parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 16.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint (T0311)F27.CB (T0311)R40.CB 7.5355 12.5591 16.3268 90.5403 Constraint (T0311)F27.CB (T0311)S39.CB 5.9239 9.8732 12.8351 90.5403 Constraint (T0311)F27.CB (T0311)A38.CB 3.3384 5.5640 7.2332 90.5403 Constraint (T0311)F27.CB (T0311)T37.CB 6.0956 10.1594 13.2072 90.5403 Constraint (T0311)L24.CB (T0311)R40.CB 6.3346 10.5576 13.7249 90.5403 Constraint (T0311)L24.CB (T0311)S39.CB 3.5866 5.9776 7.7709 90.5403 Constraint (T0311)L24.CB (T0311)A38.CB 3.0971 5.1618 6.7103 90.5403 Constraint (T0311)L24.CB (T0311)T37.CB 5.8761 9.7935 12.7316 90.5403 Constraint (T0311)L24.CB (T0311)I33.CB 5.9166 9.8609 12.8192 90.5403 Constraint (T0311)S23.CB (T0311)S39.CB 6.6729 11.1216 14.4580 90.5403 Constraint (T0311)S23.CB (T0311)A38.CB 5.8233 9.7056 12.6172 90.5403 Constraint (T0311)S23.CB (T0311)T37.CB 8.6325 14.3876 18.7038 90.5403 Constraint (T0311)S23.CB (T0311)I33.CB 7.9022 13.1704 17.1215 90.5403 Constraint (T0311)M31.CB (T0311)R40.CB 7.6742 12.7903 16.6274 89.5947 Constraint (T0311)E26.CB (T0311)S39.CB 7.7464 12.9106 16.7838 87.8820 Constraint (T0311)E26.CB (T0311)A38.CB 5.7776 9.6293 12.5181 87.8820 Constraint (T0311)E26.CB (T0311)T37.CB 8.3180 13.8633 18.0223 87.8820 Constraint (T0311)R25.CB (T0311)R40.CB 8.5335 14.2226 18.4893 87.8820 Constraint (T0311)R25.CB (T0311)S39.CB 6.0167 10.0278 13.0362 87.8820 Constraint (T0311)R25.CB (T0311)A38.CB 4.9868 8.3113 10.8047 87.8820 Constraint (T0311)R25.CB (T0311)T37.CB 6.9831 11.6386 15.1301 87.8820 Constraint (T0311)F27.CB (T0311)S36.CB 7.3486 12.2477 15.9220 87.7474 Constraint (T0311)L24.CB (T0311)S36.CB 5.5102 9.1836 11.9387 87.7474 Constraint (T0311)L24.CB (T0311)P35.CB 3.2458 5.4097 7.0326 87.7474 Constraint (T0311)L24.CB (T0311)A34.CB 5.9589 9.9315 12.9110 87.7474 Constraint (T0311)S23.CB (T0311)S36.CB 8.2715 13.7858 17.9216 87.7474 Constraint (T0311)S23.CB (T0311)P35.CB 5.3546 8.9243 11.6016 87.7474 Constraint (T0311)S23.CB (T0311)A34.CB 8.1963 13.6605 17.7586 87.7474 Constraint (T0311)F27.CB (T0311)L41.CB 5.7969 9.6615 12.5600 87.6284 Constraint (T0311)L24.CB (T0311)L41.CB 5.9621 9.9369 12.9179 87.6284 Constraint (T0311)A28.CB (T0311)R40.CB 6.5970 10.9951 14.2936 87.5403 Constraint (T0311)A28.CB (T0311)S39.CB 5.1937 8.6561 11.2530 87.5403 Constraint (T0311)A28.CB (T0311)A38.CB 2.8086 4.6810 6.0853 87.5403 Constraint (T0311)A28.CB (T0311)T37.CB 4.2218 7.0364 9.1473 87.5403 Constraint (T0311)M31.CB (T0311)L41.CB 5.8517 9.7528 12.6786 86.6829 Constraint (T0311)V22.CB (T0311)S39.CB 7.9233 13.2056 17.1672 85.6452 Constraint (T0311)V22.CB (T0311)A38.CB 6.2243 10.3739 13.4861 85.6452 Constraint (T0311)F27.CB (T0311)L42.CB 5.4605 9.1008 11.8311 85.5352 Constraint (T0311)L24.CB (T0311)L42.CB 4.4686 7.4476 9.6819 85.5352 Constraint (T0311)S23.CB (T0311)L42.CB 7.0470 11.7450 15.2685 85.5352 Constraint (T0311)S23.CB (T0311)L41.CB 8.7039 14.5065 18.8584 85.5352 Constraint (T0311)E26.CB (T0311)P35.CB 5.7320 9.5533 12.4193 85.0891 Constraint (T0311)R25.CB (T0311)S36.CB 6.3863 10.6439 13.8370 85.0891 Constraint (T0311)R25.CB (T0311)P35.CB 3.2009 5.3348 6.9352 85.0891 Constraint (T0311)R25.CB (T0311)A34.CB 5.8094 9.6823 12.5870 85.0891 Constraint (T0311)A30.CB (T0311)L41.CB 8.2183 13.6972 17.8063 84.9702 Constraint (T0311)E26.CB (T0311)L41.CB 8.7856 14.6427 19.0355 84.9702 Constraint (T0311)R25.CB (T0311)L41.CB 8.3952 13.9920 18.1896 84.9702 Constraint (T0311)R29.CB (T0311)S39.CB 8.2087 13.6811 17.7854 84.8820 Constraint (T0311)R29.CB (T0311)A38.CB 5.7993 9.6655 12.5651 84.8820 Constraint (T0311)E32.CB (T0311)L41.CB 8.1369 13.5616 17.6300 84.7917 Constraint (T0311)V22.CB (T0311)M31.CB 6.7886 11.3143 14.7086 84.6996 Constraint (T0311)V22.CB (T0311)I33.CB 8.0599 13.4331 17.4631 84.6746 Constraint (T0311)A28.CB (T0311)L41.CB 6.0445 10.0741 13.0964 84.6284 Constraint (T0311)I33.CB (T0311)L42.CB 6.9616 11.6026 15.0834 83.5350 Constraint (T0311)R25.CB (T0311)L42.CB 7.5760 12.6267 16.4147 82.8770 Constraint (T0311)V22.CB (T0311)P35.CB 7.2732 12.1221 15.7587 82.8523 Constraint (T0311)L24.CB (T0311)T43.CB 6.4172 10.6954 13.9040 82.7317 Constraint (T0311)V22.CB (T0311)L42.CB 6.9438 11.5729 15.0448 82.5814 Constraint (T0311)V22.CB (T0311)L41.CB 8.3039 13.8399 17.9918 82.5814 Constraint (T0311)A28.CB (T0311)L42.CB 6.4575 10.7626 13.9913 82.5352 Constraint (T0311)R40.CB (T0311)L56.CB 7.2764 12.1274 15.7656 82.3719 Constraint (T0311)E26.CB (T0311)S36.CB 8.7275 14.5458 18.9095 82.2524 Constraint (T0311)A30.CB (T0311)S39.CB 8.8594 14.7656 19.1953 82.0288 Constraint (T0311)M31.CB (T0311)L42.CB 7.2927 12.1545 15.8009 82.0187 Constraint (T0311)S39.CB (T0311)L56.CB 7.4146 12.3577 16.0650 81.3738 Constraint (T0311)I33.CB (T0311)T43.CB 8.5157 14.1929 18.4507 80.7315 Constraint (T0311)E26.CB (T0311)L42.CB 7.9378 13.2296 17.1985 80.3060 Constraint (T0311)F27.CB (T0311)T43.CB 8.1608 13.6013 17.6816 80.1608 Constraint (T0311)R40.CB (T0311)A53.CB 7.6145 12.6909 16.4981 79.8809 Constraint (T0311)A38.CB (T0311)A53.CB 7.1469 11.9115 15.4850 79.8809 Constraint (T0311)T37.CB (T0311)A53.CB 7.2373 12.0622 15.6809 79.8809 Constraint (T0311)L41.CB (T0311)S57.CB 6.8240 11.3733 14.7853 79.4600 Constraint (T0311)L41.CB (T0311)L56.CB 4.6873 7.8121 10.1557 79.4600 Constraint (T0311)I33.CB (T0311)K45.CB 8.2701 13.7834 17.9185 79.3021 Constraint (T0311)A38.CB (T0311)S57.CB 7.7715 12.9525 16.8382 79.0736 Constraint (T0311)L24.CB (T0311)K45.CB 8.1522 13.5870 17.6630 78.7314 Constraint (T0311)S36.CB (T0311)K45.CB 6.5316 10.8860 14.1518 78.5094 Constraint (T0311)L41.CB (T0311)I54.CB 7.4405 12.4009 16.1212 78.3514 Constraint (T0311)A38.CB (T0311)L56.CB 4.8115 8.0192 10.4250 78.3386 Constraint (T0311)T37.CB (T0311)L56.CB 6.1207 10.2012 13.2615 78.3386 Constraint (T0311)F27.CB (T0311)S57.CB 6.8598 11.4330 14.8629 78.3386 Constraint (T0311)F27.CB (T0311)L56.CB 4.4614 7.4357 9.6664 78.3386 Constraint (T0311)L24.CB (T0311)L56.CB 6.8409 11.4015 14.8220 78.3386 Constraint (T0311)T37.CB (T0311)A46.CB 5.4687 9.1146 11.8489 78.3081 Constraint (T0311)M31.CB (T0311)L56.CB 3.7481 6.2469 8.1209 77.3930 Constraint (T0311)A34.CB (T0311)T43.CB 8.3241 13.8735 18.0355 77.3679 Constraint (T0311)L42.CB (T0311)L56.CB 6.0537 10.0895 13.1163 77.3668 Constraint (T0311)T37.CB (T0311)K55.CB 6.7540 11.2567 14.6337 77.2617 Constraint (T0311)A28.CB (T0311)T43.CB 8.3102 13.8503 18.0053 77.1608 Constraint (T0311)R29.CB (T0311)L41.CB 8.8274 14.7124 19.1261 77.0722 Constraint (T0311)L42.CB (T0311)A53.CB 7.3615 12.2692 15.9500 76.9691 Constraint (T0311)L41.CB (T0311)A53.CB 5.1028 8.5047 11.0561 76.9691 Constraint (T0311)F27.CB (T0311)A53.CB 7.6712 12.7853 16.6209 76.7408 Constraint (T0311)A38.CB (T0311)K55.CB 6.5056 10.8427 14.0955 76.5453 Constraint (T0311)L17.CB (T0311)A38.CB 5.5036 9.1726 11.9244 76.5309 Constraint (T0311)L17.CB (T0311)F27.CB 3.6828 6.1379 7.9793 76.5309 Constraint (T0311)Q14.CB (T0311)A38.CB 6.2870 10.4783 13.6218 76.5309 Constraint (T0311)Q14.CB (T0311)F27.CB 6.1082 10.1803 13.2344 76.5309 Constraint (T0311)Q14.CB (T0311)L24.CB 5.9604 9.9341 12.9143 76.5309 Constraint (T0311)I33.CB (T0311)L56.CB 5.1009 8.5016 11.0521 76.3384 Constraint (T0311)M31.CB (T0311)I54.CB 6.0659 10.1098 13.1427 76.2844 Constraint (T0311)I33.CB (T0311)I54.CB 7.5479 12.5798 16.3537 76.2461 Constraint (T0311)I33.CB (T0311)K55.CB 5.0405 8.4008 10.9210 76.2453 Constraint (T0311)F27.CB (T0311)K55.CB 6.0385 10.0642 13.0835 76.2453 Constraint (T0311)L17.CB (T0311)S39.CB 6.8755 11.4592 14.8970 75.9352 Constraint (T0311)Q14.CB (T0311)S39.CB 6.5476 10.9127 14.1865 75.9352 Constraint (T0311)M31.CB (T0311)A53.CB 6.1596 10.2660 13.3458 75.9001 Constraint (T0311)A30.CB (T0311)L56.CB 5.5858 9.3096 12.1025 75.6803 Constraint (T0311)L41.CB (T0311)K55.CB 6.6456 11.0759 14.3987 75.6479 Constraint (T0311)L17.CB (T0311)P35.CB 7.5079 12.5131 16.2671 75.6352 Constraint (T0311)M31.CB (T0311)S57.CB 6.0901 10.1501 13.1951 75.6058 Constraint (T0311)D18.CB (T0311)F27.CB 6.4583 10.7639 13.9931 75.5603 Constraint (T0311)A30.CB (T0311)L42.CB 8.6719 14.4532 18.7892 75.4691 Constraint (T0311)V22.CB (T0311)L56.CB 6.7249 11.2082 14.5707 75.4127 Constraint (T0311)S23.CB (T0311)L56.CB 8.3568 13.9280 18.1064 75.3386 Constraint (T0311)A28.CB (T0311)L56.CB 5.8812 9.8020 12.7427 75.3386 Constraint (T0311)M31.CB (T0311)K55.CB 3.2571 5.4286 7.0572 75.2997 Constraint (T0311)L17.CB (T0311)M31.CB 6.8650 11.4416 14.8741 75.2853 Constraint (T0311)A38.CB (T0311)V59.CB 6.2913 10.4854 13.6311 75.0205 Constraint (T0311)I33.CB (T0311)A53.CB 6.9028 11.5046 14.9560 74.8455 Constraint (T0311)F27.CB (T0311)V58.CB 6.8317 11.3861 14.8020 74.5667 Constraint (T0311)I33.CB (T0311)S57.CB 7.9248 13.2081 17.1705 74.5512 Constraint (T0311)F27.CB (T0311)I54.CB 8.2261 13.7102 17.8233 74.2300 Constraint (T0311)E26.CB (T0311)L56.CB 7.2697 12.1162 15.7510 73.8931 Constraint (T0311)L17.CB (T0311)A30.CB 6.6513 11.0854 14.4111 73.8727 Constraint (T0311)L17.CB (T0311)E26.CB 5.2971 8.8286 11.4772 73.8727 Constraint (T0311)S16.CB (T0311)A38.CB 7.3453 12.2422 15.9149 73.8727 Constraint (T0311)S16.CB (T0311)F27.CB 5.4156 9.0260 11.7338 73.8727 Constraint (T0311)S16.CB (T0311)E26.CB 7.1979 11.9965 15.5955 73.8727 Constraint (T0311)E15.CB (T0311)F27.CB 7.3814 12.3023 15.9930 73.8727 Constraint (T0311)Q14.CB (T0311)E26.CB 8.1616 13.6027 17.6836 73.8727 Constraint (T0311)T37.CB (T0311)A47.CB 6.9523 11.5872 15.0634 73.8564 Constraint (T0311)A28.CB (T0311)A53.CB 8.5512 14.2521 18.5277 73.8456 Constraint (T0311)A34.CB (T0311)L56.CB 7.8462 13.0771 17.0002 73.7585 Constraint (T0311)E32.CB (T0311)L56.CB 6.4445 10.7409 13.9631 73.7146 Constraint (T0311)M31.CB (T0311)V58.CB 5.3432 8.9054 11.5770 73.6212 Constraint (T0311)L17.CB (T0311)L41.CB 6.6050 11.0083 14.3107 73.6191 Constraint (T0311)Q14.CB (T0311)L41.CB 5.9017 9.8361 12.7870 73.6191 Constraint (T0311)P35.CB (T0311)L56.CB 7.8054 13.0089 16.9116 73.5455 Constraint (T0311)A34.CB (T0311)K55.CB 7.9341 13.2236 17.1907 73.4525 Constraint (T0311)A28.CB (T0311)K55.CB 6.4857 10.8094 14.0523 73.2453 Constraint (T0311)F27.CB (T0311)V59.CB 3.9628 6.6046 8.5860 73.2333 Constraint (T0311)A30.CB (T0311)I54.CB 7.8212 13.0353 16.9458 72.7845 Constraint (T0311)A30.CB (T0311)A53.CB 8.4552 14.0919 18.3195 72.7845 Constraint (T0311)L17.CB (T0311)A28.CB 6.4179 10.6964 13.9054 72.6352 Constraint (T0311)E32.CB (T0311)I54.CB 7.4098 12.3497 16.0546 72.6060 Constraint (T0311)I33.CB (T0311)V59.CB 6.0394 10.0656 13.0853 72.5666 Constraint (T0311)I33.CB (T0311)V58.CB 7.6841 12.8068 16.6489 72.5666 Constraint (T0311)L42.CB (T0311)S57.CB 7.8364 13.0606 16.9788 72.3748 Constraint (T0311)V22.CB (T0311)S57.CB 8.1392 13.5653 17.6349 72.3489 Constraint (T0311)M31.CB (T0311)V59.CB 3.6486 6.0811 7.9054 72.2877 Constraint (T0311)A38.CB (T0311)I54.CB 8.4058 14.0097 18.2125 72.2743 Constraint (T0311)L41.CB (T0311)V59.CB 7.2864 12.1439 15.7871 72.1086 Constraint (T0311)R25.CB (T0311)L56.CB 8.2875 13.8125 17.9563 71.8929 Constraint (T0311)A46.CB (T0311)L56.CB 7.4341 12.3901 16.1071 71.8712 Constraint (T0311)A30.CB (T0311)S57.CB 7.1165 11.8608 15.4191 71.7999 Constraint (T0311)A30.CB (T0311)K55.CB 5.0623 8.4371 10.9682 71.7999 Constraint (T0311)E15.CB (T0311)L24.CB 8.1834 13.6390 17.7307 71.7794 Constraint (T0311)P35.CB (T0311)K45.CB 8.2626 13.7711 17.9024 71.7355 Constraint (T0311)A47.CB (T0311)L56.CB 7.8313 13.0521 16.9678 71.6225 Constraint (T0311)E32.CB (T0311)K55.CB 4.5079 7.5132 9.7671 71.6214 Constraint (T0311)L17.CB (T0311)L42.CB 4.9221 8.2035 10.6645 71.5258 Constraint (T0311)Q14.CB (T0311)L42.CB 3.7389 6.2314 8.1009 71.5258 Constraint (T0311)Q14.CB (T0311)S23.CB 6.9795 11.6326 15.1224 71.4434 Constraint (T0311)I13.CB (T0311)R40.CB 6.9082 11.5137 14.9677 71.4434 Constraint (T0311)I13.CB (T0311)S39.CB 6.4505 10.7509 13.9762 71.4434 Constraint (T0311)I13.CB (T0311)A38.CB 5.1166 8.5276 11.0859 71.4434 Constraint (T0311)I13.CB (T0311)F27.CB 4.9889 8.3149 10.8094 71.4434 Constraint (T0311)I13.CB (T0311)L24.CB 5.9693 9.9488 12.9334 71.4434 Constraint (T0311)L24.CB (T0311)V59.CB 7.1784 11.9640 15.5532 71.1401 Constraint (T0311)R40.CB (T0311)M52.CB 6.5391 10.8986 14.1681 71.1209 Constraint (T0311)S23.CB (T0311)E32.CB 9.3513 15.5855 20.2611 71.0420 Constraint (T0311)R29.CB (T0311)L56.CB 7.3214 12.2024 15.8631 70.8931 Constraint (T0311)A38.CB (T0311)A47.CB 8.0804 13.4673 