6146 59.2132 Constraint 96 449 5.9865 7.4831 11.2247 59.2132 Constraint 144 429 11.4419 14.3024 21.4536 59.0374 Constraint 161 242 12.6199 15.7749 23.6624 58.9074 Constraint 267 399 12.2773 15.3466 23.0199 58.7567 Constraint 122 461 6.0480 7.5600 11.3400 58.6481 Constraint 122 449 4.9350 6.1687 9.2531 58.6481 Constraint 113 461 9.2294 11.5368 17.3052 58.6481 Constraint 153 226 10.8852 13.6065 20.4097 58.4742 Constraint 399 467 8.8077 11.0096 16.5144 58.4423 Constraint 88 435 11.8669 14.8336 22.2504 58.4408 Constraint 314 461 11.5149 14.3937 21.5905 58.3946 Constraint 169 461 10.0343 12.5428 18.8143 58.3946 Constraint 161 461 12.1350 15.1688 22.7532 58.3946 Constraint 104 461 10.3400 12.9250 19.3875 58.3946 Constraint 267 382 12.0016 15.0020 22.5031 58.3409 Constraint 226 429 12.5301 15.6626 23.4940 58.2384 Constraint 128 267 12.1214 15.1517 22.7276 58.2162 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 104 350 10.7936 13.4919 20.2379 58.0597 Constraint 128 341 12.3347 15.4184 23.1276 58.0540 Constraint 88 341 11.8236 14.7795 22.1692 58.0540 Constraint 144 421 11.2629 14.0786 21.1179 58.0394 Constraint 136 461 10.9868 13.7335 20.6003 57.7988 Constraint 279 412 12.3178 15.3973 23.0959 57.7406 Constraint 128 399 10.9703 13.7129 20.5693 57.7257 Constraint 237 303 13.0236 16.2795 24.4192 57.6428 Constraint 122 330 12.3711 15.4639 23.1958 57.5028 Constraint 161 449 9.6908 12.1135 18.1702 57.4776 Constraint 122 467 9.0496 11.3120 16.9680 57.4567 Constraint 136 242 12.2196 15.2745 22.9118 57.3748 Constraint 88 449 7.6931 9.6164 14.4245 57.2112 Constraint 210 382 12.0710 15.0888 22.6332 57.1841 Constraint 285 449 11.5617 14.4521 21.6782 56.9560 Constraint 136 330 11.6259 14.5323 21.7985 56.8724 Constraint 122 404 11.5443 14.4303 21.6455 56.8547 Constraint 153 435 10.0615 12.5769 18.8654 56.8479 Constraint 153 429 9.8914 12.3643 18.5464 56.8479 Constraint 153 421 9.2888 11.6110 17.4165 56.8479 Constraint 153 412 11.8498 14.8122 22.2183 56.8479 Constraint 303 382 11.6295 14.5368 21.8053 56.7220 Constraint 292 375 12.3000 15.3750 23.0625 56.6194 Constraint 128 250 12.2172 15.2715 22.9072 56.4563 Constraint 221 382 11.8902 14.8628 22.2942 56.4149 Constraint 136 429 12.6185 15.7731 23.6597 56.3011 Constraint 128 404 12.6293 15.7867 23.6800 56.2589 Constraint 96 355 10.0060 12.5075 18.7612 56.0875 Constraint 144 237 11.2274 14.0342 21.0514 56.0767 Constraint 242 355 12.3437 15.4296 23.1445 56.0382 Constraint 122 285 12.5335 15.6669 23.5004 55.6871 Constraint 250 375 12.1047 15.1309 22.6963 55.6802 Constraint 292 461 12.1074 15.1342 22.7013 55.5578 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 144 442 10.4807 13.1009 19.6514 55.5145 Constraint 128 467 11.9266 14.9082 22.3624 55.3160 Constraint 80 330 8.5588 10.6984 16.0477 55.2772 Constraint 80 297 11.3235 14.1543 21.2315 55.2772 Constraint 285 435 12.1268 15.1584 22.7377 55.0688 Constraint 80 421 11.0253 13.7817 20.6725 55.0475 Constraint 88 467 9.1462 11.4328 17.1492 55.0217 Constraint 88 461 7.2778 9.0972 13.6459 55.0217 Constraint 322 461 11.5274 14.4093 21.6139 55.0203 Constraint 226 449 10.2887 12.8609 19.2914 54.9531 Constraint 80 429 12.0165 15.0206 22.5310 54.9475 Constraint 122 259 11.3383 14.1729 21.2593 54.9014 Constraint 382 449 11.8405 14.8006 22.2010 54.6424 Constraint 267 368 11.1611 13.9514 20.9271 54.5203 Constraint 96 391 8.9912 11.2391 16.8586 54.3945 Constraint 88 412 11.9515 14.9394 22.4091 54.3593 Constraint 113 467 11.5843 14.4804 21.7205 54.2900 Constraint 80 182 11.7767 14.7208 22.0813 54.2495 Constraint 272 449 12.1889 15.2361 22.8542 54.1631 Constraint 169 399 12.8883 16.1104 24.1656 54.1480 Constraint 242 461 10.5747 13.2183 19.8275 53.9095 Constraint 80 292 11.1480 13.9350 20.9026 53.8842 Constraint 190 391 12.6808 15.8510 23.7765 53.8842 Constraint 128 350 12.1896 15.2370 22.8554 53.8454 Constraint 303 449 12.4970 15.6213 23.4320 53.7596 Constraint 375 449 12.3317 15.4147 23.1220 53.6444 Constraint 421 480 10.3571 12.9464 19.4196 53.6219 Constraint 96 250 11.9995 14.9994 22.4991 53.5766 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 80 169 12.0802 15.1003 22.6504 52.4524 Constraint 169 303 13.1193 16.3991 24.5987 52.3301 Constraint 412 473 8.5329 10.6662 15.9993 52.3177 Constraint 404 473 5.4961 6.8701 10.3051 52.3177 Constraint 250 449 10.6917 13.3647 20.0470 52.2015 Constraint 96 473 9.7923 12.2404 18.3606 52.1110 Constraint 303 442 12.3370 15.4212 23.1318 52.0698 Constraint 153 461 7.8545 9.8182 14.7273 51.8559 Constraint 153 449 5.6971 7.1214 10.6821 51.8559 Constraint 144 461 8.6075 10.7594 16.1391 51.8559 Constraint 144 449 7.8179 9.7724 14.6586 51.8559 Constraint 153 272 12.8002 16.0002 24.0003 51.8500 Constraint 136 272 12.3955 15.4944 23.2416 51.6941 Constraint 96 360 7.5663 9.4579 14.1868 51.5236 Constraint 210 368 12.4274 15.5343 23.3014 51.3132 Constraint 221 368 11.8669 14.8336 22.2504 51.3132 Constraint 267 355 11.9833 14.9792 22.4688 51.2667 Constraint 279 368 12.1013 15.1266 22.6900 51.2652 Constraint 80 350 11.0328 13.7910 20.6865 51.1591 Constraint 297 368 12.3287 15.4109 23.1163 51.0484 Constraint 201 391 12.3812 15.4765 23.2148 50.9072 Constraint 144 435 12.5630 15.7038 23.5556 50.8480 Constraint 122 473 10.1174 12.6468 18.9702 50.7364 Constraint 96 480 11.1551 13.9439 20.9159 50.7287 Constraint 399 473 5.0505 6.3131 9.4697 50.5306 Constraint 412 480 12.2640 15.3300 22.9950 50.5123 Constraint 350 429 11.8942 14.8677 22.3015 50.4213 Constraint 144 292 12.1017 15.1271 22.6907 50.0864 Constraint 360 449 10.1209 12.6511 18.9766 50.0571 Constraint 122 480 10.9696 13.7120 20.5680 49.9473 Constraint 399 480 8.2521 10.3151 15.4727 49.9190 Constraint 404 480 9.1584 11.4480 17.1721 49.5142 Constraint 113 399 11.9883 14.9853 22.4780 49.4944 Constraint 237 461 10.6299 13.2874 19.9311 49.3601 Constraint 80 399 11.4082 14.2603 21.3904 49.2994 Constraint 153 314 12.4030 15.5037 23.2556 48.8501 Constraint 314 473 10.8592 13.5741 20.3611 48.6312 Constraint 153 467 11.6649 14.5812 21.8718 48.3782 Constraint 80 461 10.8516 13.5645 20.3468 48.2366 Constraint 80 449 10.5703 13.2129 19.8194 48.2366 Constraint 161 272 12.8058 16.0073 24.0109 48.1966 Constraint 368 449 12.7369 15.9211 23.8817 48.0735 Constraint 88 473 9.3919 11.7399 17.6098 47.9196 Constraint 113 242 11.7657 14.7071 22.0606 47.9125 Constraint 122 272 12.5567 15.6959 23.5439 47.9018 Constraint 391 467 12.3405 15.4256 23.1383 47.8881 Constraint 391 461 11.4287 14.2859 21.4288 47.8881 Constraint 210 473 11.9896 14.9870 22.4805 47.8216 Constraint 250 350 12.3813 15.4766 23.2150 47.6696 Constraint 88 480 9.2214 11.5267 17.2901 47.5123 Constraint 88 360 9.4767 11.8458 17.7688 47.3091 Constraint 128 391 11.2931 14.1164 21.1746 47.1715 Constraint 144 314 12.8542 16.0678 24.1017 47.0865 Constraint 144 242 12.2456 15.3070 22.9604 47.0864 Constraint 182 435 12.7375 15.9219 23.8828 46.7261 Constraint 182 461 13.0037 16.2546 24.3819 46.4056 Constraint 104 360 10.6364 13.2955 19.9432 46.3025 Constraint 201 461 12.4438 15.5547 23.3321 46.2850 Constraint 242 473 10.8299 13.5374 20.3061 45.8984 Constraint 292 473 12.6257 15.7822 23.6732 45.7945 Constraint 122 303 12.9553 16.1941 24.2912 45.7841 Constraint 88 350 10.6980 13.3725 20.0587 45.2837 Constraint 113 480 12.4726 15.5907 23.3861 45.2831 Constraint 322 473 12.6712 15.8390 23.7584 45.2744 Constraint 176 412 12.8299 16.0374 24.0561 45.1294 Constraint 210 467 12.7802 15.9752 23.9629 44.8707 Constraint 322 404 11.4791 14.3489 21.5234 44.8162 Constraint 88 355 10.7764 13.4704 20.2057 44.5145 Constraint 360 461 11.3768 14.2210 21.3316 44.3008 Constraint 382 461 12.6260 15.7826 23.6738 43.9599 Constraint 375 467 11.1495 13.9369 20.9054 43.9599 Constraint 375 461 12.0716 15.0895 22.6342 43.9599 Constraint 122 391 11.5186 14.3983 21.5974 43.6025 Constraint 128 360 10.8967 13.6209 20.4313 43.3025 Constraint 122 360 10.8618 13.5772 20.3659 43.3025 Constraint 96 375 11.2287 14.0359 21.0538 43.0356 Constraint 88 391 11.1087 13.8858 20.8288 43.0342 Constraint 355 473 11.6062 14.5077 21.7616 42.9325 Constraint 144 467 11.7729 14.7161 22.0741 42.3879 Constraint 104 355 11.9339 14.9174 22.3761 42.2838 Constraint 136 226 12.9077 16.1346 24.2019 42.2666 Constraint 303 375 11.1958 13.9948 20.9922 42.2192 Constraint 128 473 11.4979 14.3723 21.5585 41.8312 Constraint 96 368 10.9021 13.6276 20.4414 41.7456 Constraint 153 297 12.9036 16.1296 24.1943 41.6491 Constraint 96 382 11.8106 14.7632 22.1448 41.6167 Constraint 113 473 12.3094 15.3868 23.0802 41.4010 Constraint 360 467 12.1334 15.1668 22.7502 41.3008 Constraint 226 404 12.9286 16.1608 24.2412 41.2653 Constraint 169 391 12.3576 15.4470 23.1706 41.2335 Constraint 391 480 12.4265 15.5331 23.2997 41.1725 Constraint 80 360 10.5647 13.2058 19.8088 40.9480 Constraint 80 355 11.1717 13.9646 20.9470 40.8786 Constraint 153 259 12.2916 15.3645 23.0468 40.8653 Constraint 153 399 12.9787 16.2234 24.3351 40.8060 Constraint 153 473 12.6315 15.7893 23.6840 40.8052 Constraint 391 473 9.0502 11.3127 16.9690 40.7859 Constraint 88 259 11.5275 14.4093 21.6140 40.4530 Constraint 375 480 10.0903 12.6129 18.9194 40.1744 Constraint 382 473 9.0358 11.2947 16.9421 39.7696 Constraint 375 473 7.0909 8.8636 13.2955 39.7696 Constraint 242 467 12.2768 15.3460 23.0189 39.5481 Constraint 88 285 11.8173 14.7716 22.1575 39.4533 Constraint 303 429 11.0562 13.8203 20.7305 38.6521 Constraint 382 467 12.2662 15.3328 22.9992 38.3869 Constraint 237 473 12.6120 15.7649 23.6474 37.9685 Constraint 113 360 12.0817 15.1021 22.6532 37.7294 Constraint 360 480 11.4857 14.3571 21.5357 37.6035 Constraint 88 375 12.0342 15.0427 22.5641 37.4647 Constraint 104 412 12.5732 15.7165 23.5748 37.3966 Constraint 104 267 13.1085 16.3856 24.5785 37.3881 Constraint 429 489 6.4851 8.1064 12.1596 37.3601 Constraint 421 489 8.9595 11.1994 16.7991 37.3601 Constraint 368 473 9.9385 12.4231 18.6347 37.1987 Constraint 360 473 8.8089 11.0112 16.5167 37.1987 Constraint 113 237 11.2370 14.0462 21.0693 36.8018 Constraint 80 473 12.6993 15.8742 23.8112 36.4722 Constraint 80 480 12.4613 15.5766 23.3649 36.2085 Constraint 210 489 12.3674 15.4593 23.1889 35.8393 Constraint 128 489 10.7683 13.4604 20.1905 35.8393 Constraint 104 489 11.2055 14.0069 21.0104 35.8393 Constraint 104 391 11.5404 14.4255 21.6382 35.6094 Constraint 412 489 11.6900 14.6124 21.9187 35.2669 Constraint 435 497 8.8198 11.0247 16.5371 35.0892 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 421 497 6.3341 7.9177 11.8765 35.0892 Constraint 322 382 12.6194 15.7743 23.6614 35.0537 Constraint 279 442 12.6131 15.7663 23.6495 34.9101 Constraint 88 237 10.8247 13.5309 20.2963 34.6991 Constraint 382 480 12.3611 15.4514 23.1772 34.6014 Constraint 259 461 12.5829 15.7286 23.5929 34.1271 Constraint 237 368 12.3774 15.4718 23.2077 34.0496 Constraint 88 176 12.2810 15.3512 23.0268 33.7732 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 128 497 9.6045 12.0057 18.0085 33.5683 Constraint 399 497 5.7426 7.1782 10.7673 33.4007 Constraint 314 497 8.7608 10.9510 16.4265 33.2683 Constraint 292 497 10.7892 13.4866 20.2298 33.2683 Constraint 210 497 10.3590 12.9488 19.4232 33.2683 Constraint 104 497 9.6545 12.0681 18.1021 33.2683 Constraint 412 497 9.1618 11.4522 17.1783 32.9959 Constraint 399 489 8.4371 10.5463 15.8195 32.9364 Constraint 136 489 12.6979 15.8724 23.8086 32.6281 Constraint 104 473 12.5076 15.6345 23.4517 32.5774 Constraint 404 489 9.7088 12.1360 18.2040 32.5316 Constraint 113 303 13.3318 16.6647 24.9971 32.4244 Constraint 88 221 11.5701 14.4626 21.6939 32.4167 Constraint 350 497 11.1960 13.9950 20.9925 32.1914 Constraint 350 442 12.8110 16.0137 24.0206 32.1305 Constraint 350 449 12.2009 15.2512 22.8768 32.0960 Constraint 169 497 11.6915 14.6144 21.9216 32.0539 Constraint 259 473 12.3905 15.4881 23.2321 32.0279 Constraint 322 435 11.6659 14.5824 21.8736 32.0122 Constraint 153 489 11.3241 14.1551 21.2327 31.9666 Constraint 144 489 10.7861 13.4827 20.2240 31.9666 Constraint 322 497 9.5148 11.8935 17.8403 31.4751 Constraint 96 497 6.2746 7.8432 11.7648 31.4751 Constraint 267 404 12.7283 15.9104 23.8656 31.3085 Constraint 404 497 7.5289 9.4111 14.1167 31.2770 Constraint 88 497 5.6890 7.1113 10.6669 31.1751 Constraint 122 489 7.5066 9.3833 14.0749 31.0878 Constraint 221 461 12.8320 16.0400 24.0600 30.9639 Constraint 122 497 7.4785 9.3481 14.0222 30.6101 Constraint 113 497 9.4270 11.7838 17.6757 30.6101 Constraint 242 497 10.1556 12.6945 19.0417 30.2295 Constraint 122 250 11.8141 14.7676 22.1514 30.2062 Constraint 169 489 12.5527 15.6908 23.5363 30.1830 Constraint 144 473 12.9116 16.1395 24.2093 30.0064 Constraint 314 489 11.2778 14.0972 21.1459 30.0025 Constraint 122 350 12.5589 15.6986 23.5478 29.8792 Constraint 113 489 9.5110 11.8888 17.8332 29.8734 Constraint 88 368 12.3677 15.4597 23.1895 29.7567 Constraint 272 399 12.6857 15.8572 23.7858 29.5718 Constraint 330 497 12.4716 15.5894 23.3842 29.4914 Constraint 153 497 10.9887 13.7358 20.6037 29.3957 Constraint 104 226 12.7593 15.9491 23.9237 29.2245 Constraint 80 467 12.4622 15.5777 23.3666 29.2086 Constraint 355 497 9.6588 12.0735 18.1102 29.1914 Constraint 259 497 11.7728 14.7160 22.0740 29.1783 Constraint 314 480 12.4856 15.6070 23.4105 29.0037 Constraint 297 429 10.6409 13.3011 19.9517 28.9978 Constraint 303 404 10.6415 13.3019 19.9529 28.9724 Constraint 350 473 11.5893 14.4866 21.7299 28.9142 Constraint 330 449 11.9491 14.9363 22.4045 28.8922 Constraint 237 467 12.5819 15.7274 23.5911 28.7968 Constraint 314 467 12.8986 16.1232 24.1848 28.5677 Constraint 250 461 12.9241 16.1551 24.2326 28.5540 Constraint 267 449 12.7172 15.8964 23.8447 28.5175 Constraint 80 497 9.3774 11.7218 17.5826 28.4674 Constraint 80 489 10.3060 12.8825 19.3238 28.4674 Constraint 113 435 13.1627 16.4534 24.6801 28.4514 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 368 480 12.7465 15.9331 23.8996 28.0304 Constraint 322 489 11.5495 14.4369 21.6553 27.9093 Constraint 136 259 13.2312 16.5390 24.8085 27.8965 Constraint 80 285 12.8815 16.1018 24.1527 27.8499 Constraint 182 497 12.5789 15.7236 23.5854 27.6953 Constraint 226 382 12.6721 15.8402 23.7602 27.6344 Constraint 297 497 12.8542 16.0677 24.1016 27.4316 Constraint 279 399 12.0536 15.0670 22.6006 27.3904 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 153 250 12.7850 15.9813 23.9719 26.9782 Constraint 435 511 11.1449 13.9311 20.8966 26.7157 Constraint 412 511 11.3448 14.1811 21.2716 26.7157 Constraint 242 489 12.2533 15.3166 22.9750 26.3416 Constraint 226 360 12.5778 15.7223 23.5834 26.2158 Constraint 221 497 12.5052 15.6314 23.4472 26.1783 Constraint 399 511 6.6596 8.3245 12.4867 26.1224 Constraint 429 511 7.4598 9.3247 13.9871 25.7176 Constraint 404 511 8.9594 11.1993 16.7990 25.7176 Constraint 237 497 12.1425 15.1782 22.7672 25.6801 Constraint 322 511 12.2656 15.3320 22.9981 25.6157 Constraint 314 511 10.7236 13.4045 20.1068 25.6157 Constraint 96 511 9.5073 11.8841 17.8262 25.6157 Constraint 88 511 8.2671 10.3339 15.5008 25.6157 Constraint 176 429 12.9965 16.2456 24.3684 24.8081 Constraint 169 404 13.0879 16.3599 24.5398 24.7596 Constraint 272 368 12.6813 15.8517 23.7775 24.7015 Constraint 136 497 11.1371 13.9213 20.8820 24.4841 Constraint 250 473 12.5740 15.7175 23.5763 24.3637 Constraint 267 435 12.9319 16.1649 24.2473 24.3538 Constraint 330 429 11.1084 13.8856 20.8283 24.2175 Constraint 176 435 12.9815 16.2269 24.3404 24.0363 Constraint 190 435 13.1348 16.4185 24.6278 24.0343 Constraint 391 497 9.1276 11.4095 17.1142 23.6561 Constraint 169 360 12.7259 