17.5075 70.8565 Constraint (T0311)I13.CB (T0311)T37.CB 7.2663 12.1106 15.7437 70.8477 Constraint (T0311)I13.CB (T0311)P35.CB 8.1443 13.5738 17.6459 70.8477 Constraint (T0311)T43.CB (T0311)L56.CB 8.3043 13.8405 17.9926 70.5876 Constraint (T0311)Q14.CB (T0311)A28.CB 8.1356 13.5594 17.6272 70.5405 Constraint (T0311)E32.CB (T0311)A53.CB 8.0572 13.4286 17.4572 70.4399 Constraint (T0311)I13.CB (T0311)S23.CB 7.5697 12.6161 16.4009 70.4271 Constraint (T0311)Q14.CB (T0311)S57.CB 8.5463 14.2438 18.5170 70.0317 Constraint (T0311)L17.CB (T0311)R29.CB 7.6496 12.7493 16.5742 69.9769 Constraint (T0311)A30.CB (T0311)V58.CB 5.5346 9.2244 11.9917 69.8153 Constraint (T0311)L42.CB (T0311)V59.CB 7.9910 13.3183 17.3138 69.6487 Constraint (T0311)Q14.CB (T0311)R40.CB 7.6069 12.6782 16.4817 69.6448 Constraint (T0311)S36.CB (T0311)A46.CB 6.6179 11.0298 14.3387 69.6035 Constraint (T0311)I13.CB (T0311)V22.CB 6.0573 10.0956 13.1242 69.5022 Constraint (T0311)I12.CB (T0311)V22.CB 8.0391 13.3985 17.4181 69.4964 Constraint (T0311)L41.CB (T0311)V58.CB 8.4255 14.0425 18.2553 69.4583 Constraint (T0311)A38.CB (T0311)V58.CB 8.3365 13.8942 18.0625 69.4583 Constraint (T0311)T37.CB (T0311)M52.CB 5.0852 8.4754 11.0180 69.4020 Constraint (T0311)S16.CB (T0311)L42.CB 6.5087 10.8478 14.1021 68.8676 Constraint (T0311)E15.CB (T0311)L42.CB 6.4909 10.8181 14.0635 68.8676 Constraint (T0311)I12.CB (T0311)F27.CB 7.3796 12.2993 15.9890 68.8667 Constraint (T0311)A28.CB (T0311)K45.CB 8.8814 14.8023 19.2429 68.8332 Constraint (T0311)E26.CB (T0311)K55.CB 8.1170 13.5283 17.5868 68.8000 Constraint (T0311)R29.CB (T0311)K55.CB 7.0433 11.7388 15.2605 68.7999 Constraint (T0311)Q14.CB (T0311)T43.CB 6.0159 10.0264 13.0344 68.7223 Constraint (T0311)I13.CB (T0311)L42.CB 3.6463 6.0771 7.9003 68.5316 Constraint (T0311)I13.CB (T0311)L41.CB 4.1430 6.9050 8.9765 68.5316 Constraint (T0311)I12.CB (T0311)L42.CB 6.0404 10.0673 13.0875 68.5258 Constraint (T0311)I12.CB (T0311)L41.CB 6.4319 10.7198 13.9357 68.5258 Constraint (T0311)A30.CB (T0311)V59.CB 3.1111 5.1852 6.7407 68.4818 Constraint (T0311)E26.CB (T0311)V59.CB 5.4356 9.0593 11.7771 68.4818 Constraint (T0311)I13.CB (T0311)A28.CB 7.0869 11.8116 15.3551 68.4434 Constraint (T0311)A38.CB (T0311)M52.CB 5.7552 9.5919 12.4695 68.3856 Constraint (T0311)Q14.CB (T0311)P35.CB 8.5004 14.1674 18.4176 68.3456 Constraint (T0311)V22.CB (T0311)V59.CB 5.1429 8.5715 11.1430 68.2142 Constraint (T0311)L41.CB (T0311)M52.CB 4.8937 8.1562 10.6031 68.2090 Constraint (T0311)L41.CB (T0311)E51.CB 7.5751 12.6252 16.4127 68.2090 Constraint (T0311)S23.CB (T0311)V59.CB 7.3309 12.2181 15.8835 68.1401 Constraint (T0311)A28.CB (T0311)V59.CB 5.7541 9.5901 12.4671 68.1401 Constraint (T0311)K45.CB (T0311)L56.CB 8.4321 14.0535 18.2695 68.0404 Constraint (T0311)I13.CB (T0311)M31.CB 6.4506 10.7511 13.9764 67.9269 Constraint (T0311)R25.CB (T0311)V59.CB 7.5195 12.5325 16.2923 67.8151 Constraint (T0311)I13.CB (T0311)E26.CB 7.7132 12.8554 16.7120 67.7689 Constraint (T0311)E32.CB (T0311)V59.CB 5.8001 9.6669 12.5669 67.6366 Constraint (T0311)E32.CB (T0311)V58.CB 6.8449 11.4081 14.8306 67.6366 Constraint (T0311)L17.CB (T0311)S57.CB 7.3535 12.2559 15.9326 67.5965 Constraint (T0311)Q14.CB (T0311)L56.CB 6.9287 11.5478 15.0121 67.5965 Constraint (T0311)A28.CB (T0311)V58.CB 8.3306 13.8844 18.0497 67.4733 Constraint (T0311)I33.CB (T0311)M52.CB 4.6020 7.6701 9.9711 67.3876 Constraint (T0311)L24.CB (T0311)K55.CB 8.5710 14.2851 18.5706 67.2563 Constraint (T0311)T37.CB (T0311)T49.CB 6.5915 10.9858 14.2815 67.2518 Constraint (T0311)I13.CB (T0311)S57.CB 5.9546 9.9243 12.9016 67.2404 Constraint (T0311)I13.CB (T0311)I54.CB 7.9668 13.2779 17.2613 67.2404 Constraint (T0311)I12.CB (T0311)S39.CB 8.9725 14.9541 19.4403 67.2233 Constraint (T0311)L42.CB (T0311)M52.CB 7.4986 12.4976 16.2469 67.1927 Constraint (T0311)M31.CB (T0311)P50.CB 8.2286 13.7144 17.8287 67.1583 Constraint (T0311)A38.CB (T0311)I60.CB 6.7323 11.2205 14.5867 67.0627 Constraint (T0311)T37.CB (T0311)V59.CB 7.8132 13.0220 16.9286 66.9935 Constraint (T0311)L41.CB (T0311)P50.CB 7.4263 12.3772 16.0903 66.9110 Constraint (T0311)I13.CB (T0311)I33.CB 7.1939 11.9899 15.5868 66.8723 Constraint (T0311)I13.CB (T0311)T43.CB 6.3214 10.5357 13.6965 66.7444 Constraint (T0311)L42.CB (T0311)K55.CB 8.4134 14.0223 18.2289 66.6589 Constraint (T0311)I13.CB (T0311)A46.CB 7.0183 11.6971 15.2063 66.6210 Constraint (T0311)L17.CB (T0311)L56.CB 5.6579 9.4299 12.2588 66.5984 Constraint (T0311)S23.CB (T0311)T43.CB 9.0591 15.0985 19.6280 66.5367 Constraint (T0311)M31.CB (T0311)M52.CB 4.4646 7.4410 9.6733 66.4420 Constraint (T0311)M31.CB (T0311)E51.CB 6.2551 10.4252 13.5527 66.4420 Constraint (T0311)I33.CB (T0311)E51.CB 6.7936 11.3227 14.7195 66.4037 Constraint (T0311)R29.CB (T0311)L42.CB 9.0671 15.1118 19.6454 66.3166 Constraint (T0311)F27.CB (T0311)M52.CB 6.8345 11.3908 14.8081 66.1731 Constraint (T0311)L17.CB (T0311)T43.CB 7.7774 12.9623 16.8509 66.1514 Constraint (T0311)R40.CB (T0311)T49.CB 7.3483 12.2472 15.9214 66.0374 Constraint (T0311)A30.CB (T0311)M52.CB 7.2129 12.0215 15.6279 65.8731 Constraint (T0311)I13.CB (T0311)A53.CB 5.8756 9.7927 12.7305 65.8580 Constraint (T0311)A34.CB (T0311)K45.CB 7.9082 13.1804 17.1345 65.8294 Constraint (T0311)Q14.CB (T0311)V59.CB 8.2679 13.7798 17.9138 65.6673 Constraint (T0311)V22.CB (T0311)V58.CB 7.9133 13.1888 17.1454 65.5771 Constraint (T0311)D18.CB (T0311)L42.CB 6.4032 10.6720 13.8737 65.5355 Constraint (T0311)I13.CB (T0311)L56.CB 4.3155 7.1924 9.3502 65.5215 Constraint (T0311)R29.CB (T0311)V59.CB 5.6224 9.3707 12.1819 65.4818 Constraint (T0311)I12.CB (T0311)L24.CB 8.5264 14.2106 18.4738 65.4459 Constraint (T0311)S16.CB (T0311)L41.CB 7.3244 12.2073 15.8694 65.3899 Constraint (T0311)L24.CB (T0311)A46.CB 8.3484 13.9139 18.0881 65.3240 Constraint (T0311)S16.CB (T0311)A28.CB 8.1614 13.6023 17.6830 65.3114 Constraint (T0311)F27.CB (T0311)I60.CB 4.6089 7.6814 9.9858 65.2755 Constraint (T0311)L24.CB (T0311)I60.CB 7.3599 12.2665 15.9464 65.2755 Constraint (T0311)L41.CB (T0311)I60.CB 6.9361 11.5602 15.0283 65.1489 Constraint (T0311)L17.CB (T0311)R40.CB 8.4067 14.0112 18.2145 64.9806 Constraint (T0311)E15.CB (T0311)L56.CB 7.7620 12.9367 16.8177 64.9382 Constraint (T0311)S23.CB (T0311)R40.CB 9.2810 15.4684 20.1089 64.8644 Constraint (T0311)E26.CB (T0311)V58.CB 8.3475 13.9124 18.0862 64.8151 Constraint (T0311)S36.CB (T0311)L56.CB 8.4518 14.0863 18.3121 64.8051 Constraint (T0311)P35.CB (T0311)V59.CB 8.2052 13.6754 17.7780 64.6887 Constraint (T0311)L17.CB (T0311)V59.CB 5.7910 9.6517 12.5472 64.6692 Constraint (T0311)N21.CB (T0311)A30.CB 7.6025 12.6709 16.4722 64.5291 Constraint (T0311)A38.CB (T0311)L48.CB 5.9008 9.8347 12.7852 64.5166 Constraint (T0311)T37.CB (T0311)L48.CB 5.2894 8.8157 11.4604 64.5166 Constraint (T0311)I33.CB (T0311)T49.CB 6.8368 11.3947 14.8131 64.5166 Constraint (T0311)I13.CB (T0311)V58.CB 7.8535 13.0892 17.0160 64.5052 Constraint (T0311)I13.CB (T0311)K55.CB 7.2171 12.0284 15.6370 64.5052 Constraint (T0311)I33.CB (T0311)A46.CB 6.9544 11.5906 15.0678 64.4306 Constraint (T0311)A28.CB (T0311)M52.CB 6.6802 11.1337 14.4739 64.3876 Constraint (T0311)N21.CB (T0311)A38.CB 9.0705 15.1175 19.6527 64.3826 Constraint (T0311)M31.CB (T0311)I60.CB 5.7281 9.5468 12.4108 64.3299 Constraint (T0311)E32.CB (T0311)M52.CB 5.7714 9.6190 12.5048 64.2508 Constraint (T0311)E32.CB (T0311)E51.CB 6.6392 11.0653 14.3849 64.2508 Constraint (T0311)I13.CB (T0311)R25.CB 8.4439 14.0731 18.2950 64.1732 Constraint (T0311)T37.CB (T0311)E51.CB 7.4438 12.4063 16.1281 64.1338 Constraint (T0311)L48.CB (T0311)S57.CB 6.4589 10.7649 13.9943 64.0682 Constraint (T0311)E32.CB (T0311)S57.CB 8.1924 13.6540 17.7503 64.0599 Constraint (T0311)I13.CB (T0311)K45.CB 7.4032 12.3387 16.0403 64.0501 Constraint (T0311)D18.CB (T0311)A38.CB 7.7547 12.9245 16.8019 63.9969 Constraint (T0311)S16.CB (T0311)L56.CB 5.5742 9.2904 12.0775 63.9402 Constraint (T0311)Q14.CB (T0311)R25.CB 8.5452 14.2420 18.5146 63.6981 Constraint (T0311)L17.CB (T0311)V58.CB 8.2185 13.6976 17.8068 63.6094 Constraint (T0311)M31.CB (T0311)T49.CB 7.1156 11.8593 15.4171 63.5710 Constraint (T0311)M31.CB (T0311)L48.CB 6.3972 10.6619 13.8605 63.5710 Constraint (T0311)V22.CB (T0311)I60.CB 5.0375 8.3958 10.9145 63.3343 Constraint (T0311)S39.CB (T0311)L48.CB 7.1419 11.9032 15.4741 63.3022 Constraint (T0311)F27.CB (T0311)L48.CB 7.6176 12.6961 16.5049 63.3022 Constraint (T0311)L24.CB (T0311)L48.CB 8.6182 14.3637 18.6728 63.3022 Constraint (T0311)I12.CB (T0311)A38.CB 7.6478 12.7463 16.5702 63.2937 Constraint (T0311)S23.CB (T0311)I60.CB 7.7172 12.8620 16.7207 63.1823 Constraint (T0311)I13.CB (T0311)V59.CB 6.2725 10.4541 13.5903 63.1717 Constraint (T0311)A34.CB (T0311)M52.CB 6.9092 11.5153 14.9699 63.0803 Constraint (T0311)L42.CB (T0311)I60.CB 6.9358 11.5597 15.0276 63.0739 Constraint (T0311)S16.CB (T0311)A30.CB 6.7538 11.2564 14.6333 62.8919 Constraint (T0311)Q14.CB (T0311)T37.CB 8.4353 14.0589 18.2765 62.8803 Constraint (T0311)I33.CB (T0311)I60.CB 7.5820 12.6367 16.4277 62.7046 Constraint (T0311)S16.CB (T0311)S57.CB 5.8444 9.7407 12.6629 62.5450 Constraint (T0311)E15.CB (T0311)S57.CB 8.2487 13.7478 17.8721 62.5450 Constraint (T0311)I33.CB (T0311)L48.CB 6.0228 10.0380 13.0494 62.5164 Constraint (T0311)I12.CB (T0311)L56.CB 6.2661 10.4436 13.5766 62.5032 Constraint (T0311)P35.CB (T0311)K55.CB 8.6341 14.3901 18.7072 62.4633 Constraint (T0311)P50.CB (T0311)V59.CB 9.1338 15.2230 19.7899 62.3287 Constraint (T0311)Q14.CB (T0311)I60.CB 6.5399 10.8998 14.1697 62.3045 Constraint (T0311)I12.CB (T0311)S57.CB 6.3954 10.6590 13.8567 62.2032 Constraint (T0311)S39.CB (T0311)M52.CB 7.7533 12.9222 16.7988 62.1985 Constraint (T0311)T49.CB (T0311)V58.CB 8.5430 14.2383 18.5098 62.0836 Constraint (T0311)V22.CB (T0311)T37.CB 8.9368 14.8947 19.3631 61.8591 Constraint (T0311)S16.CB (T0311)K55.CB 8.2650 13.7750 17.9075 61.8469 Constraint (T0311)R29.CB (T0311)V58.CB 8.1001 13.5002 17.5502 61.8151 Constraint (T0311)I12.CB (T0311)A53.CB 6.7279 11.2132 14.5771 61.7324 Constraint (T0311)E32.CB (T0311)L48.CB 8.1863 13.6439 17.7370 61.6799 Constraint (T0311)L17.CB (T0311)T37.CB 8.1059 13.5099 17.5628 61.5008 Constraint (T0311)L20.CB (T0311)L42.CB 8.2004 13.6673 17.7675 61.4742 Constraint (T0311)L20.CB (T0311)A38.CB 8.1653 13.6088 17.6914 61.4742 Constraint (T0311)Q14.CB (T0311)M31.CB 8.1556 13.5926 17.6704 61.4510 Constraint (T0311)L17.CB (T0311)S62.CB 6.5824 10.9707 14.2619 61.3064 Constraint (T0311)L17.CB (T0311)I60.CB 4.4701 7.4502 9.6852 61.3064 Constraint (T0311)L20.CB (T0311)A30.CB 6.4797 10.7996 14.0394 61.2084 Constraint (T0311)S16.CB (T0311)V59.CB 6.0264 10.0440 13.0572 61.1152 Constraint (T0311)L48.CB (T0311)V58.CB 8.1912 13.6519 17.7475 61.0672 Constraint (T0311)Q14.CB (T0311)K45.CB 7.4984 12.4974 16.2466 61.0540 Constraint (T0311)N21.CB (T0311)L42.CB 9.1913 15.3188 19.9144 61.0300 Constraint (T0311)R40.CB (T0311)K55.CB 8.4089 14.0148 18.2192 60.9678 Constraint (T0311)T49.CB (T0311)V59.CB 9.0617 15.1028 19.6336 60.7501 Constraint (T0311)A30.CB (T0311)I60.CB 5.6124 9.3540 12.1602 60.5240 Constraint (T0311)E26.CB (T0311)I60.CB 6.5706 10.9509 14.2362 60.5240 Constraint (T0311)E15.CB (T0311)V59.CB 8.6882 14.4803 18.8244 60.5195 Constraint (T0311)S36.CB (T0311)L48.CB 7.8952 13.1586 17.1062 60.5093 Constraint (T0311)E32.CB (T0311)T49.CB 7.7864 12.9773 16.8705 60.4654 Constraint (T0311)N21.CB (T0311)V59.CB 7.7693 12.9488 16.8334 60.4585 Constraint (T0311)A38.CB (T0311)E51.CB 8.3633 13.9388 18.1204 60.4130 Constraint (T0311)S16.CB (T0311)V58.CB 7.3679 12.2798 15.9638 60.3555 Constraint (T0311)A38.CB (T0311)T49.CB 7.8647 13.1078 17.0401 60.3025 Constraint (T0311)A28.CB (T0311)L48.CB 7.7110 12.8517 16.7073 60.3022 Constraint (T0311)I54.CB (T0311)S63.CB 6.2933 10.4888 13.6354 60.2295 Constraint (T0311)A28.CB (T0311)I60.CB 7.2455 12.0759 15.6987 60.1823 Constraint (T0311)D18.CB (T0311)V59.CB 8.3913 13.9856 18.1812 60.1139 Constraint (T0311)D18.CB (T0311)L41.CB 8.4269 14.0449 18.2583 59.9624 Constraint (T0311)T43.CB (T0311)M52.CB 8.6005 14.3341 18.6344 59.8977 Constraint (T0311)I12.CB (T0311)V59.CB 8.1703 13.6171 17.7023 59.8717 Constraint (T0311)D18.CB (T0311)I60.CB 6.8938 11.4896 14.9365 59.7401 Constraint (T0311)E15.CB (T0311)A38.CB 8.1896 13.6493 17.7441 59.7383 Constraint (T0311)L48.CB (T0311)V59.CB 7.8930 13.1550 17.1015 59.7338 Constraint (T0311)I12.CB (T0311)T43.CB 8.0082 13.3471 17.3512 59.7338 Constraint (T0311)E19.CB (T0311)L42.CB 8.2799 13.7998 17.9397 59.7106 Constraint (T0311)I13.CB (T0311)A30.CB 7.4759 12.4598 16.1978 59.6956 Constraint (T0311)D18.CB (T0311)S39.CB 8.3753 13.9588 18.1465 59.6657 Constraint (T0311)A28.CB (T0311)S57.CB 8.4507 14.0844 18.3098 59.6572 Constraint (T0311)D18.CB (T0311)L56.CB 8.3405 13.9008 18.0710 59.6374 Constraint (T0311)F27.CB (T0311)S62.CB 7.5651 12.6084 16.3910 59.5192 Constraint (T0311)L17.CB (T0311)I33.CB 7.4184 12.3640 16.0732 59.5006 Constraint (T0311)S16.CB (T0311)S39.CB 8.8634 14.7723 19.2040 59.4747 Constraint (T0311)D11.CB (T0311)L42.CB 5.4705 9.1175 11.8528 59.4573 Constraint (T0311)D11.CB (T0311)L41.CB 6.7400 11.2334 14.6034 59.4573 Constraint (T0311)D11.CB (T0311)F27.CB 8.7840 14.6399 19.0319 59.4573 Constraint (T0311)P35.CB (T0311)A46.CB 8.1284 13.5474 17.6116 59.4371 Constraint (T0311)A34.CB (T0311)A46.CB 7.1730 11.9550 15.5415 59.4371 Constraint (T0311)I13.CB (T0311)R29.CB 8.9884 14.9807 19.4750 59.3020 Constraint (T0311)I13.CB (T0311)S62.CB 5.8459 9.7431 12.6660 59.2132 Constraint (T0311)I13.CB (T0311)I60.CB 4.4899 7.4831 9.7281 59.2132 Constraint (T0311)A53.CB (T0311)S62.CB 6.4417 10.7362 13.9571 59.1449 Constraint (T0311)V22.CB (T0311)K55.CB 8.1852 13.6420 17.7346 58.8285 Constraint (T0311)S16.CB (T0311)M31.CB 6.8636 11.4393 14.8711 58.7927 Constraint (T0311)S16.CB (T0311)I60.CB 3.7012 6.1687 8.0193 58.6481 Constraint (T0311)E15.CB (T0311)I60.CB 6.3988 10.6647 13.8641 58.6481 Constraint (T0311)Q14.CB (T0311)I33.CB 8.6550 14.4250 18.7525 58.4983 Constraint (T0311)I13.CB (T0311)S36.CB 8.7327 14.5546 18.9209 58.4893 Constraint (T0311)A53.CB (T0311)S63.CB 6.6058 11.0096 14.3125 58.4423 Constraint (T0311)S36.CB (T0311)M52.CB 7.8368 13.0613 16.9797 58.4075 Constraint (T0311)Q14.CB (T0311)S62.CB 7.7550 12.9250 16.8025 58.3946 Constraint (T0311)S16.CB (T0311)A53.CB 7.5125 12.5208 16.2771 58.0578 Constraint (T0311)I33.CB (T0311)A47.CB 8.3102 13.8504 18.0055 58.0486 Constraint (T0311)I13.CB (T0311)S63.CB 7.8343 13.0572 16.9744 58.0217 Constraint (T0311)R25.CB (T0311)I60.CB 8.6472 14.4120 18.7356 57.9531 Constraint (T0311)L17.CB (T0311)K55.CB 8.0669 13.4449 17.4783 57.9191 Constraint (T0311)D18.CB (T0311)S62.CB 8.2401 13.7335 17.8536 57.7988 Constraint (T0311)L17.CB (T0311)A53.CB 8.2277 13.7129 17.8268 57.7257 Constraint (T0311)I33.CB (T0311)P50.CB 8.4041 14.0069 18.2090 57.6192 Constraint (T0311)T37.CB (T0311)I54.CB 8.1877 13.6462 17.7401 57.5758 Constraint (T0311)A34.CB (T0311)L48.CB 7.6759 12.7932 16.6312 57.5093 Constraint (T0311)N21.CB (T0311)I60.CB 7.2681 12.1135 15.7475 57.4776 Constraint (T0311)I12.CB (T0311)M31.CB 7.9954 13.3256 17.3233 57.4572 Constraint (T0311)S16.CB (T0311)S63.CB 6.7872 11.3120 14.7056 57.4567 Constraint (T0311)L24.CB (T0311)M52.CB 8.3379 13.8965 18.0655 57.1841 Constraint (T0311)P35.CB (T0311)M52.CB 8.0971 13.4952 17.5438 57.0912 Constraint (T0311)A30.CB (T0311)E51.CB 8.4049 14.0082 18.2107 56.8963 Constraint (T0311)R29.CB (T0311)M52.CB 8.2991 13.8318 17.9813 56.8734 Constraint (T0311)D18.CB (T0311)T43.CB 8.7194 14.5323 18.8920 56.8724 Constraint (T0311)L20.CB (T0311)V58.CB 7.5462 12.5769 16.3500 56.8479 Constraint (T0311)L20.CB (T0311)S57.CB 7.4186 12.3643 16.0736 56.8479 Constraint (T0311)L20.CB (T0311)L56.CB 6.9666 11.6110 15.0943 56.8479 Constraint (T0311)Q14.CB (T0311)A46.CB 8.0603 13.4338 17.4640 56.8453 Constraint (T0311)E15.CB (T0311)L41.CB 7.6433 12.7388 16.5605 56.8265 Constraint (T0311)S16.CB (T0311)S62.CB 4.3273 7.2122 9.3758 56.5549 Constraint (T0311)A34.CB (T0311)V59.CB 8.4456 14.0760 18.2988 56.5365 Constraint (T0311)A28.CB (T0311)A46.CB 8.1327 13.5544 17.6208 56.4487 Constraint (T0311)F27.CB (T0311)A46.CB 8.4985 14.1641 18.4134 56.4068 Constraint (T0311)I12.CB (T0311)I60.CB 5.7011 9.5019 12.3525 56.2132 Constraint (T0311)E15.CB (T0311)S62.CB 6.7709 11.2849 14.6704 55.7363 Constraint (T0311)D18.CB (T0311)A28.CB 8.7911 14.6518 19.0473 55.6768 Constraint (T0311)L41.CB (T0311)S62.CB 8.5775 14.2959 18.5847 55.5578 Constraint (T0311)L20.CB (T0311)V59.CB 5.3953 8.9921 11.6898 55.5145 Constraint (T0311)A46.CB (T0311)K55.CB 8.4023 14.0039 18.2050 55.4858 Constraint (T0311)D18.CB (T0311)A30.CB 8.4887 14.1478 18.3921 55.3894 Constraint (T0311)D11.CB (T0311)T43.CB 6.4191 10.6984 13.9080 55.2772 Constraint (T0311)A28.CB (T0311)I54.CB 8.8754 14.7923 19.2300 55.2749 Constraint (T0311)I13.CB (T0311)A34.CB 8.8073 14.6789 19.0826 55.1990 Constraint (T0311)E15.CB (T0311)E26.CB 8.8613 14.7688 19.1995 55.0949 Constraint (T0311)I12.CB (T0311)K45.CB 8.8131 14.6884 19.0950 55.0540 Constraint (T0311)I12.CB (T0311)S62.CB 5.4583 9.0972 11.8264 55.0217 Constraint (T0311)R29.CB (T0311)I60.CB 7.7165 12.8609 16.7192 54.9531 Constraint (T0311)Q14.CB (T0311)A53.CB 8.4372 14.0620 18.2806 54.8879 Constraint (T0311)I13.CB (T0311)A47.CB 7.4506 12.4177 16.1431 54.8730 Constraint (T0311)M31.CB (T0311)A46.CB 7.9746 13.2911 17.2784 54.7288 Constraint (T0311)E51.CB (T0311)I60.CB 8.8804 14.8006 19.2408 54.6424 Constraint (T0311)R25.CB (T0311)T43.CB 9.1607 15.2678 19.8482 54.6356 Constraint (T0311)S36.CB (T0311)A47.CB 8.4892 14.1487 18.3933 54.6084 Constraint (T0311)V22.CB (T0311)S62.CB 7.3544 12.2574 15.9346 54.5142 Constraint (T0311)I12.CB (T0311)V58.CB 8.8351 14.7252 19.1427 54.4428 Constraint (T0311)S16.CB (T0311)I54.CB 8.5896 14.3160 18.6108 54.2837 Constraint (T0311)I12.CB (T0311)I54.CB 8.6142 14.3570 18.6641 54.1841 Constraint (T0311)D11.CB (T0311)A38.CB 8.3610 13.9350 18.1156 53.8842 Constraint (T0311)T37.CB (T0311)P50.CB 8.3249 13.8748 18.0373 53.7922 Constraint (T0311)S39.CB (T0311)I60.CB 8.6602 14.4337 18.7638 53.7595 Constraint (T0311)S16.CB (T0311)I33.CB 8.4752 14.1254 18.3630 53.6870 Constraint (T0311)S39.CB (T0311)A53.CB 8.5627 14.2711 18.5524 53.6584 Constraint (T0311)L56.CB (T0311)Q65.CB 7.7678 12.9464 16.8303 53.6219 Constraint (T0311)V22.CB (T0311)E32.CB 8.6532 14.4220 18.7486 53.3517 Constraint (T0311)V22.CB (T0311)A34.CB 9.0886 15.1476 19.6919 53.3478 Constraint (T0311)D11.CB (T0311)L56.CB 8.2157 13.6929 17.8007 53.3286 Constraint (T0311)I13.CB (T0311)M52.CB 6.6723 11.1204 14.4566 53.1801 Constraint (T0311)L17.CB (T0311)S36.CB 9.0774 15.1289 19.6676 53.1487 Constraint (T0311)L17.CB (T0311)A34.CB 9.0106 15.0177 19.5231 53.1487 Constraint (T0311)E19.CB (T0311)A30.CB 8.3428 13.9047 18.0761 53.0864 Constraint (T0311)E15.CB (T0311)S39.CB 9.1129 15.1881 19.7445 52.8796 Constraint (T0311)E15.CB (T0311)T43.CB 8.4840 14.1401 18.3821 52.7953 Constraint (T0311)D11.CB (T0311)L20.CB 9.0665 15.1108 19.6440 52.7723 Constraint (T0311)E19.CB (T0311)V59.CB 7.7511 12.9184 16.7940 52.5145 Constraint (T0311)D11.CB (T0311)S57.CB 8.9832 14.9720 19.4637 52.3743 Constraint (T0311)K55.CB (T0311)P64.CB 6.3997 10.6662 13.8660 52.3177 Constraint (T0311)I54.CB (T0311)P64.CB 4.1221 6.8701 8.9311 52.3177 Constraint (T0311)I13.CB (T0311)P64.CB 7.3442 12.2404 15.9125 52.1110 Constraint (T0311)E19.CB (T0311)L56.CB 8.2984 13.8307 17.9799 52.0490 Constraint (T0311)M31.CB (T0311)S62.CB 7.8632 13.1053 17.0369 52.0183 Constraint (T0311)S39.CB (T0311)V59.CB 8.5976 14.3294 18.6282 51.9824 Constraint (T0311)L20.CB (T0311)S62.CB 5.8909 9.8182 12.7636 51.8559 Constraint (T0311)L20.CB (T0311)I60.CB 4.2728 7.1214 9.2578 51.8559 Constraint (T0311)E19.CB (T0311)S62.CB 6.4556 10.7594 13.9872 51.8559 Constraint (T0311)E19.CB (T0311)I60.CB 5.8635 9.7724 12.7042 51.8559 Constraint (T0311)I12.CB (T0311)S63.CB 6.6780 11.1300 14.4690 51.8550 Constraint (T0311)I13.CB (T0311)L48.CB 5.6747 9.4579 12.2952 51.5236 Constraint (T0311)L20.CB (T0311)R29.CB 7.9401 13.2335 17.2035 51.4288 Constraint (T0311)Q14.CB (T0311)A30.CB 8.6135 14.3558 18.6626 51.3598 Constraint (T0311)F27.CB (T0311)K45.CB 8.8916 14.8193 19.2650 51.3402 Constraint (T0311)D11.CB (T0311)S39.CB 8.3673 13.9454 18.1290 51.2609 Constraint (T0311)D11.CB (T0311)K45.CB 7.9259 13.2099 17.1728 51.1591 Constraint (T0311)T37.CB (T0311)S57.CB 8.4117 14.0196 18.2254 51.0619 Constraint (T0311)E19.CB (T0311)S57.CB 8.3886 13.9809 18.1752 50.8576 Constraint (T0311)L42.CB (T0311)S62.CB 8.5379 14.2298 18.4987 50.7304 Constraint (T0311)A53.CB (T0311)P64.CB 3.7879 6.3131 8.2071 50.5306 Constraint (T0311)I12.CB (T0311)R40.CB 8.7824 14.6373 19.0285 50.1771 Constraint (T0311)L48.CB (T0311)I60.CB 7.5907 12.6511 16.4464 50.0571 Constraint (T0311)A53.CB (T0311)Q65.CB 6.1891 10.3151 13.4096 49.9190 Constraint (T0311)I12.CB (T0311)K55.CB 8.8840 14.8067 19.2488 49.8030 Constraint (T0311)D11.CB (T0311)V22.CB 9.0148 15.0247 19.5321 49.7941 Constraint (T0311)A28.CB (T0311)E51.CB 8.7808 14.6346 19.0250 49.6057 Constraint (T0311)S16.CB (T0311)P64.CB 7.5370 12.5616 16.3301 49.5449 Constraint (T0311)I54.CB (T0311)Q65.CB 6.8688 11.4480 14.8824 49.5142 Constraint (T0311)A30.CB (T0311)S62.CB 7.9725 13.2874 17.2737 49.3601 Constraint (T0311)D11.CB (T0311)A53.CB 8.5562 14.2603 18.5383 49.2994 Constraint (T0311)D11.CB (T0311)R40.CB 8.4539 14.0899 18.3168 49.2869 Constraint (T0311)E32.CB (T0311)I60.CB 7.9133 13.1889 17.1455 49.2112 Constraint (T0311)E15.CB (T0311)S63.CB 8.5820 14.3033 18.5943 49.1968 Constraint (T0311)L17.CB (T0311)S63.CB 8.8119 14.6865 19.0924 49.0621 Constraint (T0311)R25.CB (T0311)K55.CB 8.9391 14.8985 19.3680 48.9071 Constraint (T0311)L20.CB (T0311)M31.CB 7.4507 12.4179 16.1432 48.8558 Constraint (T0311)L41.CB (T0311)P64.CB 8.1444 13.5741 17.6463 48.6312 Constraint (T0311)P35.CB (T0311)L48.CB 8.4329 14.0548 18.2713 48.5299 Constraint (T0311)A34.CB (T0311)T49.CB 8.1947 13.6578 17.7552 48.5299 Constraint (T0311)F27.CB (T0311)E51.CB 8.8825 14.8042 19.2454 48.4144 Constraint (T0311)L20.CB (T0311)K55.CB 8.7314 14.5523 18.9180 48.2771 Constraint (T0311)D11.CB (T0311)L24.CB 8.6995 14.4991 18.8488 48.2691 Constraint (T0311)D11.CB (T0311)S62.CB 8.1387 13.5645 17.6339 48.2366 Constraint (T0311)D11.CB (T0311)I60.CB 7.9278 13.2129 17.1768 48.2366 Constraint (T0311)A38.CB (T0311)S62.CB 8.9462 14.9103 19.3834 48.1997 Constraint (T0311)A34.CB (T0311)E51.CB 8.8071 14.6785 19.0820 47.7949 Constraint (T0311)P50.CB (T0311)I60.CB 9.1731 15.2885 19.8751 47.7326 Constraint (T0311)I12.CB (T0311)Q65.CB 6.9160 11.5267 14.9848 47.5123 Constraint (T0311)I12.CB (T0311)L48.CB 7.1075 11.8458 15.3996 47.3091 Constraint (T0311)L17.CB (T0311)M52.CB 8.4698 14.1164 18.3513 47.1715 Constraint (T0311)I12.CB (T0311)P64.CB 6.9959 11.6598 15.1577 47.1100 Constraint (T0311)E19.CB (T0311)A38.CB 9.0412 15.0686 19.5892 47.0865 Constraint (T0311)M52.CB (T0311)S62.CB 8.5424 14.2373 18.5084 46.8718 Constraint (T0311)L20.CB (T0311)S63.CB 8.6982 14.4970 18.8461 46.2850 Constraint (T0311)M31.CB (T0311)P64.CB 8.1224 13.5374 17.5986 45.8984 Constraint (T0311)Q14.CB (T0311)S36.CB 9.1052 15.1753 19.7278 45.8569 Constraint (T0311)E26.CB (T0311)S57.CB 8.9032 14.8386 19.2902 45.8178 Constraint (T0311)T37.CB (T0311)I60.CB 8.4092 14.0154 18.2200 45.3926 Constraint (T0311)I12.CB (T0311)A46.CB 8.0235 13.3725 17.3842 45.2837 Constraint (T0311)K55.CB (T0311)Q65.CB 9.0753 15.1255 19.6631 44.9393 Constraint (T0311)I13.CB (T0311)Q65.CB 8.1814 13.6357 17.7265 44.7383 Constraint (T0311)R40.CB (T0311)E51.CB 8.4474 14.0789 18.3026 44.7221 Constraint (T0311)T43.CB (T0311)A53.CB 8.1364 13.5606 17.6288 44.5772 Constraint (T0311)L48.CB (T0311)S62.CB 8.5326 14.2210 18.4874 44.3008 Constraint (T0311)A30.CB (T0311)L48.CB 8.7306 14.5509 18.9162 44.2100 Constraint (T0311)P50.CB (T0311)S63.CB 8.3621 13.9369 18.1180 43.9599 Constraint (T0311)E32.CB (T0311)P50.CB 8.8844 14.8074 19.2496 43.7236 Constraint (T0311)L17.CB (T0311)L48.CB 8.1725 13.6209 17.7071 43.3025 Constraint (T0311)S16.CB (T0311)L48.CB 8.1463 13.5772 17.6504 43.3025 Constraint (T0311)I13.CB (T0311)P50.CB 8.4215 14.0359 18.2466 43.0356 Constraint (T0311)L20.CB (T0311)L41.CB 9.1809 15.3016 19.8920 42.8598 Constraint (T0311)I13.CB (T0311)E32.CB 8.7977 14.6628 19.0617 42.6623 Constraint (T0311)D11.CB (T0311)A46.CB 7.8940 13.1567 17.1037 42.5975 Constraint (T0311)E19.CB (T0311)S63.CB 8.8296 14.7161 19.1309 42.3879 Constraint (T0311)I12.CB (T0311)M52.CB 8.2888 13.8146 17.9590 42.0178 Constraint (T0311)S39.CB (T0311)K55.CB 8.5927 14.3211 18.6175 41.9045 Constraint (T0311)L17.CB (T0311)E32.CB 8.9322 14.8870 19.3531 41.5422 Constraint (T0311)A34.CB (T0311)A53.CB 8.9123 14.8539 19.3100 41.3590 Constraint (T0311)D18.CB (T0311)M31.CB 8.9393 14.8988 19.3684 41.0945 Constraint (T0311)P50.CB (T0311)S62.CB 8.9943 14.9904 19.4875 40.9599 Constraint (T0311)S16.CB (T0311)Q65.CB 7.8850 13.1417 17.0842 40.8656 Constraint (T0311)D11.CB (T0311)L48.CB 7.9030 13.1716 17.1231 40.5432 Constraint (T0311)L17.CB (T0311)A46.CB 8.8130 14.6884 19.0949 40.3604 Constraint (T0311)P50.CB (T0311)Q65.CB 7.5678 12.6129 16.3968 40.1744 Constraint (T0311)N21.CB (T0311)S62.CB 8.7248 14.5414 18.9038 39.9508 Constraint (T0311)M52.CB (T0311)P64.CB 6.7010 11.1683 14.5188 39.7696 Constraint (T0311)E51.CB (T0311)P64.CB 6.7768 11.2947 14.6832 39.7696 Constraint (T0311)P50.CB (T0311)P64.CB 5.3182 8.8636 11.5227 39.7696 Constraint (T0311)A34.CB (T0311)A47.CB 8.7045 14.5074 18.8597 39.6263 Constraint (T0311)M31.CB (T0311)K45.CB 8.9918 14.9863 19.4821 39.5935 Constraint (T0311)E19.CB (T0311)V58.CB 9.2507 15.4178 20.0431 39.4403 Constraint (T0311)S16.CB (T0311)T43.CB 9.0499 15.0831 19.6081 39.4041 Constraint (T0311)T37.CB (T0311)V58.CB 8.7795 14.6325 19.0223 39.4028 Constraint (T0311)F27.CB (T0311)P64.CB 8.8372 14.7287 19.1474 39.3763 Constraint (T0311)A28.CB (T0311)T49.CB 8.6011 14.3352 18.6357 39.3229 Constraint (T0311)I12.CB (T0311)A47.CB 7.8332 13.0553 16.9719 39.2837 Constraint (T0311)L17.CB (T0311)P64.CB 8.5384 14.2307 18.4999 39.1730 Constraint (T0311)P35.CB (T0311)I60.CB 8.9035 14.8391 19.2909 39.1729 Constraint (T0311)I13.CB (T0311)T49.CB 8.0200 13.3666 17.3766 38.7457 Constraint (T0311)A46.CB (T0311)S57.CB 8.6148 14.3580 18.6654 38.4444 Constraint (T0311)S16.CB (T0311)M52.CB 8.4462 14.0770 18.3001 38.0294 Constraint (T0311)D11.CB (T0311)A47.CB 8.2496 13.7493 17.8741 37.8786 Constraint (T0311)L24.CB (T0311)S57.CB 8.6398 14.3996 18.7195 37.7974 Constraint (T0311)A47.CB (T0311)S57.CB 8.7391 14.5652 18.9348 37.7869 Constraint (T0311)Q14.CB (T0311)L48.CB 7.5608 12.6013 16.3817 37.7294 Constraint (T0311)S36.CB (T0311)T49.CB 8.7470 14.5784 18.9519 37.7096 Constraint (T0311)S57.CB (T0311)M66.CB 4.8639 8.1064 10.5383 37.3601 Constraint (T0311)L56.CB (T0311)M66.CB 6.7196 11.1994 14.5592 37.3601 Constraint (T0311)R29.CB (T0311)S57.CB 9.1238 15.2063 19.7682 37.2578 Constraint (T0311)L48.CB (T0311)P64.CB 6.6067 11.0112 14.3145 37.1987 Constraint (T0311)S36.CB (T0311)K55.CB 8.8503 14.7505 19.1757 37.1759 Constraint (T0311)D18.CB (T0311)S57.CB 9.1835 15.3058 19.8976 36.4739 Constraint (T0311)Q14.CB (T0311)A47.CB 8.8149 14.6916 19.0990 36.4470 Constraint (T0311)M31.CB (T0311)T43.CB 9.1690 15.2817 19.8662 36.1035 Constraint (T0311)E15.CB (T0311)A53.CB 8.6861 14.4768 18.8199 36.0255 Constraint (T0311)L17.CB (T0311)M66.CB 8.0762 13.4604 17.4985 35.8393 Constraint (T0311)Q14.CB (T0311)M66.CB 8.4042 14.0069 18.2090 35.8393 Constraint (T0311)A38.CB (T0311)P50.CB 8.7867 14.6446 19.0379 35.8005 Constraint (T0311)S16.CB (T0311)R25.CB 8.5329 14.2215 18.4880 35.7495 Constraint (T0311)E51.CB (T0311)S63.CB 9.1245 15.2075 19.7698 35.3869 Constraint (T0311)D18.CB (T0311)P35.CB 9.0270 15.0450 19.5584 35.3718 Constraint (T0311)V58.CB (T0311)W67.CB 6.6148 11.0247 14.3321 35.0892 Constraint (T0311)S57.CB (T0311)W67.CB 3.8470 6.4117 8.3353 35.0892 Constraint (T0311)L56.CB (T0311)W67.CB 4.7506 7.9177 10.2930 35.0892 Constraint (T0311)E15.CB (T0311)P64.CB 9.1279 15.2131 19.7771 34.8149 Constraint (T0311)L48.CB (T0311)Q65.CB 8.5089 14.1815 18.4360 34.6035 Constraint (T0311)V22.CB (T0311)M52.CB 9.1362 15.2270 19.7952 34.2630 Constraint (T0311)E32.CB (T0311)A46.CB 9.0900 15.1500 19.6950 33.7820 Constraint (T0311)I13.CB (T0311)M66.CB 6.2320 10.3866 13.5026 33.7461 Constraint (T0311)I12.CB (T0311)M66.CB 4.9699 8.2832 10.7682 33.7461 Constraint (T0311)M31.CB (T0311)A47.CB 8.8308 14.7179 19.1333 33.6439 Constraint (T0311)L17.CB (T0311)W67.CB 7.2034 12.0057 15.6074 33.5683 Constraint (T0311)K55.CB (T0311)M66.CB 8.7119 14.5198 18.8757 33.5480 Constraint (T0311)M52.CB (T0311)S63.CB 8.9719 14.9531 19.4390 33.4783 Constraint (T0311)A53.CB (T0311)W67.CB 4.3069 7.1782 9.3317 33.4007 Constraint (T0311)L41.CB (T0311)W67.CB 6.5706 10.9510 14.2363 33.2683 Constraint (T0311)A38.CB (T0311)W67.CB 8.0919 13.4866 17.5325 33.2683 Constraint (T0311)F27.CB (T0311)W67.CB 7.7693 12.9488 16.8334 33.2683 Constraint (T0311)S39.CB (T0311)T49.CB 8.9052 14.8420 19.2947 33.2214 Constraint (T0311)I13.CB (T0311)E51.CB 8.6192 14.3654 18.6750 33.0567 Constraint (T0311)K55.CB (T0311)W67.CB 6.8713 11.4522 14.8879 32.9959 Constraint (T0311)A53.CB (T0311)M66.CB 6.3278 10.5463 13.7102 32.9364 Constraint (T0311)Q14.CB (T0311)M52.CB 8.5492 14.2487 18.5233 32.6094 Constraint (T0311)I54.CB (T0311)M66.CB 7.2816 12.1360 15.7768 32.5316 Constraint (T0311)L48.CB (T0311)S63.CB 8.8699 14.7832 19.2181 32.4641 Constraint (T0311)A47.CB (T0311)P64.CB 8.2941 13.8235 17.9706 32.3431 Constraint (T0311)N21.CB (T0311)M31.CB 9.2288 15.3814 19.9958 32.1428 Constraint (T0311)L24.CB (T0311)A53.CB 8.9591 14.9319 19.4115 32.1134 Constraint (T0311)E19.CB (T0311)M66.CB 8.0896 13.4827 17.5275 31.9666 Constraint (T0311)L17.CB (T0311)I54.CB 9.1352 15.2253 19.7928 31.7987 Constraint (T0311)T49.CB (T0311)P64.CB 7.0424 11.7373 15.2585 31.6256 Constraint (T0311)I13.CB (T0311)W67.CB 4.7059 7.8432 10.1962 31.4751 Constraint (T0311)I54.CB (T0311)W67.CB 5.6467 9.4111 12.2345 31.2770 Constraint (T0311)L42.CB (T0311)W67.CB 7.1107 11.8511 15.4064 31.1751 Constraint (T0311)I12.CB (T0311)W67.CB 4.2668 7.1113 9.2447 31.1751 Constraint (T0311)S16.CB (T0311)M66.CB 5.6300 9.3833 12.1983 31.0878 Constraint (T0311)S16.CB (T0311)W67.CB 5.6089 9.3481 12.1526 30.6101 Constraint (T0311)M31.CB (T0311)W67.CB 7.6167 12.6945 16.5028 30.2295 Constraint (T0311)R40.CB (T0311)P50.CB 7.7830 12.9717 16.8632 30.2193 Constraint (T0311)N21.CB (T0311)L56.CB 9.1362 15.2270 19.7951 30.0562 Constraint (T0311)L20.CB (T0311)I33.CB 9.0237 15.0395 19.5514 29.9779 Constraint (T0311)E15.CB (T0311)M66.CB 7.1333 11.8888 15.4554 29.8734 Constraint (T0311)A46.CB (T0311)W67.CB 8.2467 13.7446 17.8679 29.3547 Constraint (T0311)A47.CB (T0311)W67.CB 7.2441 12.0735 15.6955 29.1914 Constraint (T0311)E15.CB (T0311)L48.CB 8.7610 14.6016 18.9821 28.7404 Constraint (T0311)M52.CB (T0311)Q65.CB 9.0309 15.0515 19.5669 28.5995 Constraint (T0311)D11.CB (T0311)M66.CB 7.7295 12.8825 16.7473 28.4674 Constraint (T0311)M31.CB (T0311)S63.CB 8.9432 14.9053 19.3769 28.4659 Constraint (T0311)E26.CB (T0311)S62.CB 9.0121 15.0202 19.5263 28.2949 Constraint (T0311)E26.CB (T0311)M52.CB 8.8573 14.7622 19.1908 27.8749 Constraint (T0311)T49.CB (T0311)I60.CB 9.4301 15.7169 20.4319 27.7003 Constraint (T0311)Q14.CB (T0311)W67.CB 6.7242 11.2070 14.5691 27.6953 Constraint (T0311)L41.CB (T0311)M66.CB 8.3487 13.9145 18.0889 27.4316 Constraint (T0311)L20.CB (T0311)M66.CB 8.2409 13.7348 17.8553 27.3025 Constraint (T0311)E19.CB (T0311)M31.CB 8.6453 14.4089 18.7316 27.2013 Constraint (T0311)L42.CB (T0311)I54.CB 7.7371 12.8952 16.7638 26.9892 Constraint (T0311)E15.CB (T0311)M31.CB 7.9794 13.2990 17.2886 26.8903 Constraint (T0311)S16.CB (T0311)R29.CB 7.7601 12.9335 16.8136 26.8022 Constraint (T0311)S39.CB (T0311)S57.CB 7.8139 13.0231 16.9301 26.7998 Constraint (T0311)L56.CB (T0311)L68.CB 6.9067 11.5112 14.9645 26.7157 Constraint (T0311)K55.CB (T0311)L68.CB 8.5086 14.1811 18.4354 26.7157 Constraint (T0311)I33.CB (T0311)W67.CB 8.6833 14.4722 18.8139 26.3416 Constraint (T0311)E51.CB (T0311)S62.CB 9.2137 15.3561 19.9629 26.1342 Constraint (T0311)A46.CB (T0311)I60.CB 8.9763 14.9605 19.4487 26.1326 Constraint (T0311)A53.CB (T0311)L68.CB 4.9947 8.3245 10.8218 26.1224 Constraint (T0311)V58.CB (T0311)L68.CB 8.3100 13.8500 18.0050 25.7176 Constraint (T0311)S57.CB (T0311)L68.CB 5.5948 9.3247 12.1221 25.7176 Constraint (T0311)I12.CB (T0311)A30.CB 7.5174 12.5290 16.2876 25.6992 Constraint (T0311)L41.CB (T0311)L68.CB 8.0427 13.4045 17.4259 25.6157 Constraint (T0311)I13.CB (T0311)L68.CB 7.1305 11.8841 15.4494 25.6157 Constraint (T0311)I12.CB (T0311)L68.CB 6.2003 10.3339 13.4341 25.6157 Constraint (T0311)F27.CB (T0311)T49.CB 8.7432 14.5720 18.9435 25.3040 Constraint (T0311)E15.CB (T0311)W67.CB 6.4424 10.7374 13.9586 25.0371 Constraint (T0311)A30.CB (T0311)P64.CB 9.2515 15.4191 20.0449 24.9689 Constraint (T0311)E15.CB (T0311)Q65.CB 8.8975 14.8292 19.2780 24.8850 Constraint (T0311)I54.CB (T0311)L68.CB 6.5795 10.9659 14.2557 24.7013 Constraint (T0311)D18.CB (T0311)W67.CB 8.3528 13.9213 18.0977 24.4841 Constraint (T0311)S16.CB (T0311)T37.CB 8.7472 14.5786 18.9522 23.8904 Constraint (T0311)V22.CB (T0311)W67.CB 8.3962 13.9936 18.1917 23.8226 Constraint (T0311)L20.CB (T0311)W67.CB 7.8499 13.0832 17.0082 23.8226 Constraint (T0311)R40.CB (T0311)I60.CB 8.5788 14.2980 18.5875 23.7823 Constraint (T0311)I12.CB (T0311)P50.CB 8.6500 14.4167 18.7416 23.7567 Constraint (T0311)A30.CB (T0311)W67.CB 9.0199 15.0332 19.5432 23.6833 Constraint (T0311)L20.CB (T0311)P64.CB 9.1108 15.1847 19.7402 22.9170 Constraint (T0311)D11.CB (T0311)W67.CB 6.3423 10.5705 13.7417 22.8944 Constraint (T0311)N21.CB (T0311)P35.CB 9.2709 15.4516 20.0870 22.3470 Constraint (T0311)A47.CB (T0311)L68.CB 6.8200 11.3667 14.7767 22.2986 Constraint (T0311)M52.CB (T0311)W67.CB 6.6116 11.0193 14.3252 21.9372 Constraint (T0311)E51.CB (T0311)W67.CB 7.8525 13.0875 17.0137 21.9372 Constraint (T0311)L42.CB (T0311)M66.CB 8.3171 13.8619 18.0205 21.9114 Constraint (T0311)E19.CB (T0311)W67.CB 7.4821 12.4702 16.2113 21.8259 Constraint (T0311)S16.CB (T0311)P35.CB 8.8157 14.6928 19.1007 21.8021 Constraint (T0311)E15.CB (T0311)A30.CB 7.4034 12.3390 16.0407 21.8021 Constraint (T0311)Q14.CB (T0311)K55.CB 9.0162 15.0269 19.5350 21.8009 Constraint (T0311)T43.CB (T0311)S57.CB 8.1364 13.5607 17.6290 21.6465 Constraint (T0311)T49.CB (T0311)W67.CB 7.7490 12.9150 16.7895 21.6372 Constraint (T0311)R40.CB (T0311)I54.CB 7.2761 12.1268 15.7648 21.4162 Constraint (T0311)M52.CB (T0311)L68.CB 7.8612 13.1020 17.0327 21.2739 Constraint (T0311)I12.CB (T0311)S23.CB 8.6514 14.4190 18.7447 21.2620 Constraint (T0311)R25.CB (T0311)M52.CB 9.0064 15.0107 19.5140 21.2150 Constraint (T0311)D11.CB (T0311)Q65.CB 8.9495 14.9158 19.3906 21.2107 Constraint (T0311)R40.CB (T0311)S57.CB 6.9126 11.5210 14.9773 20.8538 Constraint (T0311)V22.CB (T0311)T43.CB 8.8038 14.6731 19.0750 20.8208 Constraint (T0311)P50.CB (T0311)W67.CB 6.5032 10.8386 14.0902 20.6209 Constraint (T0311)L48.CB (T0311)W67.CB 5.5915 9.3191 12.1148 20.6209 Constraint (T0311)A77.CB (T0311)S86.CB 9.0489 15.0815 19.6059 20.6173 Constraint (T0311)L42.CB (T0311)V58.CB 8.1358 13.5596 17.6275 20.4510 Constraint (T0311)A47.CB (T0311)Q65.CB 8.8050 14.6750 19.0775 20.3417 Constraint (T0311)E51.CB (T0311)L68.CB 8.3908 13.9847 18.1801 20.2576 Constraint (T0311)S36.CB (T0311)V59.CB 9.1217 15.2029 19.7637 20.2519 Constraint (T0311)P50.CB (T0311)M66.CB 8.4411 14.0685 18.2891 20.1918 Constraint (T0311)E19.CB (T0311)L41.CB 9.2853 15.4755 20.1182 20.1856 Constraint (T0311)A28.CB (T0311)W67.CB 9.2347 15.3912 20.0086 20.1784 Constraint (T0311)V22.CB (T0311)M66.CB 9.1827 15.3045 19.8959 20.1320 Constraint (T0311)P50.CB (T0311)L68.CB 6.2647 10.4411 13.5734 19.9576 Constraint (T0311)T49.CB (T0311)L68.CB 7.9061 13.1768 17.1299 19.9576 Constraint (T0311)L48.CB (T0311)L68.CB 6.6256 11.0427 14.3554 19.9576 Constraint (T0311)A46.CB (T0311)P64.CB 8.0563 13.4271 17.4552 19.9238 Constraint (T0311)L20.CB (T0311)P35.CB 9.1323 15.2206 19.7867 19.8677 Constraint (T0311)I12.CB (T0311)T37.CB 7.8838 13.1397 17.0816 19.7951 Constraint (T0311)I12.CB (T0311)E26.CB 8.2037 13.6728 17.7747 19.7074 Constraint (T0311)I33.CB (T0311)S62.CB 9.1200 15.2000 19.7600 19.5542 Constraint (T0311)A30.CB (T0311)T49.CB 8.7328 14.5547 18.9211 19.3040 Constraint (T0311)L17.CB (T0311)K45.CB 8.0126 13.3544 17.3607 19.1781 Constraint (T0311)S36.CB (T0311)A53.CB 8.6589 14.4315 18.7610 18.7342 Constraint (T0311)E51.CB (T0311)Q65.CB 8.8540 14.7566 19.1836 18.6015 Constraint (T0311)I60.CB (T0311)N69.CB 7.8781 13.1301 17.0692 18.1430 Constraint (T0311)L56.CB (T0311)N69.CB 7.9744 13.2907 17.2779 18.0576 Constraint (T0311)S16.CB (T0311)E32.CB 8.0584 13.4306 17.4598 17.9945 Constraint (T0311)R29.CB (T0311)R40.CB 9.3195 15.5326 20.1923 17.9619 Constraint (T0311)F27.CB (T0311)M66.CB 8.7379 14.5631 18.9321 17.7786 Constraint (T0311)T37.CB (T0311)W67.CB 8.7484 14.5806 18.9548 17.7685 Constraint (T0311)A79.CB (T0311)L88.CB 8.4290 14.0483 18.2628 17.6246 Constraint (T0311)L48.CB (T0311)M66.CB 7.7098 12.8496 16.7045 17.6209 Constraint (T0311)E80.CB (T0311)R89.CB 8.6593 14.4321 