15.9073 23.8610 23.3724 Constraint 355 480 11.9346 14.9183 22.3774 23.3417 Constraint 375 489 11.4736 14.3421 21.5131 23.1918 Constraint 161 435 12.9174 16.1467 24.2201 23.1342 Constraint 153 404 13.2504 16.5630 24.8445 22.9803 Constraint 122 511 10.6044 13.2554 19.8832 22.9575 Constraint 80 391 12.6137 15.7671 23.6506 22.9286 Constraint 113 221 12.1415 15.1768 22.7652 22.8614 Constraint 221 355 12.3919 15.4899 23.2349 22.6725 Constraint 88 201 11.1953 13.9942 20.9912 22.5442 Constraint 169 467 12.7995 15.9993 23.9990 22.3693 Constraint 360 497 7.9001 9.8751 14.8126 22.3398 Constraint 210 355 12.7738 15.9673 23.9509 22.3217 Constraint 355 511 9.0933 11.3667 17.0500 22.2986 Constraint 161 297 13.0080 16.2600 24.3900 22.2315 Constraint 382 497 10.4700 13.0875 19.6312 21.9372 Constraint 113 341 12.3559 15.4449 23.1673 21.9348 Constraint 144 497 9.9762 12.4702 18.7054 21.8259 Constraint 368 497 10.3320 12.9150 19.3725 21.6372 Constraint 341 497 12.2064 15.2580 22.8870 21.4842 Constraint 391 511 10.4816 13.1020 19.6531 21.2739 Constraint 391 489 11.7180 14.6475 21.9713 21.2082 Constraint 355 449 12.4633 15.5791 23.3687 21.1594 Constraint 585 651 12.0939 15.1173 22.6760 21.0221 Constraint 341 404 11.3697 14.2121 21.3182 20.9492 Constraint 375 497 8.6709 10.8386 16.2580 20.6209 Constraint 360 489 10.7311 13.4139 20.1209 20.6209 Constraint 128 480 12.6512 15.8140 23.7210 20.5493 Constraint 226 399 12.8540 16.0676 24.1013 20.4746 Constraint 279 382 12.4632 15.5790 23.3685 20.4501 Constraint 355 489 11.7445 14.6806 22.0209 20.3417 Constraint 267 429 12.6945 15.8682 23.8023 20.3384 Constraint 382 511 11.1877 13.9847 20.9770 20.2576 Constraint 169 473 12.3601 15.4501 23.1752 20.1842 Constraint 341 412 11.5835 14.4794 21.7191 20.0210 Constraint 375 511 8.3529 10.4411 15.6617 19.9576 Constraint 368 511 10.5415 13.1768 19.7652 19.9576 Constraint 360 511 8.8341 11.0427 16.5640 19.9576 Constraint 210 375 12.8813 16.1017 24.1525 19.8725 Constraint 421 519 10.8762 13.5952 20.3928 19.7765 Constraint 303 497 11.9794 14.9742 22.4613 19.7653 Constraint 80 442 12.7772 15.9715 23.9572 19.6852 Constraint 104 467 12.0586 15.0732 22.6098 19.6566 Constraint 80 511 10.6508 13.3135 19.9703 19.2331 Constraint 144 221 12.5152 15.6440 23.4661 19.2091 Constraint 297 404 11.2272 14.0340 21.0510 19.0939 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 104 511 12.2470 15.3088 22.9632 18.8283 Constraint 113 355 13.0677 16.3346 24.5019 18.8018 Constraint 599 668 11.3270 14.1588 21.2381 18.6092 Constraint 449 519 10.5041 13.1301 19.6952 18.1430 Constraint 153 480 12.9959 16.2449 24.3674 18.0822 Constraint 272 429 12.4470 15.5587 23.3381 18.0238 Constraint 136 303 13.0660 16.3325 24.4987 17.9832 Constraint 368 467 13.1729 16.4661 24.6991 17.9793 Constraint 585 657 11.6698 14.5872 21.8808 17.8710 Constraint 285 497 11.6645 14.5806 21.8709 17.7685 Constraint 250 497 12.9034 16.1292 24.1938 17.7685 Constraint 590 657 11.4059 14.2573 21.3860 17.7028 Constraint 330 442 12.4523 15.5654 23.3481 17.6475 Constraint 604 676 11.5457 14.4321 21.6482 17.6035 Constraint 80 176 13.1826 16.4782 24.7174 17.5852 Constraint 368 461 13.1455 16.4319 24.6479 17.5633 Constraint 190 360 13.0193 16.2741 24.4111 17.4252 Constraint 330 404 11.8571 14.8214 22.2321 17.3067 Constraint 355 461 12.8536 16.0670 24.1005 17.2312 Constraint 242 511 12.2646 15.3307 22.9961 17.2058 Constraint 182 355 12.9219 16.1524 24.2287 17.1631 Constraint 429 519 8.8613 11.0766 16.6149 17.0595 Constraint 122 519 10.2606 12.8258 19.2386 16.9576 Constraint 104 519 12.6142 15.7677 23.6516 16.9576 Constraint 96 519 9.7254 12.1568 18.2352 16.9576 Constraint 88 519 8.0895 10.1118 15.1677 16.9576 Constraint 297 435 11.6724 14.5905 21.8858 16.9198 Constraint 122 355 12.5419 15.6774 23.5161 16.9038 Constraint 128 355 13.1853 16.4816 24.7224 16.8924 Constraint 201 399 12.9673 16.2091 24.3136 16.8560 Constraint 292 511 13.1051 16.3813 24.5720 16.7790 Constraint 303 435 10.7907 13.4884 20.2325 16.6712 Constraint 221 375 13.0898 16.3623 24.5435 16.6278 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 350 511 10.9588 13.6986 20.5478 16.4619 Constraint 399 519 8.9708 11.2135 16.8203 16.4480 Constraint 272 435 13.0358 16.2948 24.4421 16.3702 Constraint 176 391 12.9298 16.1623 24.2434 16.3478 Constraint 201 360 12.7434 15.9292 23.8939 16.3218 Constraint 399 527 8.1919 10.2399 15.3599 16.1833 Constraint 113 511 11.1552 13.9440 20.9160 16.1700 Constraint 80 519 10.9430 13.6788 20.5182 16.1480 Constraint 404 519 11.1843 13.9804 20.9706 16.0432 Constraint 552 629 12.5554 15.6943 23.5414 16.0422 Constraint 557 629 11.4423 14.3029 21.4544 16.0403 Constraint 267 375 12.7085 15.8856 23.8285 15.9884 Constraint 429 604 8.2338 10.2923 15.4384 15.9828 Constraint 577 644 12.2712 15.3390 23.0086 15.9299 Constraint 113 226 12.3935 15.4918 23.2377 15.8103 Constraint 435 527 10.5512 13.1890 19.7835 15.7785 Constraint 429 527 7.8000 9.7499 14.6249 15.7785 Constraint 421 527 8.1705 10.2131 15.3196 15.7785 Constraint 113 519 11.3309 14.1636 21.2454 15.7432 Constraint 590 668 12.8755 16.0944 24.1416 15.7182 Constraint 314 629 11.9118 14.8897 22.3346 15.6922 Constraint 314 622 12.4714 15.5892 23.3839 15.6922 Constraint 442 527 10.3979 12.9974 19.4961 15.4431 Constraint 314 604 9.5524 11.9404 17.9107 15.0970 Constraint 330 412 12.1761 15.2201 22.8301 15.0861 Constraint 144 480 12.2179 15.2724 22.9086 15.0822 Constraint 435 519 12.0912 15.1140 22.6710 15.0577 Constraint 341 429 10.5420 13.1775 19.7662 15.0058 Constraint 113 527 9.8762 12.3452 18.5178 14.9576 Constraint 314 599 9.6142 12.0177 18.0266 14.9297 Constraint 113 350 11.6425 14.5531 21.8297 14.8988 Constraint 449 535 10.9344 13.6680 20.5020 14.8266 Constraint 190 350 13.3786 16.7232 25.0849 14.5730 Constraint 201 330 13.0290 16.2863 24.4294 14.5133 Constraint 429 535 9.4476 11.8095 17.7143 14.4620 Constraint 421 535 9.3680 11.7101 17.5651 14.4620 Constraint 404 622 10.2180 12.7725 19.1587 14.3782 Constraint 382 489 12.5151 15.6439 23.4658 14.3552 Constraint 449 527 7.9650 9.9562 14.9343 14.1450 Constraint 571 636 12.1017 15.1271 22.6907 14.0630 Constraint 599 676 11.9622 14.9528 22.4291 14.0613 Constraint 404 527 9.9907 12.4884 18.7326 14.0596 Constraint 297 375 12.1381 15.1726 22.7589 14.0394 Constraint 412 629 10.7439 13.4298 20.1447 13.9951 Constraint 391 527 9.9207 12.4009 18.6014 13.9929 Constraint 421 629 9.7460 12.1825 18.2738 13.9829 Constraint 421 622 10.3700 12.9625 19.4437 13.9829 Constraint 104 480 12.5499 15.6874 23.5311 13.9784 Constraint 169 527 12.3848 15.4810 23.2214 13.9577 Constraint 128 527 10.4604 13.0755 19.6133 13.9577 Constraint 122 527 8.1216 10.1520 15.2280 13.9577 Constraint 96 527 7.5870 9.4838 14.2257 13.9577 Constraint 88 527 7.0190 8.7738 13.1607 13.9577 Constraint 201 404 13.1010 16.3763 24.5645 13.9441 Constraint 322 599 9.9047 12.3809 18.5714 13.9297 Constraint 391 622 11.9794 14.9742 22.4614 13.9252 Constraint 272 355 12.0939 15.1174 22.6761 13.8357 Constraint 461 535 9.7397 12.1747 18.2620 13.8285 Constraint 292 489 11.7988 14.7485 22.1227 13.7787 Constraint 404 629 9.8294 12.2868 18.4302 13.7400 Constraint 360 604 10.9476 13.6845 20.5268 13.6278 Constraint 404 613 9.9887 12.4859 18.7288 13.6074 Constraint 585 668 13.1132 16.3915 24.5872 13.5262 Constraint 350 461 12.7836 15.9796 23.9693 13.4601 Constraint 429 629 9.2582 11.5727 17.3590 13.4221 Constraint 421 613 10.5291 13.1614 19.7420 13.4099 Constraint 412 622 10.9462 13.6828 20.5241 13.4099 Constraint 404 604 8.8915 11.1144 16.6715 13.4067 Constraint 429 622 9.5217 11.9021 17.8532 13.3936 Constraint 429 613 8.6856 10.8570 16.2855 13.3936 Constraint 285 473 12.5622 15.7028 23.5541 13.3698 Constraint 161 429 13.2071 16.5089 24.7633 13.3499 Constraint 226 368 12.9253 16.1566 24.2349 13.3218 Constraint 113 190 12.2001 15.2501 22.8752 13.2938 Constraint 391 535 9.8979 12.3724 18.5586 13.2832 Constraint 80 221 12.8116 16.0145 24.0218 13.2567 Constraint 210 535 12.6666 15.8332 23.7498 13.2141 Constraint 144 226 11.9524 14.9405 22.4107 13.2013 Constraint 122 341 12.2229 15.2787 22.9180 13.1784 Constraint 128 511 12.2850 15.3563 23.0345 13.1700 Constraint 544 613 12.3220 15.4025 23.1037 13.1345 Constraint 314 590 11.0100 13.7625 20.6437 13.1323 Constraint 399 613 10.1586 12.6983 19.0474 12.9958 Constraint 412 604 10.2213 12.7767 19.1650 12.9951 Constraint 421 604 8.2633 10.3291 15.4937 12.9829 Constraint 613 687 12.0126 15.0157 22.5236 12.9380 Constraint 391 613 12.3930 15.4913 23.2369 12.9252 Constraint 104 544 12.7601 15.9501 23.9251 12.8093 Constraint 303 599 11.7915 14.7394 22.1091 12.7153 Constraint 242 629 10.5470 13.1838 19.7757 12.7083 Constraint 104 435 12.0770 15.0962 22.6443 12.6904 Constraint 360 527 8.0346 10.0432 15.0649 12.6242 Constraint 322 527 8.6280 10.7850 16.1775 12.6242 Constraint 314 527 8.5478 10.6848 16.0272 12.6242 Constraint 210 527 10.6486 13.3108 19.9661 12.6242 Constraint 104 527 9.8768 12.3460 18.5189 12.6242 Constraint 242 599 9.0633 11.3292 16.9937 12.6125 Constraint 391 604 10.6432 13.3040 19.9559 12.6042 Constraint 421 599 8.0975 10.1219 15.1828 12.5790 Constraint 622 698 11.9334 14.9168 22.3751 12.5471 Constraint 480 599 9.5133 11.8916 17.8374 12.5008 Constraint 297 382 12.0542 15.0678 22.6017 12.4930 Constraint 461 604 9.9408 12.4260 18.6389 12.4600 Constraint 272 382 13.2165 16.5206 24.7809 12.3722 Constraint 412 535 10.9853 13.7316 20.5974 12.3688 Constraint 473 629 8.4392 10.5490 15.8235 12.3648 Constraint 303 577 10.1209 12.6511 18.9766 12.3419 Constraint 341 449 12.1473 15.1842 22.7763 12.3274 Constraint 577 657 10.9178 13.6472 20.4708 12.2139 Constraint 113 391 12.1821 15.2276 22.8414 12.2018 Constraint 429 585 10.3639 12.9548 19.4322 12.0940 Constraint 557 636 12.4610 15.5763 23.3644 12.0822 Constraint 190 429 13.1635 16.4543 24.6815 12.0402 Constraint 442 535 12.0263 15.0329 22.5493 12.0334 Constraint 399 604 8.5347 10.6684 16.0026 12.0244 Constraint 435 629 10.3485 12.9356 19.4034 12.0105 Constraint 480 622 10.5285 13.1606 19.7409 11.9805 Constraint 136 350 12.5732 15.7165 23.5748 11.9776 Constraint 360 535 7.8607 9.8259 14.7389 11.9497 Constraint 604 687 10.8971 13.6214 20.4321 11.9380 Constraint 382 604 11.5134 14.3918 21.5876 11.9374 Constraint 375 604 10.3701 12.9626 19.4439 11.9374 Constraint 368 604 11.8619 14.8273 22.2410 11.9374 Constraint 292 599 9.9002 12.3753 18.5629 11.9336 Constraint 399 622 10.2993 12.8741 19.3111 11.9243 Constraint 467 585 9.3127 11.6409 17.4613 11.8870 Constraint 461 585 10.3285 12.9106 19.3659 11.8870 Constraint 279 429 11.7853 14.7317 22.0975 11.8217 Constraint 80 527 9.4109 11.7636 17.6454 11.8146 Constraint 368 489 12.5044 15.6305 23.4457 11.7842 Constraint 391 599 8.8488 11.0611 16.5916 11.7732 Constraint 341 577 10.3349 12.9186 19.3779 11.7007 Constraint 350 480 12.2038 15.2548 22.8821 11.6725 Constraint 399 535 6.9366 8.6708 13.0061 11.6276 Constraint 242 604 9.6515 12.0644 18.0966 11.5952 Constraint 480 629 8.9723 11.2154 16.8231 11.5757 Constraint 104 552 11.8974 14.8718 22.3077 11.4759 Constraint 237 375 12.4457 15.5571 23.3357 11.4752 Constraint 404 599 7.7848 9.7310 14.5966 11.4298 Constraint 404 590 9.2115 11.5144 17.2717 11.4298 Constraint 435 622 10.5055 13.1318 19.6978 11.4253 Constraint 467 622 11.1944 13.9930 20.9896 11.3667 Constraint 467 613 10.3868 12.9835 19.4752 11.3667 Constraint 473 604 7.2151 9.0188 13.5282 11.3648 Constraint 297 577 10.6355 13.2944 19.9415 11.3256 Constraint 279 577 11.2858 14.1073 21.1609 11.3256 Constraint 435 535 11.2259 14.0324 21.0486 11.2228 Constraint 404 535 9.4640 11.8300 17.7449 11.2228 Constraint 629 706 11.0510 13.8137 20.7206 11.1424 Constraint 604 698 11.2760 14.0950 21.1424 11.1423 Constraint 535 604 11.5048 14.3810 21.5714 11.1285 Constraint 128 519 12.4574 15.5718 23.3577 11.1209 Constraint 88 535 9.7790 12.2238 18.3357 11.1209 Constraint 314 519 10.1627 12.7034 19.0552 11.1209 Constraint 322 604 7.5479 9.4349 14.1524 11.1067 Constraint 292 604 9.0604 11.3255 16.9882 11.1067 Constraint 599 687 10.6280 13.2851 19.9276 11.1032 Constraint 341 604 11.4118 14.2648 21.3972 11.0384 Constraint 391 590 10.1335 12.6669 19.0003 11.0321 Constraint 382 590 10.7665 13.4581 20.1871 11.0321 Constraint 442 629 9.8760 12.3450 18.5175 11.0105 Constraint 122 375 12.6902 15.8628 23.7942 10.9919 Constraint 153 527 11.2522 14.0653 21.0979 10.9579 Constraint 375 527 9.9622 12.4527 18.6791 10.9577 Constraint 375 519 10.7087 13.3859 20.0789 10.9577 Constraint 360 519 9.7186 12.1483 18.2224 10.9577 Constraint 104 368 12.6570 15.8213 23.7319 10.9038 Constraint 250 355 12.4736 15.5920 23.3880 10.8954 Constraint 473 585 8.4286 10.5357 15.8036 10.8707 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 122 279 13.2197 16.5246 24.7869 10.8052 Constraint 113 259 11.3914 14.2393 21.3589 10.8052 Constraint 88 272 11.3381 14.1726 21.2590 10.8052 Constraint 88 267 11.1444 13.9306 20.8958 10.8052 Constraint 88 250 8.5176 10.6469 15.9704 10.8052 Constraint 88 226 10.1294 12.6618 18.9927 10.8052 Constraint 88 190 11.8183 14.7729 22.1594 10.8052 Constraint 375 535 8.2071 10.2589 15.3883 10.8038 Constraint 368 535 9.0647 11.3308 16.9962 10.8038 Constraint 355 535 8.1668 10.2085 15.3127 10.8038 Constraint 350 535 9.9144 12.3929 18.5894 10.8038 Constraint 350 519 11.4708 14.3386 21.5078 10.8037 Constraint 104 404 11.9655 14.9569 22.4353 10.7957 Constraint 467 629 9.3474 11.6843 17.5264 10.7938 Constraint 467 599 8.9105 11.1381 16.7071 10.7937 Constraint 461 599 9.4613 11.8266 17.7398 10.7937 Constraint 473 599 7.6739 9.5923 14.3885 10.7919 Constraint 176 461 13.0710 16.3387 24.5081 10.7348 Constraint 341 585 11.4938 14.3672 21.5508 10.6843 Constraint 210 604 7.1220 8.9025 13.3537 10.5869 Constraint 201 604 9.4531 11.8164 17.7246 10.5869 Constraint 480 590 9.5787 11.9734 17.9600 10.4864 Constraint 226 461 13.0939 16.3674 24.5511 10.4711 Constraint 297 461 11.7224 14.6530 21.9795 10.4698 Constraint 429 599 7.0253 8.7816 13.1724 10.4452 Constraint 421 590 9.7208 12.1511 18.2266 10.4452 Constraint 412 599 8.3951 10.4939 15.7409 10.4452 Constraint 435 604 9.6678 12.0848 18.1272 10.4375 Constraint 80 242 10.3689 12.9612 19.4417 10.4201 Constraint 467 604 7.5563 9.4454 14.1680 10.3667 Constraint 473 622 9.0539 11.3174 16.9761 10.3649 Constraint 182 404 11.5066 14.3832 21.5748 10.3568 Constraint 322 480 12.0909 15.1136 22.6705 10.3565 Constraint 88 382 11.9345 14.9181 22.3772 10.3064 Constraint 122 267 12.2339 15.2924 22.9385 10.2095 Constraint 136 341 10.8651 13.5814 20.3721 10.1972 Constraint 360 599 8.4740 10.5925 15.8887 10.0901 Constraint 480 585 7.2784 9.0980 13.6470 10.0816 Constraint 399 599 7.1324 8.9155 13.3732 10.0475 Constraint 375 590 9.1344 11.4180 17.1270 10.0157 Constraint 442 604 9.4635 11.8294 17.7441 10.0105 Constraint 480 604 6.5663 8.2078 12.3118 9.9825 Constraint 80 552 11.9155 14.8943 22.3415 9.9778 Constraint 480 613 8.4109 10.5136 15.7703 9.9661 Constraint 382 599 9.3709 11.7136 17.5704 9.9605 Constraint 368 599 9.2209 11.5262 17.2892 9.9605 Constraint 368 590 10.2515 12.8144 19.2216 9.9605 Constraint 382 613 12.4861 15.6077 23.4115 9.9483 Constraint 412 527 9.1041 11.3801 17.0702 9.9417 Constraint 136 360 12.7742 15.9677 23.9515 9.9332 Constraint 375 613 10.2486 12.8107 19.2161 9.9320 Constraint 360 613 11.7280 14.6599 21.9899 9.9320 Constraint 303 604 10.9403 13.6754 20.5131 9.9310 Constraint 210 622 8.3573 10.4466 15.6699 9.9202 Constraint 182 604 8.8883 11.1104 16.6656 9.9202 Constraint 314 613 10.6129 13.2661 19.8992 