18.7618 17.6035 Constraint (T0311)D11.CB (T0311)L68.CB 7.7816 12.9694 16.8602 17.4948 Constraint (T0311)I33.CB (T0311)P64.CB 8.9249 14.8749 19.3373 17.4570 Constraint (T0311)E32.CB (T0311)P64.CB 9.2434 15.4057 20.0274 17.3638 Constraint (T0311)M52.CB (T0311)M66.CB 8.5185 14.1974 18.4567 17.3551 Constraint (T0311)A47.CB (T0311)M66.CB 8.6496 14.4159 18.7407 17.3437 Constraint (T0311)D11.CB (T0311)S63.CB 8.9787 14.9645 19.4538 17.2214 Constraint (T0311)T43.CB (T0311)W67.CB 9.0099 15.0166 19.5216 17.0673 Constraint (T0311)S57.CB (T0311)N69.CB 6.6460 11.0766 14.3996 17.0595 Constraint (T0311)S16.CB (T0311)N69.CB 7.6955 12.8258 16.6735 16.9576 Constraint (T0311)I13.CB (T0311)N69.CB 7.2941 12.1568 15.8038 16.9576 Constraint (T0311)I12.CB (T0311)N69.CB 6.0671 10.1118 13.1454 16.9576 Constraint (T0311)L24.CB (T0311)S62.CB 9.3200 15.5334 20.1934 16.9224 Constraint (T0311)R40.CB (T0311)V59.CB 8.0476 13.4127 17.4364 16.8503 Constraint (T0311)I12.CB (T0311)I33.CB 6.8940 11.4900 14.9370 16.8051 Constraint (T0311)R40.CB (T0311)W67.CB 8.8726 14.7877 19.2241 16.7654 Constraint (T0311)E78.CB (T0311)R87.CB 8.4918 14.1530 18.3989 16.7182 Constraint (T0311)P35.CB (T0311)T49.CB 9.2957 15.4928 20.1407 16.4619 Constraint (T0311)A46.CB (T0311)L68.CB 8.2191 13.6986 17.8081 16.4619 Constraint (T0311)A53.CB (T0311)N69.CB 6.7281 11.2135 14.5776 16.4480 Constraint (T0311)S23.CB (T0311)K55.CB 9.0418 15.0697 19.5906 16.4297 Constraint (T0311)S16.CB (T0311)L68.CB 7.1535 11.9225 15.4992 16.1700 Constraint (T0311)E15.CB (T0311)L68.CB 8.3664 13.9440 18.1272 16.1700 Constraint (T0311)A34.CB (T0311)I54.CB 9.2048 15.3413 19.9437 16.0699 Constraint (T0311)I54.CB (T0311)N69.CB 8.3882 13.9804 18.1745 16.0432 Constraint (T0311)W74.CB (T0311)V83.CB 8.5818 14.3029 18.5938 16.0403 Constraint (T0311)A73.CB (T0311)T82.CB 8.8758 14.7930 19.2309 15.9452 Constraint (T0311)L24.CB (T0311)W67.CB 9.1095 15.1825 19.7372 15.8586 Constraint (T0311)Q14.CB (T0311)L68.CB 9.0470 15.0783 19.6018 15.8283 Constraint (T0311)S57.CB (T0311)L70.CB 5.8500 9.7499 12.6749 15.7785 Constraint (T0311)L56.CB (T0311)L70.CB 6.1279 10.2131 13.2770 15.7785 Constraint (T0311)E15.CB (T0311)N69.CB 8.4982 14.1636 18.4127 15.7432 Constraint (T0311)D11.CB (T0311)N69.CB 8.1691 13.6151 17.6997 15.7432 Constraint (T0311)L42.CB (T0311)L68.CB 8.8326 14.7209 19.1372 15.4455 Constraint (T0311)V59.CB (T0311)L70.CB 7.7984 12.9974 16.8966 15.4431 Constraint (T0311)L41.CB (T0311)Q65.CB 8.9089 14.8482 19.3027 15.2545 Constraint (T0311)E15.CB (T0311)A28.CB 8.6894 14.4823 18.8270 14.9315 Constraint (T0311)I12.CB (T0311)A28.CB 7.2013 12.0022 15.6029 14.8564 Constraint (T0311)I12.CB (T0311)T49.CB 8.7829 14.6382 19.0296 14.7569 Constraint (T0311)A77.CB (T0311)R87.CB 8.5397 14.2328 18.5026 14.6313 Constraint (T0311)L20.CB (T0311)S39.CB 9.1281 15.2136 19.7776 14.5558 Constraint (T0311)A53.CB (T0311)L70.CB 5.6801 9.4668 12.3068 14.4644 Constraint (T0311)L56.CB (T0311)Q71.CB 7.0260 11.7101 15.2231 14.4620 Constraint (T0311)E32.CB (T0311)L42.CB 9.5041 15.8401 20.5921 14.4488 Constraint (T0311)S57.CB (T0311)E80.CB 5.7611 9.6018 12.4823 14.4221 Constraint (T0311)L24.CB (T0311)V58.CB 8.8462 14.7437 19.1669 14.4136 Constraint (T0311)R40.CB (T0311)V58.CB 7.7570 12.9284 16.8069 14.3488 Constraint (T0311)T43.CB (T0311)I60.CB 8.0858 13.4763 17.5192 14.3293 Constraint (T0311)K45.CB (T0311)K55.CB 8.1436 13.5726 17.6444 14.2282 Constraint (T0311)I60.CB (T0311)L70.CB 5.9737 9.9562 12.9431 14.1450 Constraint (T0311)A79.CB (T0311)R89.CB 8.9717 14.9528 19.4386 14.0613 Constraint (T0311)I54.CB (T0311)L70.CB 7.4931 12.4884 16.2350 14.0596 Constraint (T0311)K45.CB (T0311)I54.CB 7.8296 13.0493 16.9641 14.0212 Constraint (T0311)S16.CB (T0311)L70.CB 6.0912 10.1520 13.1976 13.9577 Constraint (T0311)E15.CB (T0311)L70.CB 7.2278 12.0463 15.6602 13.9577 Constraint (T0311)I12.CB (T0311)L70.CB 5.2643 8.7738 11.4059 13.9577 Constraint (T0311)L42.CB (T0311)A79.CB 7.4285 12.3809 16.0952 13.9297 Constraint (T0311)D11.CB (T0311)M52.CB 9.1031 15.1719 19.7234 13.9286 Constraint (T0311)S16.CB (T0311)A47.CB 9.3501 15.5835 20.2585 13.9038 Constraint (T0311)S62.CB (T0311)Q71.CB 7.3048 12.1747 15.8271 13.8285 Constraint (T0311)S16.CB (T0311)R40.CB 9.1620 15.2700 19.8510 13.7971 Constraint (T0311)K45.CB (T0311)W67.CB 8.7371 14.5618 18.9304 13.7673 Constraint (T0311)Q14.CB (T0311)P64.CB 8.6605 14.4341 18.7644 13.7427 Constraint (T0311)V22.CB (T0311)S36.CB 9.2491 15.4152 20.0398 13.7263 Constraint (T0311)I54.CB (T0311)T82.CB 7.5491 12.5818 16.3563 13.7115 Constraint (T0311)V22.CB (T0311)A53.CB 8.9799 14.9665 19.4564 13.6996 Constraint (T0311)A28.CB (T0311)A47.CB 8.9601 14.9336 19.4136 13.6955 Constraint (T0311)Q14.CB (T0311)S63.CB 8.6384 14.3973 18.7165 13.6676 Constraint (T0311)S57.CB (T0311)V83.CB 6.9436 11.5727 15.0445 13.4221 Constraint (T0311)L56.CB (T0311)T82.CB 7.6901 12.8168 16.6618 13.4099 Constraint (T0311)K55.CB (T0311)T82.CB 8.2097 13.6828 17.7876 13.4099 Constraint (T0311)I54.CB (T0311)E80.CB 6.6686 11.1144 14.4487 13.4067 Constraint (T0311)S57.CB (T0311)T82.CB 7.1413 11.9021 15.4728 13.3936 Constraint (T0311)A38.CB (T0311)P64.CB 8.3984 13.9973 18.1965 13.3699 Constraint (T0311)S39.CB (T0311)I54.CB 7.8540 13.0900 17.0170 13.1632 Constraint (T0311)N72.CB (T0311)K81.CB 9.2415 15.4025 20.0232 13.1345 Constraint (T0311)L41.CB (T0311)A79.CB 6.8490 11.4151 14.8396 13.1201 Constraint (T0311)L42.CB (T0311)P64.CB 8.3432 13.9053 18.0769 13.0561 Constraint (T0311)L56.CB (T0311)V83.CB 7.0931 11.8219 15.3685 12.9951 Constraint (T0311)D18.CB (T0311)M66.CB 9.0947 15.1579 19.7052 12.9911 Constraint (T0311)L56.CB (T0311)E80.CB 6.1975 10.3291 13.4279 12.9829 Constraint (T0311)I60.CB (T0311)Q71.CB 7.9042 13.1736 17.1257 12.8285 Constraint (T0311)P35.CB (T0311)A53.CB 9.1495 15.2492 19.8240 12.8028 Constraint (T0311)I12.CB (T0311)N21.CB 9.0620 15.1034 19.6344 12.7964 Constraint (T0311)A47.CB (T0311)I60.CB 9.0957 15.1595 19.7073 12.6745 Constraint (T0311)L76.CB (T0311)S86.CB 9.0423 15.0705 19.5917 12.6409 Constraint (T0311)L48.CB (T0311)L70.CB 6.0259 10.0432 13.0562 12.6242 Constraint (T0311)L42.CB (T0311)L70.CB 6.4710 10.7850 14.0205 12.6242 Constraint (T0311)L41.CB (T0311)L70.CB 6.4109 10.6848 13.8902 12.6242 Constraint (T0311)V22.CB (T0311)L70.CB 9.1944 15.3241 19.9213 12.6242 Constraint (T0311)L17.CB (T0311)L70.CB 7.6057 12.6762 16.4791 12.6242 Constraint (T0311)Q14.CB (T0311)L70.CB 7.4076 12.3460 16.0497 12.6242 Constraint (T0311)I13.CB (T0311)L70.CB 5.2591 8.7652 11.3948 12.6242 Constraint (T0311)I54.CB (T0311)K81.CB 7.2800 12.1334 15.7734 12.5910 Constraint (T0311)T43.CB (T0311)V59.CB 9.1589 15.2649 19.8444 12.5323 Constraint (T0311)K45.CB (T0311)S57.CB 7.4489 12.4148 16.1392 12.4348 Constraint (T0311)S57.CB (T0311)K81.CB 6.2320 10.3867 13.5028 12.3936 Constraint (T0311)R40.CB (T0311)L76.CB 7.5907 12.6511 16.4464 12.3419 Constraint (T0311)K55.CB (T0311)V83.CB 7.8032 13.0054 16.9070 12.3284 Constraint (T0311)L42.CB (T0311)E51.CB 8.5501 14.2502 18.5252 12.1773 Constraint (T0311)M52.CB (T0311)Q71.CB 7.1619 11.9365 15.5175 12.1373 Constraint (T0311)L41.CB (T0311)E78.CB 8.1294 13.5490 17.6137 12.1323 Constraint (T0311)E19.CB (T0311)Q65.CB 8.9884 14.9806 19.4748 12.0822 Constraint (T0311)L48.CB (T0311)E80.CB 8.0016 13.3361 17.3369 12.0671 Constraint (T0311)A53.CB (T0311)E80.CB 6.4010 10.6684 13.8689 12.0244 Constraint (T0311)L20.CB (T0311)E32.CB 9.1010 15.1683 19.7188 11.9803 Constraint (T0311)D11.CB (T0311)P64.CB 8.8379 14.7298 19.1487 11.9794 Constraint (T0311)T82.CB (T0311)L91.CB 8.8941 14.8235 19.2706 11.9742 Constraint (T0311)A53.CB (T0311)K81.CB 7.4172 12.3621 16.0707 11.9243 Constraint (T0311)E15.CB (T0311)A46.CB 8.3703 13.9505 18.1357 11.9008 Constraint (T0311)S62.CB (T0311)A77.CB 7.7463 12.9106 16.7837 11.8870 Constraint (T0311)A30.CB (T0311)R40.CB 9.3569 15.5949 20.2734 11.8440 Constraint (T0311)D11.CB (T0311)L70.CB 7.0582 11.7636 15.2927 11.8146 Constraint (T0311)M52.CB (T0311)A79.CB 6.6366 11.0611 14.3794 11.7732 Constraint (T0311)M31.CB (T0311)M66.CB 8.4644 14.1073 18.3395 11.7706 Constraint (T0311)L41.CB (T0311)V83.CB 8.5910 14.3184 18.6139 11.7019 Constraint (T0311)A46.CB (T0311)Q65.CB 9.1529 15.2548 19.8312 11.6725 Constraint (T0311)M31.CB (T0311)A79.CB 6.5256 10.8760 14.1389 11.6125 Constraint (T0311)S36.CB (T0311)E51.CB 8.8990 14.8316 19.2811 11.4950 Constraint (T0311)R29.CB (T0311)L48.CB 8.8070 14.6784 19.0819 11.4849 Constraint (T0311)F27.CB (T0311)A47.CB 9.2353 15.3922 20.0099 11.4849 Constraint (T0311)Q14.CB (T0311)A73.CB 8.9231 14.8718 19.3334 11.4759 Constraint (T0311)I54.CB (T0311)A79.CB 5.8386 9.7310 12.6504 11.4298 Constraint (T0311)P64.CB (T0311)E80.CB 5.4113 9.0188 11.7245 11.3648 Constraint (T0311)A34.CB (T0311)S57.CB 9.1547 15.2578 19.8351 11.3405 Constraint (T0311)A53.CB (T0311)Q71.CB 5.0702 8.4504 10.9855 11.3276 Constraint (T0311)S39.CB (T0311)L76.CB 7.9766 13.2944 17.2827 11.3256 Constraint (T0311)S57.CB (T0311)Q71.CB 6.3168 10.5281 13.6865 11.2228 Constraint (T0311)S75.CB (T0311)D84.CB 8.9210 14.8683 19.3288 11.1738 Constraint (T0311)V83.CB (T0311)V92.CB 8.2882 13.8137 17.9579 11.1424 Constraint (T0311)L42.CB (T0311)E80.CB 5.6610 9.4349 12.2654 11.1067 Constraint (T0311)L41.CB (T0311)E80.CB 6.2638 10.4397 13.5716 11.1067 Constraint (T0311)K45.CB (T0311)E80.CB 8.5589 14.2648 18.5442 11.0384 Constraint (T0311)Q65.CB (T0311)V83.CB 6.5765 10.9609 14.2492 11.0028 Constraint (T0311)P50.CB (T0311)N69.CB 8.0315 13.3859 17.4017 10.9577 Constraint (T0311)L48.CB (T0311)N69.CB 7.2890 12.1483 15.7927 10.9577 Constraint (T0311)M52.CB (T0311)E80.CB 7.6704 12.7840 16.6192 10.9374 Constraint (T0311)I54.CB (T0311)Q71.CB 7.0189 11.6981 15.2076 10.9228 Constraint (T0311)P9.CB (T0311)S57.CB 6.6776 11.1293 14.4681 10.8517 Constraint (T0311)P9.CB (T0311)L56.CB 6.0061 10.0102 13.0133 10.8517 Constraint (T0311)P9.CB (T0311)K55.CB 8.4085 14.0141 18.2183 10.8517 Constraint (T0311)P9.CB (T0311)I54.CB 7.6934 12.8223 16.6689 10.8517 Constraint (T0311)P9.CB (T0311)A53.CB 4.7829 7.9715 10.3630 10.8517 Constraint (T0311)P9.CB (T0311)A47.CB 5.0228 8.3713 10.8827 10.8517 Constraint (T0311)P9.CB (T0311)A46.CB 6.1440 10.2400 13.3120 10.8517 Constraint (T0311)P9.CB (T0311)K45.CB 6.7715 11.2859 14.6717 10.8517 Constraint (T0311)P9.CB (T0311)T43.CB 6.8116 11.3527 14.7585 10.8517 Constraint (T0311)P9.CB (T0311)L42.CB 5.5476 9.2459 12.0197 10.8517 Constraint (T0311)P9.CB (T0311)L41.CB 4.4409 7.4015 9.6219 10.8517 Constraint (T0311)P9.CB (T0311)R40.CB 7.0130 11.6883 15.1948 10.8517 Constraint (T0311)P9.CB (T0311)S39.CB 8.3280 13.8800 18.0440 10.8517 Constraint (T0311)P9.CB (T0311)A38.CB 7.3509 12.2514 15.9269 10.8517 Constraint (T0311)P9.CB (T0311)T37.CB 8.0301 13.3835 17.3986 10.8517 Constraint (T0311)P9.CB (T0311)I33.CB 8.5445 14.2409 18.5132 10.8517 Constraint (T0311)P9.CB (T0311)F27.CB 8.2953 13.8255 17.9732 10.8517 Constraint (T0311)A30.CB (T0311)S63.CB 8.6821 14.4702 18.8112 10.8098 Constraint (T0311)E15.CB (T0311)I33.CB 8.5436 14.2393 18.5111 10.8052 Constraint (T0311)I12.CB (T0311)P35.CB 8.5036 14.1726 18.4244 10.8052 Constraint (T0311)I12.CB (T0311)E32.CB 6.3882 10.6469 13.8410 10.8052 Constraint (T0311)I12.CB (T0311)R29.CB 7.5971 12.6618 16.4603 10.8052 Constraint (T0311)L48.CB (T0311)Q71.CB 5.4766 9.1276 11.8659 10.8038 Constraint (T0311)A46.CB (T0311)Q71.CB 7.4358 12.3929 16.1108 10.8038 Constraint (T0311)S63.CB (T0311)V83.CB 7.0106 11.6843 15.1896 10.7938 Constraint (T0311)S63.CB (T0311)A79.CB 6.6828 11.1381 14.4795 10.7937 Constraint (T0311)S62.CB (T0311)A79.CB 7.0959 11.8266 15.3745 10.7937 Constraint (T0311)A38.CB (T0311)M66.CB 8.5375 14.2292 18.4980 10.7787 Constraint (T0311)S57.CB (T0311)A77.CB 7.5183 12.5305 16.2897 10.7605 Constraint (T0311)K45.CB (T0311)L76.CB 7.5469 12.5781 16.3516 10.6843 Constraint (T0311)M52.CB (T0311)E78.CB 7.5150 12.5249 16.2824 10.6273 Constraint (T0311)E51.CB (T0311)E78.CB 8.0028 13.3380 17.3394 10.6273 Constraint (T0311)F27.CB (T0311)E80.CB 5.3415 8.9025 11.5732 10.5869 Constraint (T0311)Q65.CB (T0311)T82.CB 7.6422 12.7370 16.5581 10.5777 Constraint (T0311)A34.CB (T0311)I60.CB 9.0423 15.0705 19.5916 10.5197 Constraint (T0311)E80.CB (T0311)R90.CB 7.9363 13.2272 17.1954 10.4756 Constraint (T0311)A28.CB (T0311)S62.CB 9.1110 15.1850 19.7405 10.4711 Constraint (T0311)S57.CB (T0311)A79.CB 5.2690 8.7816 11.4161 10.4452 Constraint (T0311)L56.CB (T0311)A79.CB 5.2841 8.8068 11.4488 10.4452 Constraint (T0311)L56.CB (T0311)E78.CB 7.2906 12.1511 15.7964 10.4452 Constraint (T0311)K55.CB (T0311)A79.CB 6.2964 10.4939 13.6421 10.4452 Constraint (T0311)I54.CB (T0311)E78.CB 6.5985 10.9975 14.2968 10.4135 Constraint (T0311)T37.CB (T0311)P64.CB 9.2139 15.3565 19.9634 10.3699 Constraint (T0311)S63.CB (T0311)K81.CB 7.6000 12.6666 16.4666 10.3667 Constraint (T0311)S63.CB (T0311)E80.CB 5.6672 9.4454 12.2790 10.3667 Constraint (T0311)S62.CB (T0311)E80.CB 7.0025 11.6709 15.1721 10.3667 Constraint (T0311)P64.CB (T0311)T82.CB 6.7904 11.3174 14.7126 10.3649 Constraint (T0311)L42.CB (T0311)Q65.CB 9.0682 15.1136 19.6477 10.3565 Constraint (T0311)E19.CB (T0311)A28.CB 8.7678 14.6130 18.9969 10.2095 Constraint (T0311)S16.CB (T0311)A34.CB 9.1754 15.2924 19.8801 10.2095 Constraint (T0311)L17.CB (T0311)L68.CB 9.0486 15.0810 19.6053 10.1701 Constraint (T0311)L48.CB (T0311)A79.CB 6.3555 10.5925 13.7702 10.0901 Constraint (T0311)Q65.CB (T0311)A77.CB 5.4588 9.0980 11.8274 10.0816 Constraint (T0311)A53.CB (T0311)A79.CB 5.3493 8.9155 11.5901 10.0475 Constraint (T0311)V59.CB (T0311)V83.CB 7.1869 11.9782 15.5717 10.0105 Constraint (T0311)Q65.CB (T0311)E80.CB 4.9247 8.2078 10.6702 9.9825 Constraint (T0311)E51.CB (T0311)A79.CB 7.0281 11.7136 15.2276 9.9605 Constraint (T0311)T49.CB (T0311)A79.CB 6.9157 11.5262 14.9840 9.9605 Constraint (T0311)T49.CB (T0311)E78.CB 7.6886 12.8144 16.6587 9.9605 Constraint (T0311)V58.CB (T0311)L70.CB 6.9198 11.5330 14.9928 9.9417 Constraint (T0311)K55.CB (T0311)L70.CB 6.8281 11.3801 14.7942 9.9417 Constraint (T0311)P50.CB (T0311)E80.CB 7.3509 12.2516 15.9270 9.9288 Constraint (T0311)L24.CB (T0311)E80.CB 6.6662 11.1104 14.4435 9.9202 Constraint (T0311)P9.CB (T0311)M31.CB 8.5797 14.2996 18.5894 9.9061 Constraint (T0311)V59.CB (T0311)L68.CB 8.4250 14.0417 18.2542 9.8700 Constraint (T0311)S39.CB (T0311)W67.CB 8.9272 14.8787 19.3423 9.8607 Constraint (T0311)Q14.CB (T0311)V58.CB 8.7373 14.5621 18.9307 9.8536 Constraint (T0311)P9.CB (T0311)W67.CB 3.8497 6.4161 8.3410 9.8353 Constraint (T0311)P9.CB (T0311)M66.CB 6.4748 10.7914 14.0288 9.8353 Constraint (T0311)P9.CB (T0311)Q65.CB 7.3116 12.1860 15.8418 9.8353 Constraint (T0311)P9.CB (T0311)P64.CB 6.4860 10.8099 14.0529 9.8353 Constraint (T0311)P9.CB (T0311)S63.CB 8.2332 13.7219 17.8385 9.8353 Constraint (T0311)P9.CB (T0311)S62.CB 7.2301 12.0502 15.6652 9.8353 Constraint (T0311)P9.CB (T0311)I60.CB 6.9525 11.5876 15.0638 9.8353 Constraint (T0311)P9.CB (T0311)V59.CB 8.7734 14.6224 19.0091 9.8353 Constraint (T0311)P9.CB (T0311)L24.CB 9.1687 15.2812 19.8655 9.8353 Constraint (T0311)P9.CB (T0311)E19.CB 9.2567 15.4278 20.0561 9.8353 Constraint (T0311)P9.CB (T0311)D18.CB 8.9524 14.9207 19.3969 9.8353 Constraint (T0311)S63.CB (T0311)T82.CB 8.1671 13.6118 17.6953 9.7938 Constraint (T0311)S63.CB (T0311)E78.CB 7.4864 12.4773 16.2205 9.7938 Constraint (T0311)S63.CB (T0311)A77.CB 6.3884 10.6474 13.8416 9.7938 Constraint (T0311)P64.CB (T0311)V83.CB 5.3245 8.8741 11.5363 9.7919 Constraint (T0311)P50.CB (T0311)Q71.CB 5.7601 9.6002 12.4802 9.7875 Constraint (T0311)L42.CB (T0311)Q71.CB 7.7006 12.8344 16.6847 9.7875 Constraint (T0311)L41.CB (T0311)Q71.CB 6.5230 10.8716 14.1331 9.7875 Constraint (T0311)I13.CB (T0311)Q71.CB 7.1066 11.8443 15.3976 9.7875 Constraint (T0311)L41.CB (T0311)N69.CB 7.3114 12.1856 15.8413 9.7874 Constraint (T0311)L42.CB (T0311)V83.CB 7.5745 12.6242 16.4115 9.7057 Constraint (T0311)L41.CB (T0311)T82.CB 8.9501 14.9169 19.3920 9.7057 Constraint (T0311)L42.CB (T0311)T82.CB 8.6919 14.4865 18.8324 9.6935 Constraint (T0311)L42.CB (T0311)K81.CB 7.6697 12.7828 16.6176 9.6935 Constraint (T0311)V58.CB (T0311)V83.CB 7.2844 12.1406 15.7828 9.6503 Constraint (T0311)K55.CB (T0311)E80.CB 6.8818 11.4696 14.9105 9.6350 Constraint (T0311)P50.CB (T0311)L70.CB 7.1280 11.8800 15.4440 9.6242 Constraint (T0311)F27.CB (T0311)L70.CB 7.4795 12.4658 16.2055 9.6242 Constraint (T0311)I12.CB (T0311)A34.CB 8.1994 13.6657 17.7654 9.6138 Constraint (T0311)A30.CB (T0311)E80.CB 6.6163 11.0272 14.3353 9.5991 Constraint (T0311)T49.CB (T0311)Q71.CB 6.3857 10.6428 13.8356 9.5894 Constraint (T0311)T43.CB (T0311)Q71.CB 9.0246 15.0410 19.5533 9.5894 Constraint (T0311)Q65.CB (T0311)K81.CB 6.1496 10.2493 13.3241 9.5613 Constraint (T0311)T43.CB (T0311)L76.CB 7.8588 13.0981 17.0275 9.5384 Constraint (T0311)S23.CB (T0311)E80.CB 7.1079 11.8465 15.4004 9.5154 Constraint (T0311)E80.CB (T0311)L91.CB 8.1775 13.6292 17.7180 9.4756 Constraint (T0311)S39.CB (T0311)S62.CB 8.6414 14.4023 18.7230 9.4534 Constraint (T0311)I54.CB (T0311)A77.CB 7.7075 12.8458 16.6995 9.4452 Constraint (T0311)V58.CB (T0311)E80.CB 6.9896 11.6494 15.1442 9.4375 Constraint (T0311)S57.CB (T0311)D84.CB 7.9880 13.3133 17.3073 9.4289 Constraint (T0311)S57.CB (T0311)E78.CB 6.1350 10.2249 13.2924 9.4289 Constraint (T0311)L56.CB (T0311)K81.CB 6.9990 11.6650 15.1646 9.4196 Constraint (T0311)Q65.CB (T0311)A79.CB 6.2069 10.3448 13.4482 9.4095 Constraint (T0311)E19.CB (T0311)L70.CB 7.1312 11.8854 15.4510 9.3846 Constraint (T0311)E15.CB (T0311)R25.CB 8.7798 14.6329 19.0228 9.3671 Constraint (T0311)P50.CB (T0311)E78.CB 6.6308 11.0513 14.3666 9.3490 Constraint (T0311)P64.CB (T0311)K81.CB 6.3930 10.6550 13.8515 9.3486 Constraint (T0311)A79.CB (T0311)R90.CB 7.6272 12.7121 16.5257 9.3075 Constraint (T0311)E15.CB (T0311)M52.CB 8.7986 14.6644 19.0637 9.2019 Constraint (T0311)M52.CB (T0311)L70.CB 6.1702 10.2836 13.3687 9.1373 Constraint (T0311)L76.CB (T0311)R87.CB 7.5791 12.6319 16.4214 9.1268 Constraint (T0311)A38.CB (T0311)E80.CB 6.0501 10.0835 13.1086 9.1105 Constraint (T0311)Q14.CB (T0311)R29.CB 8.8128 14.6880 19.0944 9.0671 Constraint (T0311)S36.CB (T0311)S57.CB 8.5960 14.3266 18.6246 9.0499 Constraint (T0311)P64.CB (T0311)A73.CB 7.8849 13.1415 17.0840 9.0469 Constraint (T0311)V59.CB (T0311)Q71.CB 8.6472 14.4119 18.7355 9.0334 Constraint (T0311)A53.CB (T0311)E78.CB 6.0626 10.1044 13.1357 9.0311 Constraint (T0311)P35.CB (T0311)S57.CB 8.6526 14.4211 18.7474 9.0182 Constraint (T0311)A46.CB (T0311)V59.CB 9.0817 15.1361 19.6770 8.9890 Constraint (T0311)I12.CB (T0311)A79.CB 7.9953 13.3255 17.3232 8.9881 Constraint (T0311)D18.CB (T0311)K45.CB 7.8838 13.1397 17.0816 8.9828 Constraint (T0311)S16.CB (T0311)A46.CB 8.2691 13.7819 17.9165 8.9808 Constraint (T0311)I54.CB (T0311)V83.CB 6.0844 10.1406 13.1828 8.9759 Constraint (T0311)V22.CB (T0311)L48.CB 9.1194 15.1990 19.7586 8.9626 Constraint (T0311)E51.CB (T0311)E80.CB 8.2432 13.7386 17.8602 8.9605 Constraint (T0311)T49.CB (T0311)E80.CB 8.5288 14.2147 18.4791 8.9605 Constraint (T0311)K45.CB (T0311)Q71.CB 8.4223 14.0372 18.2483 8.9497 Constraint (T0311)A53.CB (T0311)T82.CB 7.1001 11.8335 15.3836 8.9474 Constraint (T0311)L48.CB (T0311)E78.CB 7.0159 11.6931 15.2011 8.9442 Constraint (T0311)E26.CB (T0311)E80.CB 6.5954 10.9924 14.2901 8.9324 Constraint (T0311)W74.CB (T0311)D84.CB 9.0811 15.1351 19.6757 8.9065 Constraint (T0311)F27.CB (T0311)Q71.CB 9.2575 15.4292 20.0580 8.8807 Constraint (T0311)L24.CB (T0311)A47.CB 9.4255 15.7092 20.4219 8.8638 Constraint (T0311)P9.CB (T0311)M52.CB 6.5333 10.8889 14.1555 8.8530 Constraint (T0311)P9.CB (T0311)E51.CB 8.3954 13.9923 18.1900 8.8530 Constraint (T0311)P9.CB (T0311)P50.CB 6.6459 11.0764 14.3993 8.8530 Constraint (T0311)P9.CB (T0311)T49.CB 6.7822 11.3036 14.6947 8.8530 Constraint (T0311)P9.CB (T0311)L48.CB 4.2137 7.0228 9.1297 8.8530 Constraint (T0311)I12.CB (T0311)E80.CB 7.6835 12.8058 16.6475 8.8452 Constraint (T0311)P64.CB (T0311)A79.CB 4.7553 7.9256 10.3032 8.7919 Constraint (T0311)I60.CB (T0311)A79.CB 7.2922 12.1537 15.7998 8.7817 Constraint (T0311)P64.CB (T0311)A77.CB 5.4913 9.1522 11.8979 8.7775 Constraint (T0311)L42.CB (T0311)E78.CB 7.9092 13.1821 17.1367 8.7250 Constraint (T0311)R40.CB (T0311)A79.CB 8.3751 13.9585 18.1460 8.7250 Constraint (T0311)M31.CB (T0311)V83.CB 6.9524 11.5874 15.0636 8.7179 Constraint (T0311)L24.CB (T0311)T82.CB 8.5621 14.2701 18.5512 8.7160 Constraint (T0311)S23.CB (T0311)T82.CB 8.1720 13.6200 17.7061 8.7160 Constraint (T0311)S39.CB (T0311)E80.CB 7.1782 11.9636 15.5527 8.7057 Constraint (T0311)A38.CB (T0311)V83.CB 7.2967 12.1612 15.8095 8.7057 Constraint (T0311)L24.CB (T0311)V83.CB 7.0006 11.6676 15.1679 8.7057 Constraint (T0311)S23.CB (T0311)V83.CB 6.4980 10.8300 14.0790 8.7057 Constraint (T0311)D11.CB (T0311)T37.CB 9.0358 15.0596 19.5775 8.6606 Constraint (T0311)P50.CB (T0311)A77.CB 7.5190 12.5317 16.2912 8.6426 Constraint (T0311)S16.CB (T0311)Q71.CB 7.4279 12.3799 16.0938 8.6411 Constraint (T0311)A47.CB (T0311)N69.CB 6.2327 10.3878 13.5042 8.5730 Constraint (T0311)A47.CB (T0311)S62.CB 9.1993 15.3321 19.9317 8.5730 Constraint (T0311)N21.CB (T0311)V58.CB 9.0848 15.1413 19.6837 8.5613 Constraint (T0311)T43.CB (T0311)K55.CB 8.4265 14.0442 18.2574 8.5513 Constraint (T0311)E26.CB (T0311)L48.CB 9.0896 15.1493 19.6941 8.4849 Constraint (T0311)V58.CB (T0311)A79.CB 7.1813 11.9689 15.5595 8.4606 Constraint (T0311)M52.CB (T0311)N69.CB 8.0199 13.3665 17.3764 8.4209 Constraint (T0311)R29.CB (T0311)E51.CB 8.6818 14.4697 18.8106 8.4098 Constraint (T0311)Q65.CB (T0311)E78.CB 6.5171 10.8618 14.1204 8.3932 Constraint (T0311)L20.CB (T0311)L70.CB 7.9029 13.1715 17.1230 8.3846 Constraint (T0311)I60.CB (T0311)V83.CB 7.9033 13.1722 17.1239 8.3668 Constraint (T0311)L76.CB (T0311)V85.CB 8.6329 14.3881 18.7045 8.3607 Constraint (T0311)I60.CB (T0311)E80.CB 7.6163 12.6938 16.5019 8.3546 Constraint (T0311)P64.CB (T0311)D84.CB 6.7174 11.1956 14.5543 8.3505 Constraint (T0311)L24.CB (T0311)I54.CB 8.3137 13.8562 18.0131 8.3379 Constraint (T0311)M66.CB (T0311)A79.CB 7.6474 12.7457 16.5695 8.3207 Constraint (T0311)F27.CB (T0311)P50.CB 9.3689 15.6149 20.2993 8.3195 Constraint (T0311)A79.CB (T0311)L91.CB 8.2144 13.6907 17.7979 8.3094 Constraint (T0311)I12.CB (T0311)E51.CB 8.7916 14.6527 19.0485 8.3062 Constraint (T0311)Q71.CB (T0311)E80.CB 8.1607 13.6012 17.6816 8.2918 Constraint (T0311)P35.CB (T0311)A47.CB 8.5938 14.3229 18.6198 8.2627 Constraint (T0311)E19.CB (T0311)A73.CB 7.9434 13.2389 17.2106 8.2363 Constraint (T0311)V83.CB (T0311)T93.CB 8.1226 13.5377 17.5991 8.2359 Constraint (T0311)V58.CB (T0311)Q71.CB 7.8006 13.0010 16.9012 8.2228 Constraint (T0311)K55.CB (T0311)Q71.CB 7.2624 12.1040 15.7352 8.2228 Constraint (T0311)V58.CB (T0311)N69.CB 8.2012 13.6687 17.7693 8.2046 Constraint (T0311)K55.CB (T0311)N69.CB 8.5026 14.1710 18.4223 8.2046 Constraint (T0311)M31.CB (T0311)T82.CB 6.1653 10.2756 13.3582 8.1330 Constraint (T0311)A30.CB (T0311)T82.CB 4.1596 6.9326 9.0124 8.1330 Constraint (T0311)A28.CB (T0311)E80.CB 7.0804 11.8007 15.3409 8.1330 Constraint (T0311)F27.CB (T0311)T82.CB 5.4612 9.1019 11.8325 8.1330 Constraint (T0311)F27.CB (T0311)K81.CB 6.0627 10.1045 13.1358 8.1330 Constraint (T0311)E26.CB (T0311)T82.CB 5.8752 9.7921 12.7297 8.1330 Constraint (T0311)E51.CB (T0311)L70.CB 7.6049 12.6749 16.4774 8.1209 Constraint (T0311)E51.CB (T0311)N69.CB 9.1610 15.2684 19.8489 8.1209 Constraint (T0311)M31.CB (T0311)Q71.CB 7.7545 12.9242 16.8015 8.1209 Constraint (T0311)M31.CB (T0311)L70.CB 6.8288 11.3814 14.7958 8.1209 Constraint (T0311)Q14.CB (T0311)N69.CB 8.8601 14.7668 19.1968 8.1209 Constraint (T0311)D18.CB (T0311)R29.CB 8.6406 14.4011 18.7214 8.0965 Constraint (T0311)E19.CB (T0311)P64.CB 8.8172 14.6953 19.1039 8.0930 Constraint (T0311)W67.CB (T0311)E80.CB 7.5777 12.6295 16.4183 8.0821 Constraint (T0311)V22.CB (T0311)R40.CB 9.3512 15.5853 20.2609 8.0683 Constraint (T0311)L70.CB (T0311)A79.CB 7.4178 12.3630 16.0719 8.0082 Constraint (T0311)Q65.CB (T0311)R87.CB 7.8517 13.0862 17.0120 7.9884 Constraint (T0311)T49.CB (T0311)A77.CB 8.3800 13.9667 18.1567 7.9759 Constraint (T0311)A47.CB (T0311)A77.CB 9.1291 15.2152 19.7798 7.9759 Constraint (T0311)A38.CB (T0311)A79.CB 6.1214 10.2024 13.2631 7.9432 Constraint (T0311)F27.CB (T0311)A79.CB 4.6515 7.7526 10.0783 7.9432 Constraint (T0311)E26.CB (T0311)A79.CB 6.3336 10.5559 13.7227 7.9432 Constraint (T0311)L24.CB (T0311)A79.CB 6.4816 10.8027 14.0436 7.9432 Constraint (T0311)S23.CB (T0311)A79.CB 7.0558 11.7596 15.2875 7.9432 Constraint (T0311)M52.CB (T0311)K81.CB 9.0752 15.1253 19.6629 7.9349 Constraint (T0311)L24.CB (T0311)K81.CB 8.7227 14.5379 18.8993 7.9064 Constraint (T0311)E32.CB (T0311)S62.CB 9.1280 15.2134 19.7774 7.8980 Constraint (T0311)S63.CB (T0311)L76.CB 6.7008 11.1681 14.5185 7.8967 Constraint (T0311)S62.CB (T0311)L76.CB 6.8438 