9.9147 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 449 585 12.2208 15.2760 22.9141 9.8749 Constraint 341 511 12.2127 15.2659 22.8989 9.8725 Constraint 571 651 13.0875 16.3594 24.5391 9.8672 Constraint 136 399 12.2596 15.3245 22.9867 9.8608 Constraint 69 497 5.1329 6.4161 9.6242 9.8353 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 467 10.9775 13.7219 20.5829 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 449 9.2700 11.5876 17.3813 9.8353 Constraint 69 442 11.6979 14.6224 21.9336 9.8353 Constraint 69 435 12.4538 15.5673 23.3509 9.8353 Constraint 69 169 13.0591 16.3239 24.4859 9.8353 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 69 144 12.3422 15.4278 23.1417 9.8353 Constraint 69 136 11.9365 14.9207 22.3810 9.8353 Constraint 467 590 9.9819 12.4773 18.7160 9.7938 Constraint 461 629 10.3233 12.9041 19.3561 9.7938 Constraint 113 250 12.0930 15.1163 22.6744 9.7889 Constraint 322 535 10.2675 12.8344 19.2515 9.7875 Constraint 314 535 8.6973 10.8716 16.3074 9.7875 Constraint 292 535 11.5213 14.4016 21.6025 9.7875 Constraint 96 535 9.4754 11.8443 17.7664 9.7875 Constraint 449 599 10.1028 12.6285 18.9427 9.7816 Constraint 322 629 10.0994 12.6242 18.9363 9.7057 Constraint 292 629 10.1011 12.6264 18.9396 9.7057 Constraint 322 622 11.5892 14.4865 21.7297 9.6935 Constraint 322 613 10.2262 12.7828 19.1742 9.6935 Constraint 88 599 10.8563 13.5704 20.3556 9.6548 Constraint 644 720 11.8615 14.8268 22.2403 9.6273 Constraint 113 285 12.8059 16.0074 24.0110 9.6138 Constraint 88 279 12.0256 15.0320 22.5480 9.6138 Constraint 314 585 10.8246 13.5307 20.2961 9.6103 Constraint 442 519 11.3932 14.2415 21.3622 9.6064 Constraint 237 604 8.8217 11.0272 16.5408 9.5991 Constraint 330 535 12.0328 15.0410 22.5615 9.5894 Constraint 355 519 8.7953 10.9941 16.4912 9.5893 Constraint 544 622 11.9939 14.9924 22.4885 9.5778 Constraint 330 577 10.4785 13.0981 19.6471 9.5384 Constraint 391 629 10.7737 13.4671 20.2006 9.5335 Constraint 341 599 12.1474 15.1842 22.7764 9.5219 Constraint 190 604 11.1065 13.8831 20.8247 9.5154 Constraint 176 604 9.4772 11.8465 17.7697 9.5154 Constraint 303 461 12.6619 15.8274 23.7411 9.4534 Constraint 404 585 10.2766 12.8458 19.2687 9.4452 Constraint 429 636 10.6506 13.3133 19.9700 9.4289 Constraint 429 590 8.1800 10.2249 15.3374 9.4289 Constraint 144 577 11.2389 14.0487 21.0730 9.4238 Constraint 391 519 10.9936 13.7421 20.6131 9.4190 Constraint 144 527 9.5083 11.8854 17.8281 9.3846 Constraint 360 590 9.5081 11.8851 17.8276 9.3490 Constraint 473 613 8.5240 10.6550 15.9826 9.3486 Constraint 489 599 10.5323 13.1653 19.7480 9.3187 Constraint 599 698 11.1823 13.9778 20.9667 9.3075 Constraint 144 399 12.3870 15.4838 23.2256 9.2900 Constraint 449 552 11.7979 14.7474 22.1210 9.2555 Constraint 412 519 11.5519 14.4399 21.6599 9.2209 Constraint 303 473 12.3234 15.4043 23.1065 9.1590 Constraint 322 590 10.6696 13.3370 20.0055 9.1298 Constraint 285 599 11.1261 13.9076 20.8614 9.1298 Constraint 210 629 7.1939 8.9923 13.4885 9.1105 Constraint 473 552 10.5132 13.1415 19.7123 9.0469 Constraint 449 577 11.3366 14.1708 21.2562 9.0407 Constraint 399 590 8.0835 10.1044 15.1565 9.0311 Constraint 153 285 12.8621 16.0777 24.1165 8.9804 Constraint 169 350 11.6990 14.6237 21.9356 8.9776 Constraint 399 629 8.8397 11.0496 16.5744 8.9759 Constraint 341 535 11.2297 14.0372 21.0558 8.9497 Constraint 375 599 7.8706 9.8383 14.7574 8.9442 Constraint 330 604 10.0545 12.5682 18.8522 8.9147 Constraint 629 720 11.7344 14.6680 22.0020 8.9027 Constraint 629 713 10.9956 13.7445 20.6167 8.9027 Constraint 303 489 12.4041 15.5051 23.2577 8.8807 Constraint 297 489 11.7847 14.7309 22.0964 8.8807 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 88 604 10.2446 12.8058 19.2087 8.8452 Constraint 421 585 10.9619 13.7024 20.5535 8.7606 Constraint 429 552 11.3633 14.2042 21.3062 8.7430 Constraint 80 375 11.9778 14.9723 22.4584 8.7270 Constraint 190 622 11.5982 14.4977 21.7465 8.7160 Constraint 182 622 11.4161 14.2701 21.4052 8.7160 Constraint 176 622 10.8960 13.6200 20.4301 8.7160 Constraint 176 613 12.2038 15.2548 22.8822 8.7160 Constraint 297 604 9.5709 11.9636 17.9454 8.7057 Constraint 182 629 9.3341 11.6676 17.5015 8.7057 Constraint 176 629 8.6640 10.8300 16.2450 8.7057 Constraint 350 489 11.9917 14.9896 22.4845 8.6855 Constraint 391 585 10.8900 13.6125 20.4188 8.6426 Constraint 375 585 10.0254 12.5317 18.7976 8.6426 Constraint 368 585 11.3496 14.1870 21.2805 8.6426 Constraint 122 535 9.9039 12.3799 18.5698 8.6411 Constraint 113 535 10.7988 13.4985 20.2477 8.6411 Constraint 210 599 6.7138 8.3922 12.5883 8.6100 Constraint 201 599 8.8273 11.0341 16.5512 8.6100 Constraint 480 636 8.5474 10.6842 16.0263 8.5633 Constraint 350 467 12.8863 16.1079 24.1618 8.5600 Constraint 350 435 12.4507 15.5633 23.3450 8.5600 Constraint 237 350 13.1168 16.3960 24.5940 8.5600 Constraint 442 599 10.0061 12.5076 18.7614 8.4606 Constraint 435 599 9.5751 11.9689 17.9533 8.4606 Constraint 341 552 10.8863 13.6079 20.4118 8.3836 Constraint 497 604 10.2062 12.7577 19.1366 8.3821 Constraint 449 629 10.5378 13.1722 19.7584 8.3668 Constraint 449 604 10.1550 12.6938 19.0407 8.3546 Constraint 473 636 8.9565 11.1956 16.7934 8.3505 Constraint 467 552 10.6438 13.3048 19.9572 8.2391 Constraint 144 552 10.5911 13.2389 19.8584 8.2363 Constraint 552 636 13.0096 16.2620 24.3930 8.2065 Constraint 144 519 11.4747 14.3434 21.5151 8.1702 Constraint 242 622 8.2205 10.2756 15.4134 8.1330 Constraint 242 613 9.2213 11.5266 17.2899 8.1330 Constraint 237 622 5.5461 6.9326 10.3989 8.1330 Constraint 237 613 8.2910 10.3637 15.5456 8.1330 Constraint 221 622 10.4835 13.1044 19.6566 8.1330 Constraint 221 604 9.4406 11.8007 17.7011 8.1330 Constraint 210 613 8.0836 10.1045 15.1567 8.1330 Constraint 201 622 7.8336 9.7921 14.6881 8.1330 Constraint 577 668 13.2242 16.5302 24.7953 8.1287 Constraint 237 629 6.9197 8.6496 12.9744 8.1227 Constraint 382 527 10.1399 12.6749 19.0124 8.1209 Constraint 382 519 12.2147 15.2684 22.9026 8.1209 Constraint 368 519 11.6604 14.5755 21.8632 8.1209 Constraint 322 519 9.9635 12.4543 18.6815 8.1209 Constraint 242 535 10.3394 12.9242 19.3863 8.1209 Constraint 242 527 9.1051 11.3814 17.0721 8.1209 Constraint 242 519 11.6734 14.5918 21.8877 8.1209 Constraint 237 527 11.9324 14.9155 22.3732 8.1209 Constraint 210 519 11.9483 14.9353 22.4030 8.1209 Constraint 144 585 11.4481 14.3101 21.4651 8.0906 Constraint 113 412 12.2592 15.3240 22.9860 8.0772 Constraint 489 571 11.2271 14.0339 21.0508 8.0631 Constraint 527 599 9.8904 12.3630 18.5445 8.0082 Constraint 153 360 12.8706 16.0883 24.1324 7.9920 Constraint 80 368 13.1673 16.4591 24.6886 7.9920 Constraint 480 657 10.4689 13.0862 19.6293 7.9884 Constraint 355 585 12.1722 15.2152 22.8229 7.9759 Constraint 651 729 11.8542 14.8177 22.2266 7.9740 Constraint 535 613 11.7761 14.7201 22.0802 7.9663 Constraint 297 599 10.3996 12.9994 19.4992 7.9432 Constraint 221 599 8.7764 10.9705 16.4557 7.9432 Constraint 182 599 8.6422 10.8027 16.2041 7.9432 Constraint 176 599 9.4077 11.7596 17.6394 7.9432 Constraint 297 613 12.8784 16.0980 24.1469 7.9064 Constraint 182 613 11.6303 14.5379 21.8068 7.9064 Constraint 604 706 12.2199 15.2749 22.9123 7.9046 Constraint 128 368 12.6918 15.8648 23.7972 7.9038 Constraint 122 368 12.0339 15.0423 22.5635 7.9038 Constraint 467 577 8.9345 11.1681 16.7521 7.8967 Constraint 461 577 9.1250 11.4063 17.1094 7.8967 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 657 735 10.6937 13.3671 20.0506 7.8108 Constraint 355 467 13.2631 16.5789 24.8683 7.8098 Constraint 382 535 9.4686 11.8358 17.7537 7.8038 Constraint 368 527 9.1837 11.4796 17.2195 7.8038 Constraint 355 527 7.2573 9.0717 13.6075 7.8038 Constraint 350 527 8.2521 10.3151 15.4726 7.8038 Constraint 279 404 10.9759 13.7199 20.5798 7.7994 Constraint 461 622 11.1628 13.9535 20.9302 7.7939 Constraint 461 613 10.9681 13.7102 20.5652 7.7939 Constraint 461 590 10.5040 13.1300 19.6950 7.7939 Constraint 473 651 10.5814 13.2268 19.8402 7.7756 Constraint 473 644 10.3382 12.9228 19.3842 7.7756 Constraint 429 544 11.5458 14.4323 21.6484 7.7430 Constraint 292 622 10.7554 13.4443 20.1664 7.7282 Constraint 259 622 11.0070 13.7588 20.6382 7.7282 Constraint 250 622 10.3527 12.9409 19.4114 7.7282 Constraint 226 622 9.0967 11.3709 17.0564 7.7282 Constraint 226 613 11.8197 14.7747 22.1620 7.7282 Constraint 221 613 11.6133 14.5166 21.7749 7.7282 Constraint 201 613 9.8964 12.3705 18.5558 7.7282 Constraint 190 613 13.1999 16.4998 24.7497 7.7282 Constraint 322 636 10.9063 13.6329 20.4494 7.7211 Constraint 201 629 6.3820 7.9775 11.9662 7.7179 Constraint 297 544 11.9613 14.9516 22.4274 7.6663 Constraint 297 535 12.9470 16.1837 24.2756 7.6663 Constraint 182 544 12.2185 15.2731 22.9097 7.6663 Constraint 399 585 8.6944 10.8680 16.3020 7.6580 Constraint 88 590 12.5157 15.6446 23.4669 7.6538 Constraint 128 535 10.6300 13.2875 19.9312 7.6411 Constraint 169 604 8.1601 10.2001 15.3001 7.6331 Constraint 360 585 9.5800 11.9750 17.9625 7.6263 Constraint 237 599 6.7417 8.4272 12.6408 7.6222 Constraint 113 404 11.9548 14.9435 22.4152 7.5856 Constraint 303 552 10.3788 12.9735 19.4602 7.5740 Constraint 279 552 11.9216 14.9020 22.3530 7.5740 Constraint 571 657 11.9957 14.9946 22.4920 7.5692 Constraint 182 590 12.1606 15.2007 22.8011 7.5384 Constraint 176 590 12.8367 16.0459 24.0689 7.5384 Constraint 429 644 12.9091 16.1364 24.2046 7.4443 Constraint 153 535 10.6778 13.3473 20.0209 7.4267 Constraint 144 544 11.0208 13.7760 20.6641 7.4267 Constraint 144 535 9.3839 11.7299 17.5948 7.4267 Constraint 322 585 9.1581 11.4476 17.1715 7.4071 Constraint 221 473 12.3424 15.4280 23.1420 7.3718 Constraint 322 552 12.1933 15.2416 22.8624 7.3673 Constraint 297 552 11.3637 14.2046 21.3069 7.3673 Constraint 182 552 12.5357 15.6697 23.5045 7.3673 Constraint 322 467 11.3310 14.1637 21.2456 7.3602 Constraint 489 590 11.7680 14.7100 22.0650 7.3207 Constraint 330 461 11.5586 14.4483 21.6724 7.2919 Constraint 467 544 10.0366 12.5457 18.8186 7.2555 Constraint 489 577 10.1601 12.7001 19.0501 7.2535 Constraint 88 585 10.2695 12.8368 19.2553 7.2490 Constraint 442 577 10.9793 13.7241 20.5862 7.2475 Constraint 636 720 12.8155 16.0194 24.0290 7.2378 Constraint 636 713 11.9933 14.9916 22.4875 7.2378 Constraint 136 552 12.7724 15.9655 23.9482 7.2363 Constraint 210 585 11.0936 13.8670 20.8005 7.2289 Constraint 355 599 9.2812 11.6015 17.4023 7.1526 Constraint 651 735 12.2894 15.3618 23.0426 7.1441 Constraint 210 636 9.8083 12.2604 18.3906 7.1381 Constraint 435 577 10.6539 13.3174 19.9761 7.1350 Constraint 360 644 12.5741 15.7176 23.5764 7.1209 Constraint 242 480 12.2389 15.2986 22.9479 7.1105 Constraint 480 577 8.9402 11.1753 16.7629 7.1057 Constraint 461 552 9.4034 11.7542 17.6313 7.0932 Constraint 489 604 9.2741 11.5927 17.3890 7.0840 Constraint 497 613 10.6191 13.2739 19.9109 7.0822 Constraint 136 527 10.8612 13.5765 20.3648 7.0512 Constraint 480 571 9.6566 12.0708 18.1062 7.0449 Constraint 80 259 11.1884 13.9854 20.9782 7.0153 Constraint 80 250 12.0620 15.0775 22.6162 7.0153 Constraint 80 237 11.0143 13.7679 20.6519 7.0153 Constraint 421 636 11.9034 14.8792 22.3188 7.0115 Constraint 442 622 7.2932 9.1165 13.6748 7.0079 Constraint 442 613 8.6592 10.8240 16.2360 7.0079 Constraint 96 599 10.3859 12.9824 19.4735 6.9919 Constraint 467 636 9.4404 11.8005 17.7008 6.9903 Constraint 489 622 11.0831 13.8538 20.7808 6.9889 Constraint 412 636 13.0977 16.3721 24.5581 6.9750 Constraint 330 511 13.3693 16.7116 25.0675 6.9745 Constraint 169 622 9.2775 11.5969 17.3953 6.9663 Constraint 210 590 9.3655 11.7069 17.5604 6.9554 Constraint 279 449 12.4731 15.5913 23.3870 6.9547 Constraint 330 599 11.5256 14.4071 21.6106 6.9378 Constraint 314 636 12.7145 15.8932 23.8397 6.9340 Constraint 122 577 9.7624 12.2030 18.3046 6.9264 Constraint 113 577 10.6878 13.3598 20.0396 6.9264 Constraint 330 613 12.9816 16.2271 24.3406 6.9186 Constraint 297 629 11.2867 14.1084 21.1627 6.9186 Constraint 292 613 10.1483 12.6854 19.0281 6.9186 Constraint 285 629 12.2441 15.3051 22.9577 6.9186 Constraint 285 613 12.7572 15.9464 23.9197 6.9186 Constraint 285 604 10.0148 12.5184 18.7777 6.9186 Constraint 279 604 11.9374 14.9217 22.3826 6.9186 Constraint 272 629 10.5541 13.1926 19.7889 6.9186 Constraint 272 604 10.2624 12.8280 19.2419 6.9186 Constraint 267 629 12.8427 16.0534 24.0802 6.9186 Constraint 259 629 10.6497 13.3121 19.9681 6.9186 Constraint 259 613 11.4374 14.2967 21.4451 6.9186 Constraint 250 613 11.9757 14.9697 22.4545 6.9186 Constraint 221 629 8.9446 11.1808 16.7712 6.9186 Constraint 190 629 8.8907 11.1133 16.6700 6.9186 Constraint 292 467 11.7018 14.6273 21.9409 6.9031 Constraint 473 577 8.4748 10.5936 15.8903 6.8967 Constraint 421 552 10.9939 13.7423 20.6135 6.8890 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 435 585 11.4636 14.3295 21.4943 6.8036 Constraint 182 467 11.8010 14.7512 22.1269 6.7922 Constraint 341 527 8.9465 11.1831 16.7747 6.7875 Constraint 341 519 10.6890 13.3612 20.0418 6.7875 Constraint 341 489 11.9272 14.9090 22.3635 6.7875 Constraint 330 527 9.1345 11.4181 17.1272 6.7875 Constraint 330 489 10.9966 13.7458 20.6187 6.7875 Constraint 303 527 9.4890 11.8612 17.7918 6.7875 Constraint 303 519 11.9943 14.9929 22.4893 6.7875 Constraint 297 527 9.9482 12.4353 18.6530 6.7875 Constraint 297 519 13.0113 16.2641 24.3961 6.7875 Constraint 292 527 7.8984 9.8730 14.8095 6.7875 Constraint 292 519 11.4957 14.3696 21.5544 6.7875 Constraint 285 527 10.0309 12.5387 18.8080 6.7875 Constraint 272 527 12.5725 15.7157 23.5735 6.7875 Constraint 267 527 12.8076 16.0095 24.0142 6.7875 Constraint 259 535 10.9586 13.6982 20.5474 6.7875 Constraint 259 527 9.4405 11.8006 17.7010 6.7875 Constraint 250 535 12.6318 15.7897 23.6846 6.7875 Constraint 250 527 12.0037 15.0046 22.5069 6.7875 Constraint 226 527 12.7838 15.9797 23.9695 6.7875 Constraint 221 535 12.7837 15.9797 23.9695 6.7875 Constraint 221 527 9.9513 12.4391 18.6587 6.7875 Constraint 201 527 13.0146 16.2683 24.4024 6.7875 Constraint 182 527 11.1923 13.9903 20.9855 6.7875 Constraint 473 590 6.7083 8.3854 12.5781 6.7775 Constraint 461 636 11.6594 14.5742 21.8614 6.7775 Constraint 429 651 11.9034 14.8793 22.3189 6.7775 Constraint 314 577 7.2042 9.0052 13.5078 6.7525 Constraint 226 604 10.1803 12.7254 19.0881 6.7404 Constraint 297 585 12.0699 15.0874 22.6311 6.7403 Constraint 292 585 11.4429 14.3036 21.4554 6.7403 Constraint 322 651 11.1283 13.9103 20.8655 6.7365 Constraint 297 590 12.7287 15.9108 23.8662 6.7288 Constraint 341 442 11.5517 14.4397 21.6595 6.6727 Constraint 113 599 11.0690 13.8363 20.7545 6.6644 Constraint 169 599 8.7472 10.9340 16.4010 6.6408 Constraint 412 613 9.1703 11.4629 17.1943 6.6324 Constraint 497 599 10.0075 12.5094 18.7641 6.6188 Constraint 330 544 11.3600 14.2000 21.3000 6.5894 Constraint 489 629 9.1735 11.4668 17.2003 6.5841 Constraint 421 577 9.6353 12.0441 18.0661 6.5829 Constraint 104 250 12.2422 15.3028 22.9541 6.5786 Constraint 644 729 12.5754 15.7192 23.5788 6.5711 Constraint 519 599 10.7400 13.4251 20.1376 6.5622 Constraint 322 577 7.2363 9.0453 13.5680 6.5622 Constraint 292 577 8.4433 10.5542 15.8313 6.5622 Constraint 242 577 9.5870 11.9837 17.9756 6.5622 Constraint 221 577 10.5515 13.1893 19.7840 6.5622 Constraint 210 577 8.7197 10.8996 16.3495 6.5622 Constraint 182 577 9.8538 12.3172 18.4758 6.5622 Constraint 169 613 9.8935 12.3669 18.5503 6.5615 Constraint 330 552 9.5099 11.8874 17.8310 6.5576 Constraint 535 622 10.9032 13.6289 20.4434 6.5559 Constraint 497 577 9.6883 12.1104 18.1655 6.5535 Constraint 360 629 9.4577 11.8221 