11.4063 14.8282 7.8967 Constraint (T0311)E32.CB (T0311)A47.CB 9.1598 15.2663 19.8462 7.8954 Constraint (T0311)P9.CB (T0311)L68.CB 4.5992 7.6653 9.9649 7.8367 Constraint (T0311)R87.CB (T0311)T96.CB 8.0203 13.3671 17.3772 7.8108 Constraint (T0311)A47.CB (T0311)Q71.CB 4.6612 7.7687 10.0993 7.8038 Constraint (T0311)A47.CB (T0311)L70.CB 5.4430 9.0717 11.7932 7.8038 Constraint (T0311)A46.CB (T0311)L70.CB 6.1890 10.3151 13.4096 7.8038 Constraint (T0311)A46.CB (T0311)N69.CB 8.0721 13.4534 17.4894 7.8038 Constraint (T0311)S62.CB (T0311)V83.CB 7.2317 12.0528 15.6686 7.7939 Constraint (T0311)P64.CB (T0311)V85.CB 7.7537 12.9228 16.7996 7.7756 Constraint (T0311)L56.CB (T0311)A77.CB 8.0003 13.3338 17.3340 7.7606 Constraint (T0311)A38.CB (T0311)T82.CB 8.0666 13.4443 17.4775 7.7282 Constraint (T0311)I33.CB (T0311)T82.CB 8.2553 13.7588 17.8865 7.7282 Constraint (T0311)E32.CB (T0311)T82.CB 7.7645 12.9409 16.8232 7.7282 Constraint (T0311)A30.CB (T0311)K81.CB 6.0204 10.0340 13.0442 7.7282 Constraint (T0311)R29.CB (T0311)T82.CB 6.8225 11.3709 14.7822 7.7282 Constraint (T0311)R29.CB (T0311)K81.CB 8.8648 14.7747 19.2071 7.7282 Constraint (T0311)A28.CB (T0311)T82.CB 7.7539 12.9231 16.8001 7.7282 Constraint (T0311)E26.CB (T0311)K81.CB 7.4223 12.3705 16.0817 7.7282 Constraint (T0311)R25.CB (T0311)T82.CB 8.5394 14.2323 18.5020 7.7282 Constraint (T0311)R25.CB (T0311)E80.CB 7.9568 13.2614 17.2398 7.7282 Constraint (T0311)S23.CB (T0311)K81.CB 9.0565 15.0942 19.6225 7.7282 Constraint (T0311)A30.CB (T0311)V83.CB 4.9327 8.2212 10.6876 7.7179 Constraint (T0311)F27.CB (T0311)V83.CB 4.6123 7.6872 9.9934 7.7179 Constraint (T0311)E26.CB (T0311)V83.CB 4.7865 7.9775 10.3707 7.7179 Constraint (T0311)Q14.CB (T0311)N72.CB 9.3521 15.5869 20.2630 7.6663 Constraint (T0311)A53.CB (T0311)A77.CB 6.5208 10.8680 14.1284 7.6580 Constraint (T0311)V85.CB (T0311)Q94.CB 8.7056 14.5093 18.8621 7.6427 Constraint (T0311)L17.CB (T0311)Q71.CB 7.9725 13.2875 17.2737 7.6411 Constraint (T0311)V22.CB (T0311)E80.CB 6.1200 10.2001 13.2601 7.6331 Constraint (T0311)L48.CB (T0311)A77.CB 7.1850 11.9750 15.5675 7.6263 Constraint (T0311)S39.CB (T0311)V58.CB 7.4750 12.4584 16.1959 7.6079 Constraint (T0311)R40.CB (T0311)A73.CB 7.7841 12.9735 16.8655 7.5740 Constraint (T0311)S36.CB (T0311)A73.CB 8.9412 14.9020 19.3726 7.5740 Constraint (T0311)S86.CB (T0311)S95.CB 8.8249 14.7082 19.1207 7.5692 Constraint (T0311)V83.CB (T0311)Q94.CB 8.5822 14.3037 18.5948 7.5692 Constraint (T0311)Q65.CB (T0311)D84.CB 5.9799 9.9666 12.9566 7.5633 Constraint (T0311)S36.CB (T0311)L76.CB 7.8428 13.0713 16.9927 7.5423 Constraint (T0311)R29.CB (T0311)I54.CB 8.8368 14.7280 19.1464 7.4711 Constraint (T0311)V59.CB (T0311)A79.CB 7.2224 12.0373 15.6485 7.4606 Constraint (T0311)L20.CB (T0311)Q71.CB 8.0084 13.3473 17.3515 7.4267 Constraint (T0311)E19.CB (T0311)Q71.CB 7.0379 11.7299 15.2489 7.4267 Constraint (T0311)K45.CB (T0311)A73.CB 7.9112 13.1854 17.1410 7.3673 Constraint (T0311)K81.CB (T0311)R90.CB 8.3368 13.8947 18.0631 7.3650 Constraint (T0311)L42.CB (T0311)S63.CB 8.4982 14.1637 18.4128 7.3602 Constraint (T0311)E78.CB (T0311)L88.CB 9.2800 15.4667 20.1067 7.3599 Constraint (T0311)M31.CB (T0311)K81.CB 6.5622 10.9370 14.2181 7.3234 Constraint (T0311)S23.CB (T0311)S57.CB 9.0408 15.0680 19.5884 7.3215 Constraint (T0311)T43.CB (T0311)S62.CB 8.6690 14.4483 18.7828 7.2919 Constraint (T0311)D18.CB (T0311)A53.CB 9.0123 15.0205 19.5267 7.2898 Constraint (T0311)S63.CB (T0311)N72.CB 7.5274 12.5457 16.3095 7.2555 Constraint (T0311)I12.CB (T0311)A77.CB 7.7021 12.8368 16.6879 7.2490 Constraint (T0311)D84.CB (T0311)T93.CB 8.9950 14.9916 19.4891 7.2378 Constraint (T0311)E19.CB (T0311)R29.CB 8.1242 13.5403 17.6024 7.2153 Constraint (T0311)K45.CB (T0311)L68.CB 8.9748 14.9581 19.4455 7.2142 Constraint (T0311)T49.CB (T0311)Q65.CB 8.6588 14.4314 18.7608 7.2048 Constraint (T0311)S16.CB (T0311)K45.CB 8.4044 14.0073 18.2095 7.1973 Constraint (T0311)E15.CB (T0311)K45.CB 7.8976 13.1626 17.1114 7.1973 Constraint (T0311)D11.CB (T0311)V59.CB 8.7925 14.6542 19.0504 7.1818 Constraint (T0311)A47.CB (T0311)A79.CB 6.9609 11.6015 15.0820 7.1526 Constraint (T0311)V58.CB (T0311)L76.CB 7.9904 13.3174 17.3126 7.1350 Constraint (T0311)S63.CB (T0311)A73.CB 7.7121 12.8535 16.7096 7.0932 Constraint (T0311)S62.CB (T0311)A73.CB 7.0525 11.7542 15.2804 7.0932 Constraint (T0311)M66.CB (T0311)E80.CB 6.9556 11.5927 15.0705 7.0840 Constraint (T0311)A34.CB (T0311)V58.CB 9.2252 15.3753 19.9879 7.0701 Constraint (T0311)M66.CB (T0311)S75.CB 8.2155 13.6925 17.8002 7.0631 Constraint (T0311)D18.CB (T0311)L70.CB 8.1459 13.5765 17.6495 7.0512 Constraint (T0311)D11.CB (T0311)I33.CB 8.3913 13.9854 18.1811 7.0153 Constraint (T0311)D11.CB (T0311)M31.CB 6.8159 11.3598 14.7678 7.0153 Constraint (T0311)D11.CB (T0311)A30.CB 8.2608 13.7679 17.8983 7.0153 Constraint (T0311)V59.CB (T0311)T82.CB 5.4699 9.1165 11.8515 7.0079 Constraint (T0311)M31.CB (T0311)E80.CB 5.4837 9.1396 11.8814 7.0023 Constraint (T0311)T43.CB (T0311)I54.CB 7.5066 12.5111 16.2644 6.9967 Constraint (T0311)S63.CB (T0311)D84.CB 7.0803 11.8005 15.3407 6.9903 Constraint (T0311)V22.CB (T0311)T82.CB 6.9581 11.5969 15.0760 6.9663 Constraint (T0311)P50.CB (T0311)A79.CB 4.8323 8.0539 10.4700 6.9596 Constraint (T0311)T43.CB (T0311)A79.CB 8.6442 14.4071 18.7292 6.9378 Constraint (T0311)D18.CB (T0311)L48.CB 9.4625 15.7709 20.5022 6.9332 Constraint (T0311)S16.CB (T0311)L76.CB 7.3218 12.2030 15.8640 6.9264 Constraint (T0311)T43.CB (T0311)E80.CB 6.9369 11.5615 15.0300 6.9186 Constraint (T0311)L41.CB (T0311)K81.CB 7.1253 11.8754 15.4381 6.9186 Constraint (T0311)R40.CB (T0311)E80.CB 7.4746 12.4577 16.1950 6.9186 Constraint (T0311)S39.CB (T0311)V83.CB 8.4651 14.1084 18.3410 6.9186 Constraint (T0311)A38.CB (T0311)K81.CB 7.6113 12.6854 16.4911 6.9186 Constraint (T0311)T37.CB (T0311)V83.CB 9.1831 15.3051 19.8967 6.9186 Constraint (T0311)T37.CB (T0311)E80.CB 7.5111 12.5184 16.2740 6.9186 Constraint (T0311)S36.CB (T0311)E80.CB 8.9530 14.9217 19.3982 6.9186 Constraint (T0311)P35.CB (T0311)V83.CB 7.9156 13.1926 17.1504 6.9186 Constraint (T0311)P35.CB (T0311)E80.CB 7.6968 12.8280 16.6763 6.9186 Constraint (T0311)I33.CB (T0311)K81.CB 8.5780 14.2967 18.5858 6.9186 Constraint (T0311)E32.CB (T0311)K81.CB 8.9818 14.9697 19.4606 6.9186 Constraint (T0311)A28.CB (T0311)V83.CB 6.7085 11.1808 14.5351 6.9186 Constraint (T0311)A28.CB (T0311)K81.CB 8.5919 14.3198 18.6157 6.9186 Constraint (T0311)R25.CB (T0311)V83.CB 6.6680 11.1133 14.4473 6.9186 Constraint (T0311)F27.CB (T0311)S63.CB 7.7809 12.9682 16.8587 6.9031 Constraint (T0311)P64.CB (T0311)L76.CB 6.3561 10.5936 13.7716 6.8967 Constraint (T0311)I12.CB (T0311)R25.CB 8.4088 14.0147 18.2191 6.8786 Constraint (T0311)R8.CB (T0311)A53.CB 7.8881 13.1469 17.0909 6.8531 Constraint (T0311)R8.CB (T0311)L48.CB 6.9927 11.6545 15.1508 6.8531 Constraint (T0311)R8.CB (T0311)A47.CB 7.0179 11.6966 15.2055 6.8531 Constraint (T0311)R8.CB (T0311)K45.CB 7.0321 11.7201 15.2361 6.8531 Constraint (T0311)R8.CB (T0311)T43.CB 6.4232 10.7054 13.9170 6.8531 Constraint (T0311)R8.CB (T0311)L42.CB 6.2895 10.4825 13.6272 6.8531 Constraint (T0311)R8.CB (T0311)L41.CB 6.4731 10.7886 14.0252 6.8531 Constraint (T0311)R8.CB (T0311)R40.CB 8.1703 13.6171 17.7023 6.8531 Constraint (T0311)V58.CB (T0311)A77.CB 8.5977 14.3295 18.6284 6.8036 Constraint (T0311)E15.CB (T0311)E32.CB 8.7239 14.5398 18.9017 6.7947 Constraint (T0311)E15.CB (T0311)R29.CB 8.4796 14.1326 18.3724 6.7947 Constraint (T0311)S62.CB (T0311)E78.CB 7.5603 12.6006 16.3807 6.7939 Constraint (T0311)I60.CB (T0311)A77.CB 8.8294 14.7156 19.1303 6.7939 Constraint (T0311)I12.CB (T0311)Q71.CB 5.7775 9.6292 12.5180 6.7876 Constraint (T0311)E51.CB (T0311)Q71.CB 6.6792 11.1319 14.4715 6.7875 Constraint (T0311)E51.CB (T0311)M66.CB 8.7365 14.5608 18.9290 6.7875 Constraint (T0311)T49.CB (T0311)N69.CB 8.4728 14.1213 18.3576 6.7875 Constraint (T0311)T49.CB (T0311)M66.CB 8.9571 14.9285 19.4070 6.7875 Constraint (T0311)A46.CB (T0311)M66.CB 8.7415 14.5692 18.9399 6.7875 Constraint (T0311)K45.CB (T0311)L70.CB 6.7099 11.1831 14.5381 6.7875 Constraint (T0311)K45.CB (T0311)N69.CB 8.0167 13.3612 17.3696 6.7875 Constraint (T0311)T43.CB (T0311)L70.CB 6.8509 11.4181 14.8436 6.7875 Constraint (T0311)T43.CB (T0311)M66.CB 8.2475 13.7458 17.8695 6.7875 Constraint (T0311)L42.CB (T0311)N69.CB 6.9567 11.5945 15.0728 6.7875 Constraint (T0311)R40.CB (T0311)L70.CB 7.1167 11.8612 15.4196 6.7875 Constraint (T0311)S39.CB (T0311)L70.CB 7.4612 12.4353 16.1659 6.7875 Constraint (T0311)A38.CB (T0311)Q71.CB 8.0234 13.3723 17.3839 6.7875 Constraint (T0311)A38.CB (T0311)L70.CB 5.9238 9.8730 12.8349 6.7875 Constraint (T0311)A38.CB (T0311)N69.CB 8.6218 14.3696 18.6805 6.7875 Constraint (T0311)T37.CB (T0311)L70.CB 7.5232 12.5387 16.3003 6.7875 Constraint (T0311)P35.CB (T0311)L70.CB 9.4294 15.7157 20.4304 6.7875 Constraint (T0311)I33.CB (T0311)Q71.CB 8.2189 13.6982 17.8077 6.7875 Constraint (T0311)I33.CB (T0311)L70.CB 7.0804 11.8006 15.3408 6.7875 Constraint (T0311)E32.CB (T0311)L70.CB 9.0028 15.0046 19.5060 6.7875 Constraint (T0311)A30.CB (T0311)L70.CB 8.7360 14.5600 18.9280 6.7875 Constraint (T0311)A28.CB (T0311)L70.CB 7.4635 12.4391 16.1708 6.7875 Constraint (T0311)L24.CB (T0311)L70.CB 8.3942 13.9903 18.1874 6.7875 Constraint (T0311)P64.CB (T0311)E78.CB 5.0312 8.3854 10.9010 6.7775 Constraint (T0311)S62.CB (T0311)D84.CB 8.7445 14.5742 18.9465 6.7775 Constraint (T0311)S57.CB (T0311)S86.CB 8.9276 14.8793 19.3430 6.7775 Constraint (T0311)K45.CB (T0311)I60.CB 8.2850 13.8082 17.9507 6.7544 Constraint (T0311)R29.CB (T0311)E80.CB 7.6352 12.7254 16.5430 6.7404 Constraint (T0311)L42.CB (T0311)A77.CB 6.5476 10.9127 14.1865 6.7403 Constraint (T0311)S39.CB (T0311)A79.CB 7.4202 12.3670 16.0771 6.7288 Constraint (T0311)S57.CB (T0311)N72.CB 8.4839 14.1398 18.3818 6.7267 Constraint (T0311)K45.CB (T0311)V59.CB 8.6638 14.4397 18.7716 6.6727 Constraint (T0311)A73.CB (T0311)V83.CB 8.9036 14.8394 19.2912 6.6478 Constraint (T0311)M52.CB (T0311)A77.CB 7.7087 12.8479 16.7023 6.6426 Constraint (T0311)V22.CB (T0311)A79.CB 6.5604 10.9340 14.2142 6.6408 Constraint (T0311)K55.CB (T0311)K81.CB 6.8777 11.4629 14.9017 6.6324 Constraint (T0311)S39.CB (T0311)E51.CB 8.1030 13.5050 17.5565 6.6043 Constraint (T0311)T49.CB (T0311)L70.CB 6.3340 10.5567 13.7238 6.5894 Constraint (T0311)A28.CB (T0311)P50.CB 9.5368 15.8947 20.6632 6.5894 Constraint (T0311)E15.CB (T0311)K55.CB 9.0540 15.0901 19.6171 6.5858 Constraint (T0311)M66.CB (T0311)V83.CB 6.8801 11.4668 14.9069 6.5841 Constraint (T0311)M52.CB (T0311)V83.CB 7.2730 12.1217 15.7583 6.5796 Constraint (T0311)Q14.CB (T0311)E32.CB 9.1817 15.3028 19.8936 6.5786 Constraint (T0311)L41.CB (T0311)S63.CB 8.5227 14.2045 18.4659 6.5622 Constraint (T0311)A28.CB (T0311)L76.CB 7.9136 13.1893 17.1461 6.5622 Constraint (T0311)F27.CB (T0311)L76.CB 6.5398 10.8996 14.1695 6.5622 Constraint (T0311)V22.CB (T0311)K81.CB 7.4201 12.3669 16.0769 6.5615 Constraint (T0311)T43.CB (T0311)A73.CB 7.1324 11.8874 15.4536 6.5576 Constraint (T0311)S39.CB (T0311)A73.CB 8.3337 13.8895 18.0564 6.5576 Constraint (T0311)W67.CB (T0311)L76.CB 7.2662 12.1104 15.7435 6.5535 Constraint (T0311)K55.CB (T0311)E78.CB 6.6210 11.0350 14.3455 6.4549 Constraint (T0311)S39.CB (T0311)P64.CB 7.9487 13.2478 17.2221 6.4513 Constraint (T0311)L24.CB (T0311)P64.CB 7.4592 12.4320 16.1615 6.4513 Constraint (T0311)V22.CB (T0311)P64.CB 7.6058 12.6764 16.4793 6.4513 Constraint (T0311)S57.CB (T0311)L76.CB 6.7141 11.1902 14.5473 6.4369 Constraint (T0311)V58.CB (T0311)T82.CB 6.2146 10.3577 13.4650 6.4350 Constraint (T0311)E15.CB (T0311)Q71.CB 7.4503 12.4171 16.1422 6.3076 Constraint (T0311)Q14.CB (T0311)Q71.CB 7.5229 12.5381 16.2996 6.3076 Constraint (T0311)D84.CB (T0311)Q94.CB 9.5369 15.8949 20.6633 6.2398 Constraint (T0311)A28.CB (T0311)A79.CB 5.6108 9.3513 12.1567 6.1561 Constraint (T0311)R25.CB (T0311)A79.CB 6.8312 11.3854 14.8010 6.1561 Constraint (T0311)A47.CB (T0311)E80.CB 8.9736 14.9559 19.4427 6.1526 Constraint (T0311)N72.CB (T0311)T82.CB 8.5756 14.2926 18.5804 6.1511 Constraint (T0311)I12.CB (T0311)A73.CB 6.8231 11.3719 14.7834 6.1431 Constraint (T0311)S16.CB (T0311)A73.CB 7.3148 12.1913 15.8487 6.1430 Constraint (T0311)M52.CB (T0311)S86.CB 8.7396 14.5660 18.9358 6.1363 Constraint (T0311)T49.CB (T0311)S86.CB 7.1662 11.9436 15.5267 6.1363 Constraint (T0311)L48.CB (T0311)S86.CB 8.5220 14.2034 18.4644 6.1363 Constraint (T0311)M66.CB (T0311)L76.CB 7.1511 11.9184 15.4940 6.1076 Constraint (T0311)M66.CB (T0311)A77.CB 7.4278 12.3796 16.0935 6.1063 Constraint (T0311)Q65.CB (T0311)L76.CB 6.1732 10.2886 13.3752 6.0893 Constraint (T0311)Q65.CB (T0311)W74.CB 7.9213 13.2022 17.1629 6.0469 Constraint (T0311)V59.CB (T0311)E80.CB 5.4298 9.0497 11.7646 6.0201 Constraint (T0311)A47.CB (T0311)E78.CB 7.3625 12.2709 15.9521 6.0067 Constraint (T0311)I54.CB (T0311)D84.CB 7.1238 11.8729 15.4348 5.9904 Constraint (T0311)A53.CB (T0311)V83.CB 5.0242 8.3737 10.8858 5.9904 Constraint (T0311)M52.CB (T0311)T82.CB 7.9212 13.2019 17.1625 5.9904 Constraint (T0311)E51.CB (T0311)V83.CB 6.0532 10.0886 13.1152 5.9904 Constraint (T0311)E51.CB (T0311)T82.CB 6.9651 11.6085 15.0911 5.9904 Constraint (T0311)P50.CB (T0311)D84.CB 6.3461 10.5769 13.7500 5.9904 Constraint (T0311)P50.CB (T0311)V83.CB 3.7540 6.2566 8.1336 5.9904 Constraint (T0311)P50.CB (T0311)T82.CB 4.0131 6.6885 8.6951 5.9904 Constraint (T0311)P50.CB (T0311)K81.CB 6.3012 10.5021 13.6527 5.9904 Constraint (T0311)T49.CB (T0311)V83.CB 6.4561 10.7602 13.9883 5.9904 Constraint (T0311)T49.CB (T0311)T82.CB 6.0813 10.1355 13.1761 5.9904 Constraint (T0311)T49.CB (T0311)K81.CB 8.4028 14.0046 18.2060 5.9904 Constraint (T0311)L48.CB (T0311)T82.CB 6.7508 11.2513 14.6267 5.9904 Constraint (T0311)A46.CB (T0311)S62.CB 9.3435 15.5725 20.2442 5.9890 Constraint (T0311)L20.CB (T0311)T37.CB 9.4061 15.6769 20.3799 5.9886 Constraint (T0311)D18.CB (T0311)A46.CB 9.2018 15.3363 19.9372 5.9886 Constraint (T0311)P64.CB (T0311)R87.CB 6.4716 10.7860 14.0219 5.9884 Constraint (T0311)P64.CB (T0311)S86.CB 7.2944 12.1573 15.8044 5.9884 Constraint (T0311)E51.CB (T0311)K81.CB 9.1147 15.1911 19.7485 5.9782 Constraint (T0311)L42.CB (T0311)D84.CB 7.6752 12.7920 16.6296 5.9340 Constraint (T0311)A38.CB (T0311)D84.CB 8.5604 14.2674 18.5476 5.9340 Constraint (T0311)L24.CB (T0311)D84.CB 7.6923 12.8206 16.6668 5.9340 Constraint (T0311)A34.CB (T0311)E80.CB 8.8060 14.6766 19.0796 5.9308 Constraint (T0311)I33.CB (T0311)V83.CB 7.6277 12.7128 16.5266 5.9308 Constraint (T0311)I33.CB (T0311)E80.CB 6.5581 10.9302 14.2092 5.9308 Constraint (T0311)E32.CB (T0311)V83.CB 7.9495 13.2492 17.2239 5.9308 Constraint (T0311)E32.CB (T0311)E80.CB 8.0178 13.3630 17.3719 5.9308 Constraint (T0311)R29.CB (T0311)V83.CB 5.6969 9.4948 12.3432 5.9308 Constraint (T0311)D11.CB (T0311)A28.CB 9.1379 15.2298 19.7987 5.9254 Constraint (T0311)Q14.CB (T0311)A34.CB 9.3391 15.5651 20.2347 5.9061 Constraint (T0311)E26.CB (T0311)R40.CB 9.4759 15.7931 20.5310 5.8752 Constraint (T0311)Q71.CB (T0311)K81.CB 8.5556 14.2594 18.5372 5.8731 Constraint (T0311)P9.CB (T0311)V58.CB 9.0863 15.1439 19.6870 5.8367 Constraint (T0311)R8.CB (T0311)L68.CB 6.8709 11.4514 14.8869 5.8367 Constraint (T0311)R8.CB (T0311)W67.CB 6.0436 10.0726 13.0944 5.8367 Constraint (T0311)R8.CB (T0311)M66.CB 8.1814 13.6357 17.7264 5.8367 Constraint (T0311)R8.CB (T0311)P64.CB 9.3000 15.5000 20.1500 5.8367 Constraint (T0311)R8.CB (T0311)S62.CB 9.2940 15.4900 20.1370 5.8367 Constraint (T0311)R8.CB (T0311)I60.CB 8.9928 14.9880 19.4843 5.8367 Constraint (T0311)R8.CB (T0311)S57.CB 9.2235 15.3725 19.9842 5.8367 Constraint (T0311)R8.CB (T0311)L56.CB 8.3891 13.9819 18.1765 5.8367 Constraint (T0311)R8.CB (T0311)A46.CB 7.6560 12.7601 16.5881 5.8367 Constraint (T0311)R8.CB (T0311)S39.CB 9.1127 15.1878 19.7442 5.8367 Constraint (T0311)R8.CB (T0311)E19.CB 9.4042 15.6736 20.3757 5.8367 Constraint (T0311)R8.CB (T0311)D18.CB 8.9390 14.8983 19.3677 5.8367 Constraint (T0311)R8.CB (T0311)L17.CB 8.2961 13.8269 17.9750 5.8367 Constraint (T0311)M31.CB (T0311)E78.CB 5.3579 8.9298 11.6087 5.8350 Constraint (T0311)A30.CB (T0311)A79.CB 3.5233 5.8722 7.6338 5.8350 Constraint (T0311)W67.CB (T0311)A79.CB 7.1389 11.8982 15.4677 5.8092 Constraint (T0311)W67.CB (T0311)E78.CB 7.7224 12.8706 16.7318 5.8092 Constraint (T0311)I60.CB (T0311)L76.CB 7.6880 12.8134 16.6574 5.8015 Constraint (T0311)R25.CB (T0311)V58.CB 9.4954 15.8257 20.5734 5.8002 Constraint (T0311)L42.CB (T0311)L76.CB 4.8158 8.0264 10.4343 5.7525 Constraint (T0311)L41.CB (T0311)L76.CB 4.6679 7.7798 10.1138 5.7525 Constraint (T0311)A38.CB (T0311)L76.CB 5.8539 9.7565 12.6835 5.7525 Constraint (T0311)P35.CB (T0311)A79.CB 7.1023 11.8372 15.3884 5.7513 Constraint (T0311)E26.CB (T0311)A53.CB 9.3846 15.6410 20.3333 5.7486 Constraint (T0311)S57.CB (T0311)A73.CB 7.9170 13.1950 17.1535 5.7430 Constraint (T0311)L56.CB (T0311)A73.CB 7.9475 13.2459 17.2196 5.7430 Constraint (T0311)L56.CB (T0311)N72.CB 8.1297 13.5495 17.6144 5.7411 Constraint (T0311)Q14.CB (T0311)P50.CB 9.5037 15.8394 20.5913 5.7352 Constraint (T0311)D11.CB (T0311)P50.CB 8.4914 14.1523 18.3980 5.7352 Constraint (T0311)A34.CB (T0311)P50.CB 8.8790 14.7984 19.2379 5.7351 Constraint (T0311)S36.CB (T0311)P50.CB 8.3311 13.8851 18.0506 5.7122 Constraint (T0311)D18.CB (T0311)E80.CB 6.8740 11.4567 14.8937 5.6645 Constraint (T0311)L17.CB (T0311)E80.CB 6.5255 10.8759 14.1386 5.6645 Constraint (T0311)S16.CB (T0311)E80.CB 6.5917 10.9862 14.2821 5.6645 Constraint (T0311)L17.CB (T0311)Q65.CB 8.2575 13.7625 17.8912 5.6622 Constraint (T0311)I12.CB (T0311)L76.CB 7.1731 11.9551 15.5416 5.5929 Constraint (T0311)T49.CB (T0311)S62.CB 9.3504 15.5840 20.2592 5.5730 Constraint (T0311)T43.CB (T0311)N72.CB 8.2809 13.8015 17.9420 5.5730 Constraint (T0311)T43.CB (T0311)N69.CB 7.7531 12.9218 16.7984 5.5730 Constraint (T0311)R40.CB (T0311)N72.CB 9.3538 15.5897 20.2666 5.5730 Constraint (T0311)R40.CB (T0311)Q71.CB 8.5758 14.2931 18.5810 5.5730 Constraint (T0311)R40.CB (T0311)N69.CB 8.8586 14.7644 19.1937 5.5730 Constraint (T0311)S39.CB (T0311)N72.CB 8.5904 14.3173 18.6124 5.5730 Constraint (T0311)T37.CB (T0311)Q71.CB 8.3866 13.9776 18.1709 5.5730 Constraint (T0311)S36.CB (T0311)N72.CB 9.1890 15.3150 19.9095 5.5730 Constraint (T0311)S36.CB (T0311)L70.CB 9.5735 15.9558 20.7425 5.5730 Constraint (T0311)E32.CB (T0311)Q71.CB 9.4215 15.7025 20.4132 5.5730 Constraint (T0311)A30.CB (T0311)P50.CB 8.6913 14.4855 18.8312 5.5730 Constraint (T0311)R29.CB (T0311)A53.CB 8.9602 14.9336 19.4137 5.5730 Constraint (T0311)R29.CB (T0311)T49.CB 9.3950 15.6583 20.3558 5.5730 Constraint (T0311)L24.CB (T0311)N72.CB 8.8733 14.7889 19.2255 5.5730 Constraint (T0311)V22.CB (T0311)E78.CB 8.7652 14.6086 18.9912 5.5692 Constraint (T0311)T49.CB (T0311)R87.CB 8.5970 14.3284 18.6269 5.5633 Constraint (T0311)L48.CB (T0311)V83.CB 6.5786 10.9644 14.2537 5.5633 Constraint (T0311)E26.CB (T0311)T43.CB 9.4713 15.7855 20.5212 5.5502 Constraint (T0311)M31.CB (T0311)L68.CB 7.5704 12.6174 16.4026 5.5478 Constraint (T0311)S23.CB (T0311)V58.CB 9.0855 15.1425 19.6852 5.5344 Constraint (T0311)K45.CB (T0311)A79.CB 8.3400 13.9000 18.0700 5.5315 Constraint (T0311)S23.CB (T0311)M52.CB 9.2476 15.4126 20.0364 5.4828 Constraint (T0311)R40.CB (T0311)P64.CB 8.9025 14.8375 19.2887 5.4738 Constraint (T0311)I60.CB (T0311)K81.CB 7.2031 12.0052 15.6067 5.3643 Constraint (T0311)F27.CB (T0311)D84.CB 6.4789 10.7982 14.0377 5.3510 Constraint (T0311)E26.CB (T0311)D84.CB 6.5391 10.8985 14.1681 5.3510 Constraint (T0311)L70.CB (T0311)E80.CB 7.4914 12.4856 16.2313 5.3256 Constraint (T0311)S39.CB (T0311)P50.CB 7.7281 12.8801 16.7441 5.3062 Constraint (T0311)S16.CB (T0311)E51.CB 8.7404 14.5674 18.9376 5.2920 Constraint (T0311)L17.CB (T0311)A77.CB 6.9896 11.6494 15.1442 5.2597 Constraint (T0311)S16.CB (T0311)A77.CB 7.2904 12.1507 15.7959 5.2597 Constraint (T0311)I60.CB (T0311)A73.CB 7.8929 13.1548 17.1012 5.2555 Constraint (T0311)I60.CB (T0311)N72.CB 8.0599 13.4331 17.4630 5.2536 Constraint (T0311)L56.CB (T0311)L76.CB 6.5023 10.8371 14.0882 5.2494 Constraint (T0311)V59.CB (T0311)L76.CB 7.6313 12.7189 16.5346 5.2475 Constraint (T0311)Q65.CB (T0311)S75.CB 6.3624 10.6041 13.7853 5.2372 Constraint (T0311)P64.CB (T0311)S75.CB 7.8609 13.1014 17.0319 5.2372 Constraint (T0311)L20.CB (T0311)S75.CB 8.7103 14.5172 18.8724 5.2363 Constraint (T0311)E19.CB (T0311)W74.CB 7.6371 12.7285 16.5470 5.2363 Constraint (T0311)F27.CB (T0311)A77.CB 7.6126 12.6877 16.4940 5.2327 Constraint (T0311)N69.CB (T0311)A79.CB 7.6419 12.7365 16.5575 5.2288 Constraint (T0311)V59.CB (T0311)K81.CB 5.4189 9.0316 11.7410 5.2208 Constraint (T0311)Q14.CB (T0311)I54.CB 7.8061 13.0101 16.9131 5.1895 Constraint (T0311)S23.CB (T0311)V85.CB 6.4697 10.7829 14.0178 5.1760 Constraint (T0311)V22.CB (T0311)R87.CB 8.4724 14.1206 18.3568 5.1689 Constraint (T0311)V22.CB (T0311)D84.CB 6.1330 10.2217 13.2882 5.1689 Constraint (T0311)I33.CB (T0311)A79.CB 5.3956 8.9927 11.6905 5.1683 Constraint (T0311)E32.CB (T0311)A79.CB 5.7897 9.6494 12.5443 5.1683 Constraint (T0311)E32.CB (T0311)E78.CB 6.7933 11.3222 14.7189 5.1683 Constraint (T0311)A30.CB (T0311)E78.CB 5.1212 8.5354 11.0960 5.1683 Constraint (T0311)R29.CB (T0311)A79.CB 5.3851 8.9751 11.6677 5.1683 Constraint (T0311)A28.CB (T0311)E78.CB 7.7302 12.8837 16.7488 5.1683 Constraint (T0311)F27.CB (T0311)E78.CB 5.9463 9.9106 12.8837 5.1683 Constraint (T0311)S16.CB (T0311)N72.CB 7.3952 12.3254 16.0230 5.1431 Constraint (T0311)E15.CB (T0311)A73.CB 7.3476 12.2460 15.9197 5.1431 Constraint (T0311)I13.CB (T0311)N72.CB 8.3731 13.9552 18.1418 5.1431 Constraint (T0311)I12.CB (T0311)N72.CB 6.6144 11.0239 14.3311 5.1431 Constraint (T0311)M52.CB (T0311)L76.CB 5.7289 9.5482 12.4126 5.1315 Constraint (T0311)L48.CB (T0311)L76.CB 6.5591 10.9319 14.2115 5.1315 Constraint (T0311)A47.CB (T0311)L76.CB 7.9140 13.1901 17.1471 5.1315 Constraint (T0311)S63.CB (T0311)S75.CB 8.4998 14.1664 18.4163 5.1095 Constraint (T0311)S62.CB (T0311)N72.CB 7.2827 12.1378 15.7791 5.0932 Constraint (T0311)D18.CB (T0311)Q71.CB 8.2602 13.7670 17.8971 5.0932 Constraint (T0311)S36.CB (T0311)I60.CB 9.1771 15.2952 19.8837 5.0566 Constraint (T0311)A46.CB (T0311)A79.CB 8.4040 14.0066 18.2086 5.0067 Constraint (T0311)E26.CB (T0311)S63.CB 8.6155 14.3591 18.6668 5.0051 Constraint (T0311)E15.CB (T0311)A79.CB 7.7948 12.9914 16.8888 4.9977 Constraint (T0311)Q14.CB (T0311)A79.CB 6.3911 10.6518 13.8473 4.9977 Constraint (T0311)L68.CB (T0311)E80.CB 7.9561 13.2601 17.2381 4.9921 Constraint (T0311)L20.CB (T0311)I54.CB 9.4398 15.7330 20.4529 4.9920 Constraint (T0311)L20.CB (T0311)A53.CB 8.5398 14.2331 18.5030 4.9920 Constraint (T0311)L20.CB (T0311)M52.CB 8.5124 14.1873 18.4434 4.9920 Constraint (T0311)L20.CB (T0311)L48.CB 9.4606 15.7676 20.4979 4.9920 Constraint (T0311)E19.CB (T0311)K55.CB 9.0122 15.0204 19.5265 4.9920 Constraint (T0311)E19.CB (T0311)A53.CB 8.6957 14.4928 18.8406 4.9920 Constraint (T0311)S16.CB (T0311)P50.CB 8.8696 14.7827 19.2175 4.9920 Constraint (T0311)S16.CB (T0311)T49.CB 8.6345 14.3908 18.7080 4.9920 Constraint (T0311)Q65.CB (T0311)S86.CB 8.3918 13.9864 18.1823 4.9904 Constraint (T0311)Q65.CB (T0311)V85.CB 7.4522 12.4203 16.1463 4.9904 Constraint (T0311)S63.CB (T0311)R87.CB 8.0233 13.3722 17.3838 4.9904 Constraint (T0311)V58.CB (T0311)R87.CB 8.9943 14.9905 19.4876 4.9904 Constraint (T0311)S57.CB (T0311)R87.CB 8.1563 13.5938 17.6720 4.9904 Constraint (T0311)K55.CB (T0311)S86.CB 9.2177 15.3628 19.9716 4.9904 Constraint (T0311)I54.CB (T0311)R87.CB 6.1811 10.3018 13.3924 4.9904 Constraint (T0311)I54.CB (T0311)S86.CB 6.3948 10.6580 13.8554 4.9904 Constraint (T0311)I54.CB (T0311)V85.CB 8.1647 13.6078 17.6901 4.9904 Constraint (T0311)A53.CB (T0311)R87.CB 7.7249 12.8749 16.7373 4.9904 Constraint (T0311)A53.CB (T0311)S86.CB 7.1047 11.8412 15.3936 4.9904 Constraint (T0311)A53.CB (T0311)V85.CB 8.1550 13.5916 17.6691 4.9904 Constraint (T0311)A53.CB (T0311)D84.CB 6.9595 11.5992 15.0789 4.9904 Constraint (T0311)E51.CB (T0311)R87.CB 7.6146 12.6910 16.4983 4.9904 Constraint (T0311)E51.CB (T0311)S86.CB 6.4925 10.8208 14.0671 4.9904 Constraint (T0311)E51.CB (T0311)V85.CB 8.9005 14.8342 19.2845 4.9904 Constraint (T0311)E51.CB (T0311)D84.CB 8.5548 14.2580 18.5354 4.9904 Constraint (T0311)P50.CB (T0311)R87.CB 5.7426 9.5711 12.4424 4.9904 Constraint (T0311)P50.CB (T0311)S86.CB 4.2096 7.0160 9.1209 4.9904 Constraint (T0311)P50.CB (T0311)V85.CB 6.0052 10.0087 13.0113 4.9904 Constraint (T0311)T49.CB (T0311)V85.CB 8.5161 14.1935 18.4516 4.9904 Constraint (T0311)T49.CB (T0311)D84.CB 8.7721 14.6201 19.0061 4.9904 Constraint (T0311)L48.CB (T0311)D84.CB 8.8748 14.7914 19.2288 4.9904 Constraint (T0311)L48.CB (T0311)K81.CB 7.7492 12.9154 16.7900 4.9904 Constraint (T0311)A47.CB (T0311)V83.CB 8.4464 14.0774 18.3006 4.9904 Constraint (T0311