17.7332 6.5511 Constraint 412 590 8.8280 11.0350 16.5525 6.4549 Constraint 297 473 10.5982 13.2478 19.8717 6.4513 Constraint 182 473 9.9456 12.4320 18.6479 6.4513 Constraint 429 577 8.9522 11.1902 16.7854 6.4369 Constraint 435 613 8.5212 10.6515 15.9772 6.4350 Constraint 341 544 13.0192 16.2739 24.4109 6.3827 Constraint 259 604 9.0278 11.2847 16.9271 6.3356 Constraint 104 535 10.0305 12.5381 18.8072 6.3076 Constraint 136 391 13.0289 16.2861 24.4292 6.2901 Constraint 122 382 11.9135 14.8919 22.3378 6.2901 Constraint 144 571 10.9867 13.7333 20.6000 6.2362 Constraint 169 590 11.8878 14.8597 22.2896 6.2359 Constraint 128 552 12.0212 15.0265 22.5398 6.2028 Constraint 144 259 12.7634 15.9542 23.9313 6.1990 Constraint 190 599 9.1083 11.3854 17.0780 6.1561 Constraint 355 604 11.9647 14.9559 22.4339 6.1526 Constraint 88 552 9.0975 11.3719 17.0578 6.1431 Constraint 122 552 9.7530 12.1913 18.2869 6.1430 Constraint 113 552 10.3192 12.8990 19.3485 6.1430 Constraint 391 651 11.6528 14.5660 21.8490 6.1363 Constraint 368 651 9.5549 11.9436 17.9154 6.1363 Constraint 368 644 11.7228 14.6536 21.9803 6.1363 Constraint 360 651 11.3627 14.2034 21.3050 6.1363 Constraint 527 604 10.4511 13.0639 19.5959 6.1352 Constraint 489 585 9.9037 12.3796 18.5694 6.1063 Constraint 144 604 10.3120 12.8899 19.3349 6.0687 Constraint 480 557 10.5618 13.2022 19.8033 6.0469 Constraint 473 571 10.8164 13.5205 20.2807 6.0469 Constraint 473 557 10.7444 13.4305 20.1458 6.0469 Constraint 69 279 13.0596 16.3245 24.4867 6.0150 Constraint 355 590 9.8167 12.2709 18.4063 6.0067 Constraint 153 330 13.3677 16.7096 25.0644 5.9942 Constraint 489 613 10.7447 13.4309 20.1464 5.9908 Constraint 404 636 9.4983 11.8729 17.8094 5.9904 Constraint 382 629 8.0709 10.0886 15.1329 5.9904 Constraint 382 622 9.2868 11.6085 17.4128 5.9904 Constraint 375 636 8.4615 10.5769 15.8654 5.9904 Constraint 375 629 5.0053 6.2566 9.3849 5.9904 Constraint 375 622 5.3508 6.6885 10.0328 5.9904 Constraint 368 629 8.6082 10.7602 16.1404 5.9904 Constraint 368 622 8.1084 10.1355 15.2032 5.9904 Constraint 368 613 11.2037 14.0046 21.0069 5.9904 Constraint 360 622 9.0011 11.2513 16.8770 5.9904 Constraint 480 644 10.4919 13.1149 19.6724 5.9884 Constraint 473 657 8.6288 10.7860 16.1791 5.9884 Constraint 169 341 12.1393 15.1742 22.7613 5.9828 Constraint 355 629 11.5554 14.4442 21.6663 5.9782 Constraint 250 341 12.7530 15.9412 23.9118 5.9527 Constraint 303 590 12.2908 15.3635 23.0453 5.9500 Constraint 292 636 11.4139 14.2674 21.4011 5.9340 Constraint 182 636 10.2565 12.8206 19.2309 5.9340 Constraint 176 636 9.6365 12.0456 18.0685 5.9340 Constraint 136 467 12.1617 15.2021 22.8031 5.9325 Constraint 267 604 11.7413 14.6766 22.0149 5.9308 Constraint 250 629 10.5993 13.2492 19.8738 5.9308 Constraint 250 604 10.6904 13.3630 20.0445 5.9308 Constraint 226 629 7.5958 9.4948 14.2422 5.9308 Constraint 136 577 10.2218 12.7773 19.1659 5.9264 Constraint 136 412 12.6509 15.8137 23.7205 5.8692 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 480 12.6846 15.8557 23.7836 5.8367 Constraint 58 473 12.4000 15.5000 23.2500 5.8367 Constraint 58 461 12.3920 15.4900 23.2350 5.8367 Constraint 58 449 11.9904 14.9880 22.4819 5.8367 Constraint 58 429 12.2980 15.3725 23.0587 5.8367 Constraint 58 421 11.1855 13.9819 20.9728 5.8367 Constraint 58 297 12.1503 15.1878 22.7817 5.8367 Constraint 58 210 13.3683 16.7104 25.0656 5.8367 Constraint 58 144 12.5389 15.6736 23.5104 5.8367 Constraint 58 136 11.9186 14.8983 22.3474 5.8367 Constraint 58 128 11.0615 13.8269 20.7403 5.8367 Constraint 169 629 7.3667 9.2083 13.8125 5.8357 Constraint 242 590 7.1438 8.9298 13.3946 5.8350 Constraint 237 590 7.5759 9.4699 14.2049 5.8350 Constraint 497 590 10.2965 12.8706 19.3059 5.8092 Constraint 435 590 10.8722 13.5903 20.3854 5.8037 Constraint 404 577 8.4977 10.6221 15.9332 5.7881 Constraint 182 382 12.7410 15.9263 23.8894 5.7828 Constraint 285 577 9.3801 11.7251 17.5877 5.7525 Constraint 259 577 9.6082 12.0102 18.0154 5.7525 Constraint 590 676 12.8372 16.0465 24.0697 5.7519 Constraint 272 599 9.4698 11.8372 17.7558 5.7513 Constraint 190 590 12.9235 16.1543 24.2315 5.7513 Constraint 421 544 10.8396 13.5495 20.3243 5.7411 Constraint 104 375 12.6715 15.8394 23.7591 5.7352 Constraint 279 375 11.1081 13.8851 20.8276 5.7122 Constraint 341 435 11.4275 14.2844 21.4266 5.6804 Constraint 136 604 9.1653 11.4567 17.1850 5.6645 Constraint 128 604 8.7007 10.8759 16.3138 5.6645 Constraint 122 604 8.7890 10.9862 16.4794 5.6645 Constraint 113 604 9.0652 11.3315 16.9972 5.6645 Constraint 104 604 8.9112 11.1389 16.7084 5.6645 Constraint 303 511 12.7872 15.9840 23.9760 5.6582 Constraint 435 651 13.3295 16.6618 24.9927 5.6571 Constraint 435 636 12.3627 15.4533 23.1800 5.6571 Constraint 399 544 12.1619 15.2023 22.8035 5.6498 Constraint 88 577 9.5641 11.9551 17.9326 5.5929 Constraint 636 729 13.3114 16.6392 24.9589 5.5730 Constraint 330 519 10.3375 12.9218 19.3827 5.5730 Constraint 303 544 12.4717 15.5897 23.3845 5.5730 Constraint 303 535 11.4345 14.2931 21.4396 5.5730 Constraint 285 535 11.1821 13.9776 20.9664 5.5730 Constraint 279 544 12.2520 15.3150 22.9725 5.5730 Constraint 279 527 12.7646 15.9558 23.9337 5.5730 Constraint 412 657 12.5054 15.6318 23.4477 5.5633 Constraint 399 657 10.5618 13.2022 19.8033 5.5633 Constraint 382 657 10.4582 13.0727 19.6091 5.5633 Constraint 375 657 8.1899 10.2374 15.3561 5.5633 Constraint 368 657 11.4627 14.3284 21.4925 5.5633 Constraint 176 585 12.0601 15.0751 22.6127 5.5538 Constraint 442 552 11.1960 13.9951 20.9926 5.5536 Constraint 144 599 10.7884 13.4854 20.2282 5.4060 Constraint 210 511 11.7535 14.6919 22.0378 5.3846 Constraint 449 613 9.6041 12.0052 18.0078 5.3643 Constraint 322 644 9.8755 12.3443 18.5165 5.3542 Constraint 201 636 8.7188 10.8985 16.3478 5.3510 Constraint 182 375 12.8574 16.0718 24.1077 5.3062 Constraint 144 391 12.7798 15.9747 23.9620 5.2920 Constraint 128 585 9.3195 11.6494 17.4740 5.2597 Constraint 122 585 9.7205 12.1507 18.2260 5.2597 Constraint 449 544 10.7465 13.4331 20.1496 5.2536 Constraint 153 571 11.6138 14.5172 21.7759 5.2363 Constraint 144 557 10.1828 12.7285 19.0927 5.2363 Constraint 613 698 12.5324 15.6656 23.4983 5.2358 Constraint 201 585 12.1342 15.1677 22.7516 5.2327 Constraint 88 629 10.7882 13.4853 20.2279 5.1881 Constraint 80 604 12.8246 16.0308 24.0461 5.1818 Constraint 80 599 12.1998 15.2497 22.8745 5.1818 Constraint 176 644 8.6263 10.7829 16.1743 5.1760 Constraint 169 657 11.2965 14.1206 21.1809 5.1689 Constraint 169 636 8.1773 10.2217 15.3325 5.1689 Constraint 259 599 7.1941 8.9927 13.4890 5.1683 Constraint 259 590 9.5860 11.9825 17.9738 5.1683 Constraint 250 599 7.7196 9.6494 14.4742 5.1683 Constraint 250 590 9.0578 11.3222 16.9833 5.1683 Constraint 226 599 7.1801 8.9751 13.4627 5.1683 Constraint 226 590 10.5378 13.1722 19.7583 5.1683 Constraint 221 590 10.3070 12.8837 19.3256 5.1683 Constraint 122 544 9.8603 12.3254 18.4880 5.1431 Constraint 113 544 10.9310 13.6637 20.4956 5.1431 Constraint 96 544 11.1642 13.9552 20.9329 5.1431 Constraint 88 544 8.8191 11.0239 16.5359 5.1431 Constraint 391 577 7.6385 9.5482 14.3222 5.1315 Constraint 360 577 8.7455 10.9319 16.3978 5.1315 Constraint 355 577 10.5520 13.1901 19.7851 5.1315 Constraint 467 571 11.3331 14.1664 21.2496 5.1095 Constraint 341 668 12.3669 15.4586 23.1879 5.1075 Constraint 657 742 11.4732 14.3415 21.5123 5.0954 Constraint 461 544 9.7102 12.1378 18.2067 5.0932 Constraint 136 535 11.0136 13.7670 20.6505 5.0932 Constraint 350 604 13.1787 16.4733 24.7100 5.0876 Constraint 350 599 11.2053 14.0066 21.0099 5.0067 Constraint 201 467 11.4873 14.3591 21.5386 5.0051 Constraint 176 467 12.5177 15.6471 23.4707 5.0051 Constraint 104 599 8.5214 10.6518 15.9777 4.9977 Constraint 622 706 11.0613 13.8267 20.7400 4.9963 Constraint 511 604 10.6081 13.2601 19.8902 4.9921 Constraint 153 391 11.3498 14.1873 21.2809 4.9920 Constraint 144 412 12.0163 15.0204 22.5306 4.9920 Constraint 144 360 12.8692 16.0864 24.1297 4.9920 Constraint 480 651 11.1891 13.9864 20.9795 4.9904 Constraint 467 657 10.6977 13.3722 20.0583 4.9904 Constraint 467 651 12.6493 15.8116 23.7174 4.9904 Constraint 467 644 12.4084 15.5105 23.2657 4.9904 Constraint 435 657 11.9924 14.9905 22.4857 4.9904 Constraint 429 657 10.8751 13.5938 20.3907 4.9904 Constraint 412 651 12.2902 15.3628 23.0441 4.9904 Constraint 404 657 8.2415 10.3018 15.4527 4.9904 Constraint 404 651 8.5264 10.6580 15.9870 4.9904 Constraint 404 644 10.8862 13.6078 20.4116 4.9904 Constraint 399 651 9.4730 11.8412 17.7618 4.9904 Constraint 399 644 10.8733 13.5916 20.3875 4.9904 Constraint 399 636 9.2793 11.5992 17.3988 4.9904 Constraint 391 636 12.8801 16.1001 24.1501 4.9904 Constraint 382 651 8.6567 10.8208 16.2312 4.9904 Constraint 382 644 11.8674 14.8342 22.2513 4.9904 Constraint 382 636 11.4064 14.2580 21.3871 4.9904 Constraint 375 651 5.6128 7.0160 10.5241 4.9904 Constraint 375 644 8.0069 10.0087 15.0130 4.9904 Constraint 368 636 11.6961 14.6201 21.9301 4.9904 Constraint 360 636 11.8331 14.7914 22.1871 4.9904 Constraint 355 622 9.8485 12.3107 18.4660 4.9904 Constraint 355 613 12.4453 15.5566 23.3349 4.9904 Constraint 497 622 9.1902 11.4878 17.2316 4.9890 Constraint 480 668 11.2368 14.0460 21.0689 4.9884 Constraint 473 668 10.5373 13.1716 19.7574 4.9884 Constraint 322 571 10.2019 12.7523 19.1285 4.9654 Constraint 314 571 8.1418 10.1773 15.2659 4.9654 Constraint 303 571 10.3347 12.9183 19.3775 4.9654 Constraint 292 571 10.8359 13.5449 20.3174 4.9654 Constraint 330 585 10.3497 12.9371 19.4057 4.9532 Constraint 412 577 10.0357 12.5446 18.8169 4.9494 Constraint 330 651 10.0868 12.6085 18.9128 4.9494 Constraint 330 644 10.0074 12.5092 18.7638 4.9494 Constraint 297 651 10.9259 13.6574 20.4861 4.9494 Constraint 297 644 10.3033 12.8791 19.3187 4.9494 Constraint 182 651 10.6143 13.2679 19.9019 4.9494 Constraint 221 636 12.0514 15.0643 22.5964 4.9462 Constraint 190 636 11.3876 14.2345 21.3517 4.9462 Constraint 279 599 11.3741 14.2177 21.3265 4.9416 Constraint 272 590 12.8088 16.0110 24.0165 4.9416 Constraint 267 599 10.3730 12.9663 19.4494 4.9416 Constraint 182 368 11.6170 14.5213 21.7819 4.9120 Constraint 279 435 11.1262 13.9077 20.8616 4.8967 Constraint 128 577 8.1456 10.1820 15.2730 4.8929 Constraint 113 613 11.1766 13.9708 20.9562 4.8549 Constraint 113 590 12.1861 15.2326 22.8490 4.8549 Constraint 80 161 13.4332 16.7916 25.1873 4.8189 Constraint 527 622 8.5746 10.7183 16.0775 4.8018 Constraint 519 622 10.1270 12.6588 18.9882 4.8018 Constraint 421 571 10.8541 13.5676 20.3514 4.7957 Constraint 421 557 11.2523 14.0653 21.0980 4.7957 Constraint 341 480 10.7568 13.4460 20.1690 4.7834 Constraint 272 622 12.6520 15.8150 23.7224 4.7744 Constraint 176 651 10.2825 12.8532 19.2798 4.7712 Constraint 201 590 10.2034 12.7543 19.1314 4.7635 Constraint 144 590 11.8810 14.8512 22.2769 4.7610 Constraint 182 585 11.1390 13.9238 20.8857 4.7442 Constraint 201 497 12.5502 15.6877 23.5316 4.7348 Constraint 122 599 8.6048 10.7560 16.1340 4.6683 Constraint 88 613 11.9543 14.9429 22.4144 4.6634 Constraint 80 585 11.9049 14.8811 22.3217 4.6571 Constraint 382 585 10.0583 12.5728 18.8592 4.6523 Constraint 544 629 11.3404 14.1755 21.2633 4.6478 Constraint 242 585 10.1644 12.7054 19.0582 4.6321 Constraint 104 577 7.7838 9.7297 14.5946 4.5929 Constraint 497 629 7.3720 9.2149 13.8224 4.5842 Constraint 489 636 11.0236 13.7795 20.6693 4.5697 Constraint 237 577 9.8217 12.2771 18.4156 4.5660 Constraint 201 577 9.6781 12.0976 18.1464 4.5660 Constraint 190 577 10.8965 13.6206 20.4309 4.5660 Constraint 176 577 9.5913 11.9891 17.9837 4.5660 Constraint 375 668 10.5819 13.2273 19.8410 4.5633 Constraint 511 599 11.0722 13.8402 20.7603 4.5623 Constraint 341 629 13.0854 16.3568 24.5352 4.5569 Constraint 128 544 11.6227 14.5284 21.7926 4.5363 Constraint 668 742 8.7540 10.9425 16.4138 4.5224 Constraint 442 571 11.5692 14.4615 21.6922 4.4603 Constraint 136 613 11.1040 13.8800 20.8200 4.4501 Constraint 136 585 8.9495 11.1868 16.7802 4.4501 Constraint 113 636 11.3574 14.1967 21.2951 4.4501 Constraint 113 585 9.3362 11.6702 17.5053 4.4501 Constraint 104 585 8.4940 10.6175 15.9262 4.4501 Constraint 497 585 8.7580 10.9475 16.4212 4.4063 Constraint 322 668 9.1989 11.4986 17.2479 4.3664 Constraint 314 668 12.8586 16.0732 24.1098 4.3664 Constraint 297 668 8.9684 11.2105 16.8158 4.3664 Constraint 292 668 10.4137 13.0171 19.5257 4.3664 Constraint 292 644 10.7353 13.4191 20.1287 4.3664 Constraint 272 668 10.3027 12.8783 19.3175 4.3664 Constraint 221 668 11.6433 14.5541 21.8312 4.3664 Constraint 210 668 10.2023 12.7528 19.1292 4.3664 Constraint 210 644 9.3205 11.6506 17.4760 4.3664 Constraint 201 668 10.4398 13.0498 19.5746 4.3664 Constraint 201 657 11.6135 14.5168 21.7753 4.3664 Constraint 190 668 9.8535 12.3169 18.4754 4.3664 Constraint 190 657 11.4202 14.2752 21.4128 4.3664 Constraint 182 676 9.7358 12.1698 18.2547 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 182 657 9.1175 11.3968 17.0953 4.3664 Constraint 182 644 8.2901 10.3627 15.5440 4.3664 Constraint 176 676 10.6182 13.2728 19.9092 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 176 657 9.2254 11.5317 17.2976 4.3664 Constraint 449 622 7.5235 9.4044 14.1065 4.3643 Constraint 292 590 9.4907 11.8634 17.7950 4.3587 Constraint 237 636 9.0700 11.3375 17.0062 4.3587 Constraint 153 519 11.1250 13.9063 20.8594 4.3335 Constraint 153 511 10.9430 13.6787 20.5181 4.3335 Constraint 144 511 11.1053 13.8816 20.8224 4.3335 Constraint 527 613 10.3776 12.9720 19.4580 4.3256 Constraint 519 604 11.3100 14.1376 21.2063 4.3256 Constraint 557 644 11.9966 14.9958 22.4937 4.3161 Constraint 303 480 11.8692 14.8365 22.2547 4.3057 Constraint 292 480 11.0431 13.8039 20.7058 4.3057 Constraint 80 412 12.4514 15.5642 23.3463 4.2914 Constraint 80 404 11.8036 14.7545 22.1318 4.2914 Constraint 169 585 10.7208 13.4010 20.1015 4.2513 Constraint 161 613 11.2510 14.0637 21.0956 4.2513 Constraint 161 604 8.2747 10.3434 15.5150 4.2513 Constraint 161 599 9.8474 12.3092 18.4638 4.2513 Constraint 161 585 9.9082 12.3853 18.5780 4.2513 Constraint 153 557 11.5026 14.3783 21.5675 4.2363 Constraint 153 599 10.8111 13.5139 20.2709 4.2146 Constraint 237 489 11.7269 14.6587 21.9880 4.2144 Constraint 285 511 13.1480 16.4350 24.6525 4.2144 Constraint 259 511 12.7645 15.9556 23.9334 4.2143 Constraint 128 382 12.7717 15.9646 23.9470 4.2099 Constraint 80 435 13.0174 16.2718 24.4077 4.1914 Constraint 169 644 9.0752 11.3440 17.0160 4.1914 Constraint 113 629 9.9252 12.4066 18.6098 4.1881 Constraint 104 613 10.1453 12.6817 19.0225 4.1881 Constraint 104 590 10.0764 12.5955 18.8933 4.1881 Constraint 201 644 9.1614 11.4517 17.1776 4.1837 Constraint 144 250 13.0916 16.3644 24.5467 4.1801 Constraint 449 571 12.1747 15.2183 22.8275 4.1622 Constraint 391 557 9.3917 11.7396 17.6094 4.1469 Constraint 360 557 10.1890 12.7362 19.1043 4.1469 Constraint 341 657 11.2228 14.0285 21.0428 4.1209 Constraint 96 552 10.4815 13.1018 19.6527 4.1096 Constraint 467 557 11.3042 14.1302 21.1954 4.0932 Constraint 461 571 10.8953 13.6191 20.4287 4.0932 Constraint 461 557 10.9571 13.6964 20.5446 4.0932 Constraint 511 590 12.0805 15.1006 22.6509 4.0527 Constraint 355 442 12.2454 15.3068 22.9602 4.0163 Constraint 58 285 12.5878 15.7347 23.6021 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 613 706 12.3901 15.4877 23.2315 3.9983 Constraint 527 629 8.1439 10.1798 15.2697 3.9921 Constraint 519 629 9.8585 12.3232 18.4848 3.9921 Constraint 176 497 12.9738 16.2173 24.3259 3.9913 Constraint 161 497 11.5513 14.4391 21.6586 3.9913 Constraint 404 668 11.9346 14.9182 22.3773 3.9904 Constraint 350 590 12.9203 16.1504 24.2255 3.9904 Constraint 144 404 13.0770 16.3462 24.5193 3.9899 Constraint 391 571 6.0137 7.5172 11.2758 3.9855 Constraint 382 577 8.3938 10.4923 15.7385 3.9855 Constraint 382 571 7.2942 9.1178 13.6767 3.9855 Constraint 375 577 8.5375 10.6719 16.0079 3.9855 Constraint 375 571 8.2427 10.3034 15.4551 3.9855 Constraint 368 577 8.4518 10.5648 15.8472 3.9855 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 360 571 8.1014 10.1267 15.1900 3.9855 Constraint 355 571 10.2479 12.8099 19.2149 3.9855 Constraint 350 571 11.7574 14.6968 22.0452 3.9855 Constraint 341 706 11.5132 14.3915 21.5873 3.9750 Constraint 330 706 9.2476 11.5595 17.3392 3.9750 Constraint 303 706 11.9031 14.8788 22.3183 3.9750 Constraint 314 657 11.8044 14.7555 22.1333 3.9750 Constraint 330 571 10.3137 12.8921 19.3381 3.9654 Constraint 303 585 10.8170 13.5212 20.2819 3.9654 Constraint 297 571 11.5842 14.4803 21.7204 3.9654 Constraint 285 571 10.0051 12.5064 18.7595 3.9654 Constraint 267 577 10.7662 13.4577 20.1865 3.9654 Constraint 303 613 13.1617 16.4521 24.6781 3.9647 Constraint 297 636 11.2365 14.0456 21.0683 3.9647 Constraint 285 622 12.7972 15.9965 23.9948 3.9647 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 330 668 8.4725 10.5907 15.8860 3.9616 Constraint 330 657 9.6266 12.0333 18.0499 3.9616 Constraint 322 676 9.2293 11.5366 17.3049 3.9616 Constraint 322 657 9.7292 12.1614 18.2422 3.9616 Constraint 303 668 12.8489 16.0611 24.0916 3.9616 Constraint 297 676 9.3739 11.7173 17.5760 3.9616 Constraint 297 657 10.0349 12.5436 18.8155 3.9616 Constraint 279 668 12.0012 15.0015 22.5023 3.9616 Constraint 292 651 12.4498 15.5623 23.3435 3.9570 Constraint 285 590 10.2577 12.8222 19.2333 3.9538 Constraint 267 590 12.4954 15.6193 23.4289 3.9538 Constraint 242 636 11.1697 13.9622 20.9433 3.9538 Constraint 226 636 11.7812 14.7266 22.0898 3.9538 Constraint 421 657 12.0652 15.0815 22.6222 3.9331 Constraint 161 577 9.3271 11.6588 17.4882 3.9302 Constraint 136 557 10.5052 13.1315 19.6973 3.9009 Constraint 128 557 10.8112 13.5139 20.2709 3.9009 Constraint 113 557 11.6337 14.5422 21.8132 3.9009 Constraint 104 557 10.1808 12.7260 19.0889 3.9009 Constraint 303 467 10.9854 13.7318 20.5976 3.8804 Constraint 297 467 8.9438 11.1797 16.7696 3.8804 Constraint 176 473 10.2976 12.8720 19.3080 3.8804 Constraint 161 473 8.9584 11.1980 16.7970 3.8804 Constraint 136 473 9.9779 12.4724 18.7086 3.8804 Constraint 519 590 10.9014 13.6267 20.4400 3.8642 Constraint 651 742 12.5722 15.7152 23.5728 3.8557 Constraint 644 742 10.9852 13.7315 20.5972 3.8557 Constraint 644 735 11.2282 14.0352 21.0528 3.8557 Constraint 58 375 11.6794 14.5992 21.8989 3.8531 Constraint 360 544 12.9376 16.1720 24.2580 3.8096 Constraint 113 272 12.5104 15.6380 23.4570 3.8076 Constraint 88 571 10.6174 13.2718 19.9077 3.8058 Constraint 435 557 11.3454 14.1818 21.2727 3.7957 Constraint 314 557 9.9164 12.3955 18.5933 3.7923 Constraint 169 651 10.8183 13.5229 20.2843 3.7866 Constraint 136 590 11.5408 14.4260 21.6390 3.7833 Constraint 104 636 10.7379 13.4224 20.1336 3.7833 Constraint 104 629 8.1346 10.1682 15.2523 3.7833 Constraint 104 622 9.8579 12.3224 18.4836 3.7833 Constraint 210 651 11.5504 14.4380 21.6570 3.7789 Constraint 201 651 11.6840 14.6050 21.9075 3.7789 Constraint 242 571 7.8868 9.8585 14.7877 3.7788 Constraint 442 585 10.3145 12.8931 19.3397 3.7702 Constraint 272 577 9.9047 12.3809 18.5714 3.7564 Constraint 128 599 7.2715 9.0894 13.6341 3.6683 Constraint 128 590 10.3965 12.9956 19.4934 3.6683 Constraint 122 622 10.7926 13.4907 20.2361 3.6683 Constraint 122 613 10.6434 13.3043 19.9565 3.6683 Constraint 122 590 10.5325 13.1656 19.7484 3.6683 Constraint 96 604 9.2828 11.6035 17.4052 3.6683 Constraint 96 590 10.9836 13.7294 20.5942 3.6683 Constraint 435 571 11.1491 13.9364 20.9046 3.6498 Constraint 429 571 10.9505 13.6881 20.5322 3.6498 Constraint 404 552 11.0995 13.8743 20.8115 3.6498 Constraint 399 552 10.5900 13.2375 19.8562 3.6498 Constraint 435 552 10.4228 13.0284 19.5427 3.6479 Constraint 571 644 11.8069 14.7586 22.1379 3.6161 Constraint 161 622 11.5353 14.4191 21.6287 3.5846 Constraint 161 590 11.5457 14.4321 21.6481 3.5846 Constraint 136 435 12.6540 15.8175 23.7262 3.5690 Constraint 412 557 11.3808 14.2260 21.3391 3.4957 Constraint 442 590 8.8959 11.1199 16.6799 3.4702 Constraint 442 544 10.3820 12.9775 19.4662 3.4603 Constraint 391 544 13.2945 16.6181 24.9272 3.4594 Constraint 237 585 9.6966 12.1207 18.1811 3.4456 Constraint 161 629 10.8461 13.5576 20.3364 3.4417 Constraint 169 544 11.4011 14.2513 21.3770 3.4267 Constraint 169 535 9.8756 12.3446 18.5168 3.4267 Constraint 161 571 11.7167 14.6459 21.9689 3.4267 Constraint 161 552 12.9370 16.1713 24.2569 3.4267 Constraint 161 544 9.7700 12.2125 18.3188 3.4267 Constraint 161 535 9.1285 11.4106 17.1159 3.4267 Constraint 153 544 9.7377 12.1722 18.2583 3.4267 Constraint 136 544 12.0222 15.0277 22.5415 3.4267 Constraint 535 629 8.9575 11.1968 16.7952 3.4192 Constraint 80 544 10.4632 13.0790 19.6184 3.4048 Constraint 80 535 7.0981 8.8727 13.3090 3.4048 Constraint 242 657 12.5782 15.7227 23.5841 3.3875 Constraint 272 698 11.9642 14.9552 22.4328 3.3818 Constraint 190 698 12.0980 15.1225 22.6838 3.3818 Constraint 182 698 10.4633 13.0791 19.6187 3.3818 Constraint 176 698 10.9787 13.7234 20.5851 3.3818 Constraint 176 687 12.3863 15.4829 23.2244 3.3818 Constraint 169 668 9.4042 11.7552 17.6328 3.3818 Constraint 341 473 10.3967 12.9958 19.4937 3.3806 Constraint 221 644 11.0297 13.7871 20.6807 3.3740 Constraint 210 676 11.5051 14.3814 21.5721 3.3740 Constraint 190 644 9.7015 12.1268 18.1903 3.3740 Constraint 449 657 12.5303 15.6628 23.4943 3.3601 Constraint 449 636 11.2641 14.0802 21.1202 3.3601 Constraint 412 571 10.6953 13.3691 20.0537 3.3498 Constraint 404 557 12.3274 15.4092 23.1138 3.3498 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 622 713 10.2080 12.7600 19.1400 3.3296 Constraint 590 687 11.1514 13.9393 20.9090 3.3296 Constraint 571 698 12.5180 15.6475 23.4713 3.3296 Constraint 571 687 11.6965 14.6206 21.9309 3.3296 Constraint 272 489 12.1729 15.2161 22.8242 3.3076 Constraint 221 480 11.9320 14.9150 22.3726 3.3076 Constraint 210 480 11.0917 13.8646 20.7969 3.3076 Constraint 182 535 12.2220 15.2775 22.9162 3.3076 Constraint 182 489 10.9697 13.7122 20.5683 3.3076 Constraint 391 552 7.7277 9.6596 14.4894 3.3009 Constraint 96 585 11.1111 13.8889 20.8333 3.2635 Constraint 449 557 11.1814 13.9768 20.9652 3.2392 Constraint 442 636 12.3668 15.4585 23.1878 3.2320 Constraint 96 629 8.9311 11.1639 16.7458 3.1920 Constraint 88 622 11.5499 14.4374 21.6561 3.1920 Constraint 122 657 10.9685 13.7106 20.5659 3.1901 Constraint 104 668 11.4116 14.2645 21.3968 3.1901 Constraint 153 577 9.8620 12.3275 18.4913 3.1430 Constraint 153 552 10.9638 13.7047 20.5571 3.1430 Constraint 122 571 11.8379 14.7974 22.1961 3.1430 Constraint 122 557 11.1585 13.9481 20.9221 3.1412 Constraint 355 651 9.7835 12.2294 18.3441 3.1337 Constraint 391 644 13.0331 16.2914 24.4371 3.1305 Constraint 360 657 10.5740 13.2175 19.8262 3.1305 Constraint 297 480 9.8311 12.2889 18.4334 3.0913 Constraint 136 480 11.2838 14.1047 21.1571 3.0913 Constraint 80 226 13.1256 16.4070 24.6105 3.0886 Constraint 80 201 12.6944 15.8679 23.8019 3.0886 Constraint 144 613 11.2804 14.1005 21.1508 3.0726 Constraint 442 651 11.9971 14.9964 22.4945 3.0269 Constraint 341 571 8.4491 10.5613 15.8420 3.0125 Constraint 161 644 12.0042 15.0053 22.5079 3.0016 Constraint 136 599 9.0177 11.2722 16.9083 3.0016 Constraint 128 622 8.7995 10.9994 16.4991 3.0016 Constraint 128 613 9.4204 11.7755 17.6633 3.0016 Constraint 96 622 9.7228 12.1535 18.2303 3.0016 Constraint 404 571 7.6716 9.5895 14.3843 3.0009 Constraint 399 577 6.3107 7.8883 11.8325 3.0009 Constraint 399 571 6.9044 8.6306 12.9458 3.0009 Constraint 382 557 8.8518 11.0648 16.5972 3.0009 Constraint 375 557 8.8090 11.0112 16.5169 3.0009 Constraint 375 552 7.9253 9.9066 14.8599 3.0009 Constraint 368 557 8.5536 10.6920 16.0380 3.0009 Constraint 368 552 7.6438 9.5547 14.3321 3.0009 Constraint 360 552 7.7488 9.6860 14.5290 3.0009 Constraint 355 557 10.3137 12.8921 19.3382 3.0009 Constraint 355 552 9.3676 11.7095 17.5642 3.0009 Constraint 350 557 12.8424 16.0530 24.0795 3.0009 Constraint 161 527 13.3984 16.7480 25.1220 3.0000 Constraint 69 237 13.5123 16.8904 25.3356 3.0000 Constraint 58 182 13.2928 16.6160 24.9240 3.0000 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 467 12.1656 15.2071 22.8106 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 449 11.4549 14.3187 21.4780 3.0000 Constraint 51 429 11.6845 14.6056 21.9084 3.0000 Constraint 51 421 11.7813 14.7266 22.0899 3.0000 Constraint 51 355 10.7311 13.4139 20.1209 3.0000 Constraint 51 341 13.5658 16.9573 25.4359 3.0000 Constraint 51 330 12.2245 15.2807 22.9210 3.0000 Constraint 51 144 11.2868 14.1084 21.1627 3.0000 Constraint 51 136 12.0319 15.0399 22.5599 3.0000 Constraint 51 128 11.5757 14.4697 21.7045 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 473 12.5906 15.7383 23.6075 3.0000 Constraint 41 399 13.2985 16.6232 24.9347 3.0000 Constraint 41 355 11.5988 14.4986 21.7478 3.0000 Constraint 41 122 13.3352 16.6690 25.0036 3.0000 Constraint 41 113 11.8742 14.8427 22.2641 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 489 13.0759 16.3449 24.5173 3.0000 Constraint 33 355 11.4914 14.3642 21.5463 3.0000 Constraint 33 341 12.9148 16.1436 24.2153 3.0000 Constraint 33 330 12.2735 15.3418 23.0128 3.0000 Constraint 33 322 12.0182 15.0227 22.5341 3.0000 Constraint 33 122 13.4578 16.8222 25.2333 3.0000 Constraint 33 113 10.9570 13.6962 20.5443 3.0000 Constraint 33 104 11.2225 14.0281 21.0421 3.0000 Constraint 136 285 12.8146 16.0183 24.0274 3.0000 Constraint 272 544 13.4868 16.8585 25.2877 2.9998 Constraint 153 341 11.1667 13.9584 20.9376 2.9942 Constraint 144 341 11.0042 13.7552 20.6328 2.9942 Constraint 511 622 9.9739 12.4674 18.7011 2.9922 Constraint 176 350 12.7205 15.9007 23.8510 2.9886 Constraint 169 355 12.4567 15.5709 23.3563 2.9886 Constraint 161 350 13.1662 16.4577 24.6866 2.9886 Constraint 153 350 13.5758 16.9697 25.4545 2.9886 Constraint 153 267 13.1394 16.4242 24.6363 2.9886 Constraint 350 577 10.2282 12.7853 19.1779 2.9855 Constraint 341 613 11.0596 13.8245 20.7368 2.9840 Constraint 330 590 11.4896 14.3620 21.5430 2.9840 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 322 713 11.3366 14.1708 21.2561 2.9827 Constraint 303 713 12.0239 15.0298 22.5447 2.9827 Constraint 330 698 10.4351 13.0439 19.5659 2.9769 Constraint 330 687 10.2735 12.8419 19.2629 2.9769 Constraint 322 706 10.4814 13.1017 19.6525 2.9769 Constraint 322 698 12.4590 15.5737 23.3606 2.9769 Constraint 322 687 12.3680 15.4600 23.1900 2.9769 Constraint 297 706 8.3589 10.4487 15.6730 2.9769 Constraint 297 698 10.6410 13.3012 19.9518 2.9769 Constraint 297 687 11.5783 14.4729 21.7094 2.9769 Constraint 292 706 11.6919 14.6149 21.9223 2.9769 Constraint 279 706 10.7316 13.4146 20.1218 2.9769 Constraint 272 706 10.4848 13.1060 19.6590 2.9769 Constraint 190 341 12.9002 16.1252 24.1878 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 182 687 11.7095 14.6368 21.9552 2.9769 Constraint 176 706 10.9944 13.7431 20.6146 2.9769 Constraint 176 341 13.4862 16.8578 25.2867 2.9769 Constraint 489 657 10.3124 12.8905 19.3357 2.9759 Constraint 527 651 10.0309 12.5387 18.8080 2.9758 Constraint 519 651 12.1509 15.1886 22.7830 2.9758 Constraint 341 676 11.4602 14.3253 21.4879 2.9692 Constraint 314 644 12.0474 15.0592 22.5888 2.9692 Constraint 292 676 11.1429 13.9286 20.8929 2.9692 Constraint 279 644 13.1745 16.4681 24.7021 2.9692 Constraint 272 676 11.7414 14.6768 22.0152 2.9692 Constraint 272 644 10.5411 13.1764 19.7646 2.9692 Constraint 237 341 12.6845 15.8556 23.7834 2.9634 Constraint 341 557 9.7061 12.1326 18.1989 2.9536 Constraint 226 467 12.7699 15.9624 23.9436 2.9118 Constraint 201 368 13.3047 16.6309 24.9464 2.9118 Constraint 176 360 12.4845 15.6056 23.4084 2.9118 Constraint 169 557 12.4250 15.5313 23.2970 2.9028 Constraint 169 552 12.4107 15.5133 23.2700 2.9028 Constraint 176 399 12.6618 15.8273 23.7410 2.8709 Constraint 122 636 10.1716 12.7145 19.0718 2.8587 Constraint 122 629 8.2557 10.3197 15.4795 2.8587 Constraint 636 742 13.5613 16.9516 25.4274 2.8576 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 58 552 12.3955 15.4944 23.2416 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 88 557 10.0176 12.5220 18.7830 2.8077 Constraint 128 571 12.6689 15.8361 23.7542 2.8058 Constraint 113 571 12.2045 15.2557 22.8835 2.8058 Constraint 104 571 10.0498 12.5622 18.8433 2.8058 Constraint 449 590 8.5661 10.7076 16.0615 2.8035 Constraint 272 404 10.4058 13.0072 19.5108 2.8035 Constraint 314 552 9.2462 11.5578 17.3367 2.7942 Constraint 322 557 9.7496 12.1870 18.2806 2.7923 Constraint 292 557 11.6106 14.5133 21.7699 2.7923 Constraint 461 657 12.5785 15.7231 23.5846 2.7872 Constraint 461 651 11.5621 14.4527 21.6790 2.7872 Constraint 461 644 11.1264 13.9080 20.8620 2.7872 Constraint 421 651 10.9648 13.7061 20.5591 2.7872 Constraint 421 644 12.7562 15.9453 23.9179 2.7872 Constraint 88 636 11.5555 14.4443 21.6665 2.7872 Constraint 113 657 8.6297 10.7871 16.1806 2.7852 Constraint 104 657 8.1524 10.1905 15.2858 2.7852 Constraint 88 657 10.6022 13.2527 19.8791 2.7852 Constraint 511 585 12.4887 15.6109 23.4164 2.7794 Constraint 237 571 8.6598 10.8247 16.2370 2.7788 Constraint 226 585 12.4520 15.5650 23.3475 2.7788 Constraint 226 577 9.9877 12.4847 18.7270 2.7788 Constraint 210 571 9.0276 11.2846 16.9268 2.7788 Constraint 272 375 12.3650 15.4562 23.1844 2.7352 Constraint 599 713 8.7654 10.9568 16.4352 2.6629 Constraint 412 552 9.6940 12.1175 18.1762 2.6498 Constraint 429 557 10.4007 13.0009 19.5014 2.6335 Constraint 435 544 9.2267 11.5334 17.3000 2.6315 Constraint 412 544 11.1293 13.9116 20.8675 2.6315 Constraint 169 577 7.4066 9.2583 13.8874 2.5968 Constraint 161 651 12.6817 15.8521 23.7781 2.5968 Constraint 96 577 8.6593 10.8241 16.2362 2.5968 Constraint 80 577 13.0842 16.3552 24.5328 2.5963 Constraint 113 668 11.3154 14.1443 21.2164 2.5943 Constraint 511 629 8.5935 10.7419 16.1128 2.5874 Constraint 497 657 8.0800 10.1001 15.1501 2.5710 Constraint 497 651 10.3117 12.8897 19.3345 2.5710 Constraint 497 644 9.9589 12.4487 18.6730 2.5710 Constraint 330 473 11.5232 14.4040 21.6059 2.5709 Constraint 190 399 13.1081 16.3852 24.5777 2.5709 Constraint 161 412 11.9973 14.9966 22.4949 2.5709 Constraint 497 636 9.6923 12.1154 18.1730 2.5698 Constraint 421 668 13.4510 16.8137 25.2206 2.5653 Constraint 341 698 12.2058 15.2572 22.8858 2.5634 Constraint 237 535 11.7710 14.7137 22.0706 2.5479 Constraint 237 519 10.2084 12.7605 19.1408 2.5479 Constraint 237 511 10.0855 12.6069 18.9103 2.5479 Constraint 221 511 11.8550 14.8188 22.2281 2.5479 Constraint 201 519 12.3622 15.4528 23.1792 2.5479 Constraint 169 519 11.4646 14.3308 21.4961 2.5479 Constraint 442 557 10.0415 12.5519 18.8278 2.4623 Constraint 442 644 13.0400 16.3000 24.4499 2.4539 Constraint 161 636 9.9328 12.4160 18.6240 2.4539 Constraint 136 636 7.8595 9.8244 14.7366 2.4539 Constraint 497 668 9.3613 11.7016 17.5524 2.4029 Constraint 489 668 10.0708 12.5886 18.8828 2.4029 Constraint 341 590 8.6657 10.8322 16.2483 2.4010 Constraint 292 698 12.0891 15.1114 22.6671 2.3952 Constraint 267 698 13.1375 16.4219 24.6329 2.3952 Constraint 221 676 12.6438 15.8047 23.7071 2.3894 Constraint 201 676 11.7056 14.6320 21.9480 2.3894 Constraint 190 676 11.4988 14.3736 21.5603 2.3894 Constraint 169 676 10.0284 12.5355 18.8033 2.3894 Constraint 292 657 9.8351 12.2938 18.4407 2.3817 Constraint 221 657 11.0941 13.8676 20.8014 2.3817 Constraint 210 657 9.2011 11.5014 17.2521 2.3817 Constraint 190 651 12.0174 15.0218 22.5327 2.3817 Constraint 599 706 6.5315 8.1644 12.2466 2.3315 Constraint 590 706 10.2211 12.7763 19.1645 2.3315 Constraint 590 698 12.6139 15.7674 23.6511 2.3315 Constraint 585 706 12.0782 15.0977 22.6465 2.3315 Constraint 585 687 11.4713 14.3391 21.5087 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 577 698 11.1141 13.8926 20.8389 2.3315 Constraint 577 687 9.8766 12.3457 18.5186 2.3315 Constraint 571 706 8.9503 11.1879 16.7818 2.3315 Constraint 557 706 12.9761 16.2201 24.3301 2.3315 Constraint 399 557 10.4614 13.0767 19.6151 2.3163 Constraint 144 657 11.0792 13.8490 20.7735 2.2630 Constraint 144 644 11.4335 14.2918 21.4378 2.2630 Constraint 144 636 9.3843 11.7304 17.5955 2.2630 Constraint 144 629 9.0009 11.2511 16.8766 2.2630 Constraint 144 622 11.7927 14.7409 22.1113 2.2630 Constraint 237 644 9.9731 12.4664 18.6996 2.1990 Constraint 161 657 11.9614 14.9518 22.4277 2.1920 Constraint 136 668 10.3614 12.9517 19.4276 2.1920 Constraint 136 644 9.3581 11.6976 17.5464 2.1920 Constraint 128 676 11.9492 14.9365 22.4048 2.1920 Constraint 128 668 10.7631 13.4539 20.1808 2.1920 Constraint 128 657 8.9382 11.1728 16.7592 2.1920 Constraint 128 651 9.0900 11.3625 17.0438 2.1920 Constraint 128 644 9.0555 11.3194 16.9791 2.1920 Constraint 128 636 7.8317 9.7897 14.6845 2.1920 Constraint 128 629 5.9891 7.4863 11.2295 2.1920 Constraint 122 651 10.2654 12.8318 19.2477 2.1920 Constraint 122 644 10.8924 13.6155 20.4233 2.1920 Constraint 113 644 10.8670 13.5838 20.3756 2.1920 Constraint 113 622 10.3229 12.9036 19.3554 2.1920 Constraint 104 676 11.4357 14.2946 21.4419 2.1920 Constraint 104 644 9.4783 11.8479 17.7718 2.1920 Constraint 96 657 10.3054 12.8818 19.3226 2.1920 Constraint 96 651 9.4922 11.8653 17.7979 2.1920 Constraint 96 644 10.9546 13.6932 20.5398 2.1920 Constraint 96 636 10.5497 13.1871 19.7807 2.1920 Constraint 96 613 10.4252 13.0315 19.5472 2.1920 Constraint 80 636 11.9829 14.9787 22.4680 2.1914 Constraint 80 629 9.7710 12.2138 18.3207 2.1914 Constraint 80 613 12.1994 15.2493 22.8739 2.1914 Constraint 391 657 10.4367 13.0459 19.5688 2.1459 Constraint 355 657 9.8707 12.3384 18.5076 2.1459 Constraint 355 644 10.7692 13.4615 20.1923 2.1459 Constraint 242 544 10.3918 12.9898 19.4847 2.1431 Constraint 237 544 11.3781 14.2227 21.3340 2.1431 Constraint 210 544 11.6162 14.5202 21.7803 2.1431 Constraint 350 651 11.4356 14.2945 21.4417 2.1337 Constraint 285 467 11.5887 14.4858 21.7288 2.0932 Constraint 279 480 13.3398 16.6748 25.0122 2.0932 Constraint 279 473 12.0329 15.0411 22.5616 2.0932 Constraint 279 467 10.8279 13.5349 20.3024 2.0932 Constraint 272 480 10.7926 13.4908 20.2362 2.0932 Constraint 272 473 9.3970 11.7463 17.6194 2.0932 Constraint 272 467 9.3005 11.6257 17.4385 2.0932 Constraint 272 461 13.0164 16.2705 24.4058 2.0932 Constraint 267 473 12.9154 16.1442 24.2164 2.0932 Constraint 267 467 12.8439 16.0548 24.0823 2.0932 Constraint 259 467 12.8956 16.1194 24.1792 2.0932 Constraint 226 473 12.6510 15.8138 23.7207 2.0932 Constraint 221 467 11.8320 14.7900 22.1849 2.0932 Constraint 201 480 12.4214 15.5267 23.2901 2.0932 Constraint 201 473 9.7332 12.1665 18.2497 2.0932 Constraint 190 480 12.6240 15.7800 23.6699 2.0932 Constraint 190 473 10.7726 13.4658 20.1987 2.0932 Constraint 190 467 12.4015 15.5019 23.2529 2.0932 Constraint 182 480 8.3941 10.4926 15.7389 2.0932 Constraint 176 535 12.3723 15.4653 23.1980 2.0932 Constraint 176 480 10.9418 13.6773 20.5159 2.0932 Constraint 169 480 8.8303 11.0378 16.5568 2.0932 Constraint 161 557 12.0379 15.0474 22.5711 2.0932 Constraint 161 489 11.0008 13.7510 20.6265 2.0932 Constraint 161 480 7.1619 8.9524 13.4285 2.0932 Constraint 161 467 9.9677 12.4596 18.6894 2.0932 Constraint 330 435 8.4002 10.5003 15.7504 2.0189 Constraint 382 552 5.6671 7.0839 10.6258 2.0009 Constraint 350 552 10.3353 12.9191 19.3786 2.0009 Constraint 489 651 11.7178 14.6472 21.9708 1.9981 Constraint 489 644 11.1791 13.9739 20.9609 1.9981 Constraint 480 706 12.2829 15.3536 23.0304 1.9981 Constraint 480 698 9.8229 12.2786 18.4179 1.9981 Constraint 480 687 12.0985 15.1231 22.6847 1.9981 Constraint 473 706 11.2505 14.0631 21.0947 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 687 10.3057 12.8821 19.3231 1.9981 Constraint 473 676 10.3858 12.9822 19.4733 1.9981 Constraint 557 651 9.6751 12.0939 18.1408 1.9980 Constraint 552 651 12.2277 15.2847 22.9270 1.9980 Constraint 544 651 11.5427 14.4283 21.6425 1.9980 Constraint 535 651 10.7091 13.3864 20.0796 1.9980 Constraint 629 729 10.2036 12.7545 19.1318 1.9962 Constraint 613 713 10.6418 13.3023 19.9534 1.9962 Constraint 604 729 12.8099 16.0123 24.0185 1.9962 Constraint 604 713 9.7662 12.2078 18.3117 1.9962 Constraint 557 713 11.0265 13.7831 20.6747 1.9962 Constraint 557 687 11.4506 14.3133 21.4699 1.9962 Constraint 557 657 9.2229 11.5287 17.2930 1.9962 Constraint 341 622 11.9782 14.9728 22.4591 1.9962 Constraint 136 571 12.6186 15.7732 23.6598 1.9962 Constraint 519 613 9.8403 12.3004 18.4506 1.9941 Constraint 314 706 11.8150 14.7687 22.1531 1.9904 Constraint 303 698 11.8475 14.8093 22.2140 1.9904 Constraint 355 636 12.5132 15.6416 23.4623 1.9878 Constraint 350 629 11.9662 14.9577 22.4366 1.9878 Constraint 303 629 11.6186 14.5233 21.7849 1.9878 Constraint 421 676 13.4269 16.7836 25.1754 1.9846 Constraint 350 720 12.5830 15.7287 23.5931 1.9846 Constraint 341 720 10.9728 13.7160 20.5740 1.9846 Constraint 330 720 9.5377 11.9221 17.8831 1.9846 Constraint 322 720 13.0323 16.2904 24.4355 1.9846 Constraint 314 676 11.6238 14.5297 21.7945 1.9846 Constraint 303 720 13.0599 16.3249 24.4874 1.9846 Constraint 303 676 11.5525 14.4406 21.6609 1.9846 Constraint 297 720 10.5132 13.1415 19.7122 1.9846 Constraint 297 713 9.0889 11.3611 17.0417 1.9846 Constraint 292 713 12.8152 16.0190 24.0285 1.9846 Constraint 279 720 12.1029 15.1287 22.6930 1.9846 Constraint 279 713 12.1520 15.1899 22.7849 1.9846 Constraint 279 676 11.6259 14.5324 21.7986 1.9846 Constraint 272 720 13.5825 16.9782 25.4672 1.9846 Constraint 272 713 12.4496 15.5619 23.3429 1.9846 Constraint 267 706 13.2206 16.5258 24.7886 1.9846 Constraint 259 636 13.3015 16.6268 24.9403 1.9846 Constraint 221 706 12.8252 16.0316 24.0473 1.9846 Constraint 210 706 13.1877 16.4846 24.7269 1.9846 Constraint 190 706 11.0090 13.7612 20.6418 1.9846 Constraint 182 720 13.0729 16.3411 24.5117 1.9846 Constraint 182 713 10.7340 13.4174 20.1262 1.9846 Constraint 176 713 12.8130 16.0163 24.0244 1.9846 Constraint 169 706 13.2235 16.5294 24.7941 1.9846 Constraint 314 651 12.6072 15.7590 23.6385 1.9846 Constraint 552 657 10.4087 13.0109 19.5164 1.9827 Constraint 552 644 12.4627 15.5783 23.3675 1.9827 Constraint 330 557 10.2218 12.7772 19.1659 1.9827 Constraint 303 557 10.7445 13.4307 20.1460 1.9827 Constraint 297 557 12.3798 15.4748 23.2122 1.9827 Constraint 330 636 8.2794 10.3492 15.5239 1.9801 Constraint 279 636 12.5267 15.6583 23.4875 1.9801 Constraint 272 636 11.3771 14.2213 21.3320 1.9801 Constraint 303 657 11.7038 14.6297 21.9446 1.9769 Constraint 279 657 11.4814 14.3518 21.5277 1.9769 Constraint 272 657 9.5760 11.9699 17.9549 1.9769 Constraint 527 676 11.2431 14.0539 21.0809 1.9759 Constraint 527 668 9.2554 11.5693 17.3539 1.9759 Constraint 527 657 6.8503 8.5629 12.8443 1.9759 Constraint 527 644 9.9338 12.4172 18.6259 1.9759 Constraint 519 668 11.0903 13.8628 20.7942 1.9759 Constraint 519 657 9.2554 11.5693 17.3539 1.9759 Constraint 519 644 11.9898 14.9872 22.4808 1.9759 Constraint 511 668 10.9288 13.6611 20.4916 1.9759 Constraint 511 613 9.6097 12.0121 18.0181 1.9759 Constraint 272 651 11.9330 14.9163 22.3745 1.9724 Constraint 350 585 12.7065 15.8831 23.8246 1.9692 Constraint 285 585 9.5667 11.9584 17.9376 1.9692 Constraint 279 585 12.8895 16.1118 24.1677 1.9692 Constraint 279 571 11.7239 14.6548 21.9823 1.9692 Constraint 272 585 12.0886 15.1107 22.6660 1.9692 Constraint 272 571 10.9814 13.7267 20.5900 1.9692 Constraint 267 585 12.4279 15.5349 23.3023 1.9692 Constraint 267 571 9.7471 12.1839 18.2759 1.9692 Constraint 259 585 8.9977 11.2472 16.8708 1.9692 Constraint 259 571 5.6666 7.0833 10.6250 1.9692 Constraint 250 585 10.4917 13.1147 19.6720 1.9692 Constraint 250 577 7.4155 9.2694 13.9041 1.9692 Constraint 250 571 5.3243 6.6553 9.9830 1.9692 Constraint 226 571 9.2552 11.5690 17.3535 1.9692 Constraint 221 585 10.3325 12.9156 19.3734 1.9692 Constraint 221 571 8.3847 10.4809 15.7213 1.9692 Constraint 201 571 11.0086 13.7608 20.6411 1.9692 Constraint 190 585 13.4067 16.7584 25.1376 1.9692 Constraint 190 571 12.3536 15.4420 23.1630 1.9692 Constraint 182 571 11.4098 14.2622 21.3934 1.9692 Constraint 176 571 13.5089 16.8862 25.3293 1.9692 Constraint 285 461 13.1458 16.4322 24.6483 1.8981 Constraint 272 497 12.8355 16.0444 24.0666 1.8981 Constraint 153 622 10.9588 13.6985 20.5478 1.8812 Constraint 153 613 10.5444 13.1805 19.7707 1.8812 Constraint 153 604 6.8323 8.5404 12.8106 1.8812 Constraint 96 571 11.2767 14.0959 21.1438 1.8096 Constraint 292 552 8.9778 11.2222 16.8333 1.7942 Constraint 285 552 9.9090 12.3862 18.5793 1.7942 Constraint 259 557 10.9337 13.6671 20.5006 1.7942 Constraint 259 552 9.0173 11.2716 16.9074 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 242 557 8.7726 10.9657 16.4486 1.7942 Constraint 242 552 7.5013 9.3766 14.0649 1.7942 Constraint 237 651 11.4341 14.2926 21.4390 1.7942 Constraint 237 557 10.8597 13.5747 20.3620 1.7942 Constraint 237 552 9.7078 12.1348 18.2022 1.7942 Constraint 226 651 13.2206 16.5258 24.7886 1.7942 Constraint 226 552 12.0298 15.0373 22.5559 1.7942 Constraint 221 557 11.8019 14.7524 22.1286 1.7942 Constraint 221 552 9.9863 12.4829 18.7243 1.7942 Constraint 210 557 9.6891 12.1114 18.1671 1.7942 Constraint 210 552 8.3974 10.4968 15.7451 1.7942 Constraint 461 676 13.5810 16.9762 25.4643 1.7872 Constraint 449 676 12.2674 15.3343 23.0014 1.7872 Constraint 449 651 8.8351 11.0439 16.5658 1.7872 Constraint 449 644 9.9363 12.4204 18.6306 1.7872 Constraint 190 404 12.3132 15.3915 23.0872 1.7872 Constraint 176 404 11.6386 14.5483 21.8225 1.7872 Constraint 136 657 7.1117 8.8896 13.3344 1.7872 Constraint 136 651 8.5990 10.7487 16.1230 1.7872 Constraint 136 629 4.6170 5.7712 8.6569 1.7872 Constraint 136 622 8.5217 10.6522 15.9783 1.7872 Constraint 113 651 8.6349 10.7936 16.1904 1.7872 Constraint 104 651 6.5019 8.1274 12.1911 1.7872 Constraint 88 651 10.3560 12.9450 19.4175 1.7872 Constraint 412 585 6.9833 8.7291 13.0936 1.6831 Constraint 599 729 10.2283 12.7854 19.1781 1.6648 Constraint 599 720 9.1563 11.4453 17.1680 1.6648 Constraint 590 713 9.0496 11.3120 16.9680 1.6648 Constraint 577 720 11.4410 14.3012 21.4518 1.6648 Constraint 577 713 8.9813 11.2266 16.8399 1.6648 Constraint 571 729 10.5821 13.2276 19.8414 1.6648 Constraint 571 720 10.6241 13.2801 19.9202 1.6648 Constraint 571 713 7.6358 9.5447 14.3171 1.6648 Constraint 404 544 12.3651 15.4564 23.1845 1.6335 Constraint 144 668 11.7829 14.7287 22.0930 1.5963 Constraint 144 651 11.2104 14.0130 21.0195 1.5963 Constraint 136 676 10.9746 13.7182 20.5773 1.5963 Constraint 113 676 12.0039 15.0049 22.5073 1.5963 Constraint 104 687 11.5848 14.4810 21.7215 1.5938 Constraint 88 687 12.5816 15.7270 23.5905 1.5938 Constraint 442 657 12.4162 15.5202 23.2803 1.5730 Constraint 412 668 13.4197 16.7746 25.1620 1.5730 Constraint 399 668 11.0051 13.7564 20.6345 1.5730 Constraint 391 687 12.1075 15.1344 22.7015 1.5730 Constraint 391 668 11.9947 14.9934 22.4901 1.5730 Constraint 382 668 11.5182 14.3978 21.5967 1.5730 Constraint 368 668 10.6373 13.2966 19.9449 1.5730 Constraint 360 687 12.0772 15.0966 22.6448 1.5730 Constraint 360 668 11.2170 14.0212 21.0318 1.5730 Constraint 527 687 8.7485 10.9357 16.4035 1.5710 Constraint 511 657 8.8969 11.1211 16.6817 1.5710 Constraint 511 651 11.8954 14.8692 22.3039 1.5710 Constraint 511 644 11.0996 13.8746 20.8118 1.5710 Constraint 350 657 10.6319 13.2899 19.9349 1.5576 Constraint 144 297 13.4426 16.8032 25.2049 1.4914 Constraint 153 590 9.9619 12.4524 18.6786 1.4763 Constraint 153 585 7.7574 9.6968 14.5452 1.4763 Constraint 80 571 12.8119 16.0149 24.0224 1.4048 Constraint 80 557 12.1466 15.1832 22.7749 1.4048 Constraint 535 668 9.0224 11.2780 16.9169 1.4029 Constraint 535 657 7.2637 9.0797 13.6195 1.4029 Constraint 535 644 9.3864 11.7330 17.5995 1.4029 Constraint 527 698 8.2675 10.3344 15.5016 1.4029 Constraint 519 698 9.4958 11.8698 17.8047 1.4029 Constraint 259 698 11.0879 13.8598 20.7897 1.4029 Constraint 250 698 12.3882 15.4852 23.2279 1.4029 Constraint 242 698 11.5124 14.3905 21.5857 1.4029 Constraint 242 668 12.1810 15.2262 22.8393 1.4029 Constraint 88 668 11.8055 14.7569 22.1354 1.4029 Constraint 221 698 11.7979 14.7474 22.1211 1.3971 Constraint 210 698 11.5166 14.3957 21.5936 1.3971 Constraint 190 687 13.1060 16.3825 24.5737 1.3971 Constraint 169 698 11.8152 14.7689 22.1534 1.3971 Constraint 259 657 12.5764 15.7205 23.5807 1.3894 Constraint 242 644 9.4810 11.8513 17.7769 1.3894 Constraint 237 657 10.3496 12.9370 19.4055 1.3894 Constraint 226 657 12.1637 15.2047 22.8070 1.3894 Constraint 226 644 10.3272 12.9090 19.3636 1.3894 Constraint 544 706 11.9397 14.9246 22.3869 1.3335 Constraint 226 511 11.6136 14.5169 21.7754 1.3335 Constraint 201 544 12.8468 16.0585 24.0877 1.3335 Constraint 201 535 13.3912 16.7390 25.1085 1.3335 Constraint 201 511 10.1508 12.6885 19.0328 1.3335 Constraint 182 511 12.4573 15.5716 23.3574 1.3335 Constraint 176 511 12.4200 15.5250 23.2875 1.3335 Constraint 169 571 13.2729 16.5911 24.8867 1.3335 Constraint 169 511 8.0333 10.0416 15.0624 1.3335 Constraint 161 706 12.9910 16.2388 24.3582 1.3335 Constraint 161 519 11.4665 14.3332 21.4998 1.3335 Constraint 161 511 9.9317 12.4146 18.6219 1.3335 Constraint 136 519 10.4001 13.0001 19.5002 1.3335 Constraint 136 511 10.4618 13.0772 19.6158 1.3335 Constraint 113 382 11.1513 13.9391 20.9086 1.2981 Constraint 104 382 8.5718 10.7147 16.0721 1.2981 Constraint 285 519 10.8303 13.5379 20.3069 1.2144 Constraint 285 489 7.0351 8.7938 13.1908 1.2144 Constraint 285 480 9.6392 12.0489 18.0734 1.2144 Constraint 279 489 10.8972 13.6215 20.4322 1.2144 Constraint 272 519 13.0663 16.3329 24.4994 1.2144 Constraint 267 519 12.3521 15.4401 23.1601 1.2144 Constraint 267 497 13.1803 16.4754 24.7130 1.2144 Constraint 267 489 9.3743 11.7178 17.5767 1.2144 Constraint 267 480 11.7432 14.6791 22.0186 1.2144 Constraint 259 519 8.0159 10.0198 15.0297 1.2144 Constraint 259 489 5.1701 6.4627 9.6940 1.2144 Constraint 259 480 8.0609 10.0761 15.1141 1.2144 Constraint 250 519 7.1876 8.9845 13.4767 1.2144 Constraint 250 511 10.3391 12.9239 19.3858 1.2144 Constraint 250 489 6.4126 8.0157 12.0236 1.2144 Constraint 250 480 7.1196 8.8995 13.3492 1.2144 Constraint 237 480 11.8127 14.7659 22.1488 1.2144 Constraint 226 519 9.6801 12.1001 18.1502 1.2144 Constraint 226 497 13.1518 16.4398 24.6597 1.2144 Constraint 226 489 9.3572 11.6965 17.5447 1.2144 Constraint 226 480 11.7837 14.7296 22.0944 1.2144 Constraint 221 519 8.2803 10.3504 15.5256 1.2144 Constraint 221 489 6.5848 8.2310 12.3466 1.2144 Constraint 201 489 11.4107 14.2634 21.3951 1.2144 Constraint 190 527 11.7078 14.6347 21.9520 1.2144 Constraint 190 519 12.2729 15.3412 23.0117 1.2144 Constraint 190 489 10.9236 13.6545 20.4817 1.2144 Constraint 182 519 11.4567 14.3208 21.4813 1.2144 Constraint 176 527 12.6839 15.8549 23.7823 1.2144 Constraint 153 644 9.5952 11.9940 17.9910 1.2144 Constraint 144 272 13.0902 16.3627 24.5441 1.1914 Constraint 80 676 11.5458 14.4323 21.6484 1.1914 Constraint 80 668 12.2359 15.2948 22.9423 1.1914 Constraint 80 657 8.6727 10.8409 16.2613 1.1914 Constraint 80 651 7.3178 9.1473 13.7209 1.1914 Constraint 80 644 11.2896 14.1120 21.1680 1.1914 Constraint 80 622 9.2976 11.6219 17.4329 1.1914 Constraint 80 590 13.0083 16.2603 24.3905 1.1914 Constraint 350 644 12.7607 15.9509 23.9263 1.1459 Constraint 341 651 12.1803 15.2254 22.8380 1.1459 Constraint 237 729 12.8077 16.0096 24.0145 1.0715 Constraint 201 735 12.3761 15.4701 23.2051 1.0715 Constraint 201 729 11.2525 14.0656 21.0984 1.0715 Constraint 176 742 11.9922 14.9902 22.4853 1.0715 Constraint 176 735 12.4912 15.6140 23.4210 1.0715 Constraint 169 729 11.8301 14.7876 22.1815 1.0715 Constraint 169 720 12.9801 16.2251 24.3377 1.0715 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 161 720 10.3047 12.8809 19.3214 1.0715 Constraint 153 729 11.8672 14.8340 22.2509 1.0715 Constraint 153 720 12.0457 15.0571 22.5857 1.0715 Constraint 153 636 10.4342 13.0427 19.5641 1.0715 Constraint 153 629 10.0957 12.6196 18.9294 1.0715 Constraint 355 544 11.2518 14.0647 21.0971 1.0163 Constraint 355 435 11.2011 14.0014 21.0021 1.0163 Constraint 350 544 9.6767 12.0958 18.1437 1.0163 Constraint 69 552 13.1495 16.4369 24.6553 1.0163 Constraint 69 272 13.4837 16.8546 25.2820 1.0163 Constraint 69 267 11.9432 14.9290 22.3935 1.0163 Constraint 69 250 13.1456 16.4320 24.6480 1.0163 Constraint 58 404 12.8536 16.0670 24.1005 1.0163 Constraint 58 382 12.4270 15.5338 23.3007 1.0163 Constraint 58 259 11.9272 14.9090 22.3636 1.0163 Constraint 58 242 11.5997 14.4997 21.7495 1.0163 Constraint 51 375 10.0852 12.6065 18.9097 1.0163 Constraint 51 368 13.4918 16.8647 25.2971 1.0163 Constraint 51 303 11.0510 13.8137 20.7206 1.0163 Constraint 51 292 11.3231 14.1539 21.2308 1.0163 Constraint 51 285 9.7781 12.2226 18.3339 1.0163 Constraint 51 267 12.8363 16.0454 24.0681 1.0163 Constraint 51 259 9.1874 11.4842 17.2263 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 242 8.0307 10.0384 15.0575 1.0163 Constraint 51 237 11.5867 14.4834 21.7251 1.0163 Constraint 51 221 12.1783 15.2229 22.8343 1.0163 Constraint 51 210 11.2287 14.0358 21.0537 1.0163 Constraint 41 375 13.3894 16.7368 25.1052 1.0163 Constraint 41 314 12.2865 15.3582 23.0373 1.0163 Constraint 41 285 12.9875 16.2344 24.3516 1.0163 Constraint 41 259 11.8259 14.7823 22.1735 1.0163 Constraint 41 250 11.3244 14.1556 21.2333 1.0163 Constraint 41 242 10.4645 13.0807 19.6210 1.0163 Constraint 122 676 11.8824 14.8530 22.2794 1.0005 Constraint 122 668 10.6343 13.2928 19.9392 1.0005 Constraint 96 676 11.1770 13.9712 20.9568 1.0005 Constraint 96 668 9.9528 12.4410 18.6615 1.0005 Constraint 88 644 11.7983 14.7479 22.1218 1.0005 Constraint 480 676 10.6674 13.3343 20.0014 1.0000 Constraint 467 698 11.4986 14.3733 21.5599 1.0000 Constraint 467 687 13.2135 16.5168 24.7752 1.0000 Constraint 467 676 13.0097 16.2622 24.3933 1.0000 Constraint 467 668 9.2723 11.5904 17.3856 1.0000 Constraint 461 668 12.7285 15.9106 23.8659 1.0000 Constraint 435 698 12.6245 15.7806 23.6709 1.0000 Constraint 435 687 13.4996 16.8745 25.3117 1.0000 Constraint 435 668 12.8660 16.0825 24.1238 1.0000 Constraint 429 698 11.7026 14.6283 21.9424 1.0000 Constraint 429 687 12.2809 15.3511 23.0266 1.0000 Constraint 429 676 13.3391 16.6739 25.0108 1.0000 Constraint 429 668 10.5215 13.1518 19.7277 1.0000 Constraint 412 698 13.2225 16.5282 24.7923 1.0000 Constraint 412 687 12.5515 15.6893 23.5340 1.0000 Constraint 404 706 12.6616 15.8270 23.7404 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 687 8.6870 10.8587 16.2881 1.0000 Constraint 404 676 10.9343 13.6678 20.5017 1.0000 Constraint 399 698 11.3454 14.1818 21.2726 1.0000 Constraint 399 687 10.0466 12.5582 18.8373 1.0000 Constraint 399 676 11.0780 13.8474 20.7712 1.0000 Constraint 382 698 10.8883 13.6103 20.4155 1.0000 Constraint 382 687 8.7387 10.9234 16.3851 1.0000 Constraint 382 676 11.7533 14.6916 22.0374 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 687 5.9127 7.3909 11.0863 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 368 698 12.6523 15.8153 23.7230 1.0000 Constraint 368 687 9.6089 12.0111 18.0167 1.0000 Constraint 368 676 11.3301 14.1626 21.2439 1.0000 Constraint 360 676 12.8172 16.0216 24.0323 1.0000 Constraint 350 622 12.8312 16.0390 24.0584 1.0000 Constraint 629 742 7.6822 9.6027 14.4041 0.9981 Constraint 629 735 5.9832 7.4790 11.2185 0.9981 Constraint 622 742 11.4098 14.2622 21.3933 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 622 729 8.4502 10.5627 15.8440 0.9981 Constraint 622 720 9.2851 11.6063 17.4095 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 613 729 12.4600 15.5750 23.3625 0.9981 Constraint 613 720 13.0024 16.2530 24.3795 0.9981 Constraint 604 742 8.0595 10.0744 15.1116 0.9981 Constraint 604 735 8.8596 11.0744 16.6117 0.9981 Constraint 604 720 11.8037 14.7546 22.1319 0.9981 Constraint 599 742 11.4013 14.2516 21.3774 0.9981 Constraint 599 735 10.9187 13.6484 20.4725 0.9981 Constraint 590 735 13.3750 16.7187 25.0781 0.9981 Constraint 590 729 10.3165 12.8956 19.3434 0.9981 Constraint 590 720 11.2758 14.0948 21.1421 0.9981 Constraint 585 742 12.4589 15.5736 23.3604 0.9981 Constraint 585 713 9.0195 11.2744 16.9116 0.9981 Constraint 585 698 11.7576 14.6970 22.0455 0.9981 Constraint 577 729 12.2472 15.3090 22.9635 0.9981 Constraint 577 676 11.9189 14.8986 22.3479 0.9981 Constraint 571 735 13.5507 16.9384 25.4076 0.9981 Constraint 571 668 12.2194 15.2742 22.9114 0.9981 Constraint 557 735 12.2675 15.3343 23.0015 0.9981 Constraint 557 698 10.5564 13.1955 19.7932 0.9981 Constraint 557 676 11.4879 14.3598 21.5397 0.9981 Constraint 557 668 10.3037 12.8796 19.3194 0.9981 Constraint 552 713 13.4750 16.8438 25.2657 0.9981 Constraint 552 698 10.9559 13.6949 20.5423 0.9981 Constraint 552 687 10.8262 13.5327 20.2990 0.9981 Constraint 552 668 12.1345 15.1682 22.7522 0.9981 Constraint 544 735 12.5709 15.7136 23.5704 0.9981 Constraint 544 713 12.9759 16.2199 24.3299 0.9981 Constraint 544 698 11.5817 14.4771 21.7156 0.9981 Constraint 544 687 12.4372 15.5465 23.3198 0.9981 Constraint 544 668 11.6643 14.5804 21.8706 0.9981 Constraint 544 657 8.6579 10.8224 16.2335 0.9981 Constraint 544 644 12.5570 15.6963 23.5444 0.9981 Constraint 535 742 11.6473 14.5592 21.8388 0.9981 Constraint 535 735 8.9201 11.1501 16.7251 0.9981 Constraint 535 729 13.2599 16.5749 24.8624 0.9981 Constraint 535 713 9.7139 12.1424 18.2135 0.9981 Constraint 535 706 12.4872 15.6090 23.4135 0.9981 Constraint 535 698 8.6861 10.8576 16.2864 0.9981 Constraint 535 687 9.2070 11.5087 17.2631 0.9981 Constraint 535 676 10.4339 13.0423 19.5635 0.9981 Constraint 527 742 13.5141 16.8926 25.3389 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 729 13.5009 16.8761 25.3142 0.9981 Constraint 527 720 13.3832 16.7289 25.0934 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 527 706 10.1745 12.7181 19.0772 0.9981 Constraint 519 735 11.1465 13.9331 20.8997 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 519 706 12.2041 15.2551 22.8827 0.9981 Constraint 519 687 10.3324 12.9155 19.3733 0.9981 Constraint 519 676 12.9489 16.1861 24.2791 0.9981 Constraint 511 742 11.6193 14.5241 21.7861 0.9981 Constraint 511 735 8.6213 10.7766 16.1649 0.9981 Constraint 511 729 11.9658 14.9573 22.4360 0.9981 Constraint 511 713 9.0139 11.2673 16.9010 0.9981 Constraint 511 706 12.4253 15.5316 23.2974 0.9981 Constraint 511 698 8.7420 10.9275 16.3912 0.9981 Constraint 511 687 11.0652 13.8315 20.7473 0.9981 Constraint 511 676 12.2781 15.3476 23.0214 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 497 706 8.3556 10.4446 15.6668 0.9981 Constraint 497 698 4.7218 5.9023 8.8534 0.9981 Constraint 497 687 7.2198 9.0248 13.5372 0.9981 Constraint 497 676 8.1861 10.2326 15.3489 0.9981 Constraint 489 742 12.8183 16.0229 24.0343 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 720 11.4156 14.2695 21.4043 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 489 706 8.2414 10.3018 15.4527 0.9981 Constraint 489 698 5.0606 6.3257 9.4886 0.9981 Constraint 489 687 8.4643 10.5803 15.8705 0.9981 Constraint 489 676 10.6549 13.3186 19.9779 0.9981 Constraint 480 742 12.9188 16.1485 24.2228 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 720 13.4710 16.8388 25.2581 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 330 480 7.3610 9.2013 13.8019 0.9981 Constraint 314 713 10.2837 12.8546 19.2819 0.9981 Constraint 314 698 9.6487 12.0609 18.0914 0.9981 Constraint 314 687 12.0074 15.0093 22.5140 0.9981 Constraint 285 713 13.1019 16.3773 24.5660 0.9981 Constraint 285 706 11.5531 14.4414 21.6621 0.9981 Constraint 285 698 10.3873 12.9841 19.4762 0.9981 Constraint 259 706 13.1192 16.3990 24.5985 0.9981 Constraint 136 404 8.4503 10.5629 15.8444 0.9981 Constraint 136 382 9.9465 12.4331 18.6497 0.9981 Constraint 104 713 11.7284 14.6605 21.9907 0.9981 Constraint 104 706 13.1073 16.3842 24.5762 0.9981 Constraint 104 698 11.8313 14.7891 22.1837 0.9981 Constraint 88 713 12.7865 15.9832 23.9747 0.9981 Constraint 88 706 12.6872 15.8590 23.7885 0.9981 Constraint 88 698 10.4801 13.1001 19.6501 0.9981 Constraint 88 676 13.2697 16.5872 24.8807 0.9981 Constraint 350 706 12.8779 16.0974 24.1461 0.9923 Constraint 279 698 10.3953 12.9942 19.4913 0.9923 Constraint 272 687 13.1441 16.4301 24.6451 0.9923 Constraint 350 636 11.6266 14.5332 21.7999 0.9878 Constraint 341 636 12.6914 15.8642 23.7963 0.9878 Constraint 330 629 7.7779 9.7224 14.5836 0.9878 Constraint 330 622 11.2743 14.0928 21.1393 0.9878 Constraint 303 651 11.4665 14.3331 21.4997 0.9878 Constraint 303 636 10.5455 13.1819 19.7728 0.9878 Constraint 297 622 10.2732 12.8415 19.2623 0.9878 Constraint 279 651 10.4253 13.0316 19.5474 0.9878 Constraint 279 629 9.2555 11.5694 17.3541 0.9878 Constraint 279 622 13.2206 16.5257 24.7886 0.9878 Constraint 267 651 13.5224 16.9030 25.3545 0.9878 Constraint 341 644 13.4780 16.8475 25.2712 0.9846 Constraint 303 644 11.6630 14.5787 21.8680 0.9846 Constraint 285 657 11.5080 14.3850 21.5775 0.9846 Constraint 285 644 11.1386 13.9233 20.8849 0.9846 Constraint 285 557 9.8546 12.3182 18.4774 0.9846 Constraint 272 552 11.8897 14.8621 22.2932 0.9846 Constraint 267 657 12.8653 16.0816 24.1225 0.9846 Constraint 267 644 12.3450 15.4313 23.1469 0.9846 Constraint 267 557 12.7585 15.9481 23.9222 0.9846 Constraint 267 552 10.6722 13.3403 20.0104 0.9846 Constraint 259 644 10.2038 12.7547 19.1321 0.9846 Constraint 250 644 12.1492 15.1865 22.7797 0.9846 Constraint 250 557 9.4593 11.8241 17.7361 0.9846 Constraint 242 651 12.8573 16.0716 24.1075 0.9846 Constraint 226 557 13.1217 16.4021 24.6032 0.9846 Constraint 221 651 12.1812 15.2265 22.8398 0.9846 Constraint 527 636 9.2852 11.6065 17.4097 0.9778 Constraint 519 636 9.9181 12.3977 18.5965 0.9778 Constraint 113 279 13.0300 16.2875 24.4312 0.8957 Constraint 113 267 12.2920 15.3649 23.0474 0.8957 Constraint 382 544 13.3153 16.6441 24.9662 0.8096 Constraint 375 544 12.2087 15.2609 22.8914 0.8096 Constraint 322 544 13.3711 16.7139 25.0708 0.8096 Constraint 314 544 12.4478 15.5597 23.3396 0.8096 Constraint 292 544 13.0130 16.2662 24.3993 0.8096 Constraint 267 622 12.9552 16.1940 24.2910 0.8096 Constraint 259 544 12.5763 15.7204 23.5806 0.8096 Constraint 250 544 11.6904 14.6130 21.9195 0.8096 Constraint 226 544 13.4433 16.8042 25.2062 0.8096 Constraint 221 544 12.2386 15.2983 22.9475 0.8096 Constraint 201 557 12.7717 15.9646 23.9469 0.8096 Constraint 201 552 9.7649 12.2062 18.3092 0.8096 Constraint 190 552 11.9564 14.9455 22.4183 0.8096 Constraint 182 557 11.9691 14.9614 22.4421 0.8096 Constraint 176 552 12.4742 15.5927 23.3891 0.8096 Constraint 153 651 10.3001 12.8751 19.3127 0.8096 Constraint 96 557 5.1863 6.4829 9.7244 0.8096 Constraint 544 729 12.9019 16.1274 24.1911 0.6667 Constraint 544 720 12.6604 15.8255 23.7383 0.6667 Constraint 435 644 12.3877 15.4846 23.2269 0.6667 Constraint 237 742 12.1392 15.1740 22.7609 0.6667 Constraint 226 742 12.6866 15.8582 23.7873 0.6667 Constraint 201 742 10.2861 12.8577 19.2865 0.6667 Constraint 190 742 12.8160 16.0200 24.0300 0.6667 Constraint 169 742 11.2226 14.0283 21.0425 0.6667 Constraint 169 735 11.7239 14.6549 21.9823 0.6667 Constraint 161 742 9.4543 11.8178 17.7267 0.6667 Constraint 161 735 8.4692 10.5866 15.8798 0.6667 Constraint 161 713 12.5922 15.7403 23.6104 0.6667 Constraint 153 742 12.1154 15.1443 22.7164 0.6667 Constraint 153 735 11.9781 14.9726 22.4588 0.6667 Constraint 144 720 12.8521 16.0651 24.0977 0.6667 Constraint 449 687 12.4188 15.5235 23.2852 0.5957 Constraint 136 687 11.5428 14.4285 21.6427 0.5957 Constraint 113 687 10.7676 13.4595 20.1892 0.5957 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 511 636 8.4084 10.5105 15.7658 0.5730 Constraint 421 687 13.1708 16.4635 24.6952 0.5730 Constraint 391 742 12.6700 15.8375 23.7562 0.5730 Constraint 391 735 13.3728 16.7159 25.0739 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 735 13.3124 16.6405 24.9608 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 360 735 12.5408 15.6760 23.5140 0.5730 Constraint 360 698 12.7750 15.9688 23.9532 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 355 698 11.0780 13.8475 20.7712 0.5730 Constraint 355 687 10.6953 13.3691 20.0536 0.5730 Constraint 355 668 5.3895 6.7369 10.1053 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 350 735 12.6027 15.7534 23.6301 0.5730 Constraint 350 698 13.0269 16.2837 24.4255 0.5730 Constraint 350 668 9.1543 11.4429 17.1644 0.5730 Constraint 341 742 12.2541 15.3177 22.9765 0.5730 Constraint 341 735 13.4893 16.8616 25.2924 0.5730 Constraint 341 687 12.2629 15.3286 22.9929 0.5730 Constraint 535 636 12.6563 15.8204 23.7306 0.4048 Constraint 259 668 11.1550 13.9437 20.9155 0.4048 Constraint 250 668 11.3309 14.1636 21.2454 0.4048 Constraint 250 657 12.2311 15.2888 22.9332 0.4048 Constraint 242 687 13.4638 16.8297 25.2446 0.4048 Constraint 242 676 13.3076 16.6345 24.9518 0.4048 Constraint 237 720 13.4446 16.8058 25.2087 0.4048 Constraint 237 698 4.3036 5.3795 8.0693 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 237 676 8.4658 10.5822 15.8733 0.4048 Constraint 237 668 5.1247 6.4058 9.6087 0.4048 Constraint 226 729 12.1941 15.2426 22.8639 0.4048 Constraint 226 698 6.4367 8.0458 12.0687 0.4048 Constraint 226 687 10.6659 13.3324 19.9986 0.4048 Constraint 226 676 10.9952 13.7440 20.6159 0.4048 Constraint 226 668 8.1171 10.1463 15.2195 0.4048 Constraint 221 687 12.9314 16.1643 24.2465 0.4048 Constraint 210 729 13.2184 16.5230 24.7844 0.4048 Constraint 210 687 10.0080 12.5100 18.7650 0.4048 Constraint 201 720 11.4116 14.2645 21.3968 0.4048 Constraint 201 698 4.5555 5.6944 8.5416 0.4048 Constraint 201 687 8.3711 10.4639 15.6959 0.4048 Constraint 190 729 11.2529 14.0661 21.0991 0.4048 Constraint 176 729 9.7777 12.2222 18.3333 0.4048 Constraint 176 720 12.3195 15.3993 23.0990 0.4048 Constraint 169 687 9.7608 12.2011 18.3016 0.4048 Constraint 161 698 11.5867 14.4834 21.7251 0.4048 Constraint 161 687 12.2665 15.3331 22.9997 0.4048 Constraint 161 676 8.0481 10.0601 15.0902 0.4048 Constraint 161 668 9.4978 11.8723 17.8084 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 153 668 6.2813 7.8517 11.7775 0.4048 Constraint 153 657 9.6250 12.0313 18.0470 0.4048 Constraint 144 687 13.5342 16.9178 25.3767 0.4048 Constraint 144 676 9.6590 12.0738 18.1107 0.4048 Constraint 128 698 10.4838 13.1047 19.6570 0.4048 Constraint 128 687 12.1862 15.2327 22.8491 0.4048 Constraint 122 698 11.9680 14.9599 22.4399 0.4048 Constraint 122 687 12.3092 15.3865 23.0797 0.4048 Constraint 96 698 12.6741 15.8426 23.7640 0.4048 Constraint 33 382 13.4922 16.8653 25.2979 0.3388 Constraint 33 375 11.0191 13.7738 20.6608 0.3388 Constraint 33 368 13.2850 16.6062 24.9093 0.3388 Constraint 33 360 12.7974 15.9967 23.9951 0.3388 Constraint 33 303 12.1803 15.2254 22.8380 0.3388 Constraint 33 292 13.1632 16.4540 24.6810 0.3388 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 267 12.1135 15.1419 22.7129 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 33 237 13.1593 16.4492 24.6737 0.3388 Constraint 33 221 13.0255 16.2819 24.4228 0.3388 Constraint 161 399 13.4901 16.8626 25.2939 0.3000 Constraint 161 391 13.3985 16.7481 25.1222 0.3000 Constraint 80 382 9.9136 12.3919 18.5879 0.1000 Constraint 80 279 13.1194 16.3993 24.5989 0.1000 Constraint 80 272 12.3456 15.4320 23.1480 0.1000 Constraint 80 267 12.3518 15.4397 23.1595 0.1000 Constraint 80 190 12.5895 15.7368 23.6053 0.1000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 735 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 742 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 735 0.8000 1.0000 1.5000 0.0000 Constraint 585 729 0.8000 1.0000 1.5000 0.0000 Constraint 585 720 0.8000 1.0000 1.5000 0.0000 Constraint 585 676 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 735 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 742 0.8000 1.0000 1.5000 0.0000 Constraint 571 676 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 742 0.8000 1.0000 1.5000 0.0000 Constraint 557 729 0.8000 1.0000 1.5000 0.0000 Constraint 557 720 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 735 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 720 0.8000 1.0000 1.5000 0.0000 Constraint 552 706 0.8000 1.0000 1.5000 0.0000 Constraint 552 676 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 742 0.8000 1.0000 1.5000 0.0000 Constraint 544 676 0.8000 1.0000 1.5000 0.0000 Constraint 544 636 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 720 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 742 0.8000 1.0000 1.5000 0.0000 Constraint 519 729 0.8000 1.0000 1.5000 0.0000 Constraint 519 720 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 720 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 706 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 698 0.8000 1.0000 1.5000 0.0000 Constraint 461 687 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 668 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 687 0.8000 1.0000 1.5000 0.0000 Constraint 442 676 0.8000 1.0000 1.5000 0.0000 Constraint 442 668 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 676 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 706 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 742 0.8000 1.0000 1.5000 0.0000 Constraint 421 735 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 706 0.8000 1.0000 1.5000 0.0000 Constraint 421 698 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 676 0.8000 1.0000 1.5000 0.0000 Constraint 412 644 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 742 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 706 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 698 0.8000 1.0000 1.5000 0.0000 Constraint 391 676 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 742 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 706 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 742 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 706 0.8000 1.0000 1.5000 0.0000 Constraint 368 544 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 706 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 720 0.8000 1.0000 1.5000 0.0000 Constraint 355 713 0.8000 1.0000 1.5000 0.0000 Constraint 355 706 0.8000 1.0000 1.5000 0.0000 Constraint 355 676 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 713 0.8000 1.0000 1.5000 0.0000 Constraint 350 687 0.8000 1.0000 1.5000 0.0000 Constraint 350 676 0.8000 1.0000 1.5000 0.0000 Constraint 350 613 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 729 0.8000 1.0000 1.5000 0.0000 Constraint 341 467 0.8000 1.0000 1.5000 0.0000 Constraint 341 461 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 735 0.8000 1.0000 1.5000 0.0000 Constraint 330 729 0.8000 1.0000 1.5000 0.0000 Constraint 330 467 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 729 0.8000 1.0000 1.5000 0.0000 Constraint 314 720 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 687 0.8000 1.0000 1.5000 0.0000 Constraint 303 622 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 729 0.8000 1.0000 1.5000 0.0000 Constraint 297 511 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 720 0.8000 1.0000 1.5000 0.0000 Constraint 292 687 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 720 0.8000 1.0000 1.5000 0.0000 Constraint 285 687 0.8000 1.0000 1.5000 0.0000 Constraint 285 676 0.8000 1.0000 1.5000 0.0000 Constraint 285 668 0.8000 1.0000 1.5000 0.0000 Constraint 285 651 0.8000 1.0000 1.5000 0.0000 Constraint 285 636 0.8000 1.0000 1.5000 0.0000 Constraint 285 544 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 729 0.8000 1.0000 1.5000 0.0000 Constraint 279 687 0.8000 1.0000 1.5000 0.0000 Constraint 279 613 0.8000 1.0000 1.5000 0.0000 Constraint 279 590 0.8000 1.0000 1.5000 0.0000 Constraint 279 557 0.8000 1.0000 1.5000 0.0000 Constraint 279 535 0.8000 1.0000 1.5000 0.0000 Constraint 279 519 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 497 0.8000 1.0000 1.5000 0.0000 Constraint 279 461 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 729 0.8000 1.0000 1.5000 0.0000 Constraint 272 613 0.8000 1.0000 1.5000 0.0000 Constraint 272 557 0.8000 1.0000 1.5000 0.0000 Constraint 272 535 0.8000 1.0000 1.5000 0.0000 Constraint 272 511 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 720 0.8000 1.0000 1.5000 0.0000 Constraint 267 713 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 676 0.8000 1.0000 1.5000 0.0000 Constraint 267 668 0.8000 1.0000 1.5000 0.0000 Constraint 267 636 0.8000 1.0000 1.5000 0.0000 Constraint 267 613 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 535 0.8000 1.0000 1.5000 0.0000 Constraint 267 511 0.8000 1.0000 1.5000 0.0000 Constraint 267 461 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 713 0.8000 1.0000 1.5000 0.0000 Constraint 259 687 0.8000 1.0000 1.5000 0.0000 Constraint 259 676 0.8000 1.0000 1.5000 0.0000 Constraint 259 651 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 687 0.8000 1.0000 1.5000 0.0000 Constraint 250 676 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 636 0.8000 1.0000 1.5000 0.0000 Constraint 250 467 0.8000 1.0000 1.5000 0.0000 Constraint 250 330 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 742 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 713 0.8000 1.0000 1.5000 0.0000 Constraint 242 706 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 735 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 355 0.8000 1.0000 1.5000 0.0000 Constraint 237 330 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 735 0.8000 1.0000 1.5000 0.0000 Constraint 226 720 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 706 0.8000 1.0000 1.5000 0.0000 Constraint 226 535 0.8000 1.0000 1.5000 0.0000 Constraint 226 375 0.8000 1.0000 1.5000 0.0000 Constraint 226 355 0.8000 1.0000 1.5000 0.0000 Constraint 226 350 0.8000 1.0000 1.5000 0.0000 Constraint 226 341 0.8000 1.0000 1.5000 0.0000 Constraint 226 330 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 742 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 729 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 713 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 742 0.8000 1.0000 1.5000 0.0000 Constraint 210 735 0.8000 1.0000 1.5000 0.0000 Constraint 210 720 0.8000 1.0000 1.5000 0.0000 Constraint 210 713 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 706 0.8000 1.0000 1.5000 0.0000 Constraint 201 382 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 355 0.8000 1.0000 1.5000 0.0000 Constraint 201 350 0.8000 1.0000 1.5000 0.0000 Constraint 201 341 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 735 0.8000 1.0000 1.5000 0.0000 Constraint 190 720 0.8000 1.0000 1.5000 0.0000 Constraint 190 713 0.8000 1.0000 1.5000 0.0000 Constraint 190 557 0.8000 1.0000 1.5000 0.0000 Constraint 190 544 0.8000 1.0000 1.5000 0.0000 Constraint 190 535 0.8000 1.0000 1.5000 0.0000 Constraint 190 511 0.8000 1.0000 1.5000 0.0000 Constraint 190 497 0.8000 1.0000 1.5000 0.0000 Constraint 190 461 0.8000 1.0000 1.5000 0.0000 Constraint 190 382 0.8000 1.0000 1.5000 0.0000 Constraint 190 375 0.8000 1.0000 1.5000 0.0000 Constraint 190 368 0.8000 1.0000 1.5000 0.0000 Constraint 190 355 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 742 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 557 0.8000 1.0000 1.5000 0.0000 Constraint 176 544 0.8000 1.0000 1.5000 0.0000 Constraint 176 519 0.8000 1.0000 1.5000 0.0000 Constraint 176 489 0.8000 1.0000 1.5000 0.0000 Constraint 176 382 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 368 0.8000 1.0000 1.5000 0.0000 Constraint 176 355 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 713 0.8000 1.0000 1.5000 0.0000 Constraint 169 382 0.8000 1.0000 1.5000 0.0000 Constraint 169 375 0.8000 1.0000 1.5000 0.0000 Constraint 169 368 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 404 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 360 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 341 0.8000 1.0000 1.5000 0.0000 Constraint 161 330 0.8000 1.0000 1.5000 0.0000 Constraint 161 314 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 285 0.8000 1.0000 1.5000 0.0000 Constraint 161 279 0.8000 1.0000 1.5000 0.0000 Constraint 161 267 0.8000 1.0000 1.5000 0.0000 Constraint 161 259 0.8000 1.0000 1.5000 0.0000 Constraint 161 250 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 713 0.8000 1.0000 1.5000 0.0000 Constraint 153 706 0.8000 1.0000 1.5000 0.0000 Constraint 153 382 0.8000 1.0000 1.5000 0.0000 Constraint 153 375 0.8000 1.0000 1.5000 0.0000 Constraint 153 368 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 303 0.8000 1.0000 1.5000 0.0000 Constraint 153 279 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 742 0.8000 1.0000 1.5000 0.0000 Constraint 144 735 0.8000 1.0000 1.5000 0.0000 Constraint 144 729 0.8000 1.0000 1.5000 0.0000 Constraint 144 713 0.8000 1.0000 1.5000 0.0000 Constraint 144 706 0.8000 1.0000 1.5000 0.0000 Constraint 144 698 0.8000 1.0000 1.5000 0.0000 Constraint 144 382 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 368 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 350 0.8000 1.0000 1.5000 0.0000 Constraint 144 330 0.8000 1.0000 1.5000 0.0000 Constraint 144 303 0.8000 1.0000 1.5000 0.0000 Constraint 144 285 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 267 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 742 0.8000 1.0000 1.5000 0.0000 Constraint 136 735 0.8000 1.0000 1.5000 0.0000 Constraint 136 729 0.8000 1.0000 1.5000 0.0000 Constraint 136 720 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 698 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 355 0.8000 1.0000 1.5000 0.0000 Constraint 136 279 0.8000 1.0000 1.5000 0.0000 Constraint 136 267 0.8000 1.0000 1.5000 0.0000 Constraint 136 250 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 742 0.8000 1.0000 1.5000 0.0000 Constraint 128 735 0.8000 1.0000 1.5000 0.0000 Constraint 128 729 0.8000 1.0000 1.5000 0.0000 Constraint 128 720 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 375 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 713 0.8000 1.0000 1.5000 0.0000 Constraint 113 706 0.8000 1.0000 1.5000 0.0000 Constraint 113 698 0.8000 1.0000 1.5000 0.0000 Constraint 113 375 0.8000 1.0000 1.5000 0.0000 Constraint 113 368 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 687 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 577 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 544 0.8000 1.0000 1.5000 0.0000 Constraint 69 535 0.8000 1.0000 1.5000 0.0000 Constraint 69 226 0.8000 1.0000 1.5000 0.0000 Constraint 69 201 0.8000 1.0000 1.5000 0.0000 Constraint 69 190 0.8000 1.0000 1.5000 0.0000 Constraint 69 176 0.8000 1.0000 1.5000 0.0000 Constraint 69 161 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 585 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 557 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 535 0.8000 1.0000 1.5000 0.0000 Constraint 58 467 0.8000 1.0000 1.5000 0.0000 Constraint 58 442 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 412 0.8000 1.0000 1.5000 0.0000 Constraint 58 279 0.8000 1.0000 1.5000 0.0000 Constraint 58 272 0.8000 1.0000 1.5000 0.0000 Constraint 58 267 0.8000 1.0000 1.5000 0.0000 Constraint 58 250 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 221 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 169 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 153 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 442 0.8000 1.0000 1.5000 0.0000 Constraint 51 435 0.8000 1.0000 1.5000 0.0000 Constraint 51 412 0.8000 1.0000 1.5000 0.0000 Constraint 51 404 0.8000 1.0000 1.5000 0.0000 Constraint 51 391 0.8000 1.0000 1.5000 0.0000 Constraint 51 382 0.8000 1.0000 1.5000 0.0000 Constraint 51 350 0.8000 1.0000 1.5000 0.0000 Constraint 51 297 0.8000 1.0000 1.5000 0.0000 Constraint 51 279 0.8000 1.0000 1.5000 0.0000 Constraint 51 272 0.8000 1.0000 1.5000 0.0000 Constraint 51 226 0.8000 1.0000 1.5000 0.0000 Constraint 51 201 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 182 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 169 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 153 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 467 0.8000 1.0000 1.5000 0.0000 Constraint 41 461 0.8000 1.0000 1.5000 0.0000 Constraint 41 449 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 429 0.8000 1.0000 1.5000 0.0000 Constraint 41 421 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 368 0.8000 1.0000 1.5000 0.0000 Constraint 41 360 0.8000 1.0000 1.5000 0.0000 Constraint 41 350 0.8000 1.0000 1.5000 0.0000 Constraint 41 341 0.8000 1.0000 1.5000 0.0000 Constraint 41 330 0.8000 1.0000 1.5000 0.0000 Constraint 41 322 0.8000 1.0000 1.5000 0.0000 Constraint 41 303 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 292 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 267 0.8000 1.0000 1.5000 0.0000 Constraint 41 237 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 221 0.8000 1.0000 1.5000 0.0000 Constraint 41 210 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 144 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 480 0.8000 1.0000 1.5000 0.0000 Constraint 33 473 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 461 0.8000 1.0000 1.5000 0.0000 Constraint 33 449 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 429 0.8000 1.0000 1.5000 0.0000 Constraint 33 421 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 404 0.8000 1.0000 1.5000 0.0000 Constraint 33 399 0.8000 1.0000 1.5000 0.0000 Constraint 33 391 0.8000 1.0000 1.5000 0.0000 Constraint 33 350 0.8000 1.0000 1.5000 0.0000 Constraint 33 297 0.8000 1.0000 1.5000 0.0000 Constraint 33 279 0.8000 1.0000 1.5000 0.0000 Constraint 33 272 0.8000 1.0000 1.5000 0.0000 Constraint 33 226 0.8000 1.0000 1.5000 0.0000 Constraint 33 210 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 144 0.8000 1.0000 1.5000 0.0000 Constraint 33 136 0.8000 1.0000 1.5000 0.0000 Constraint 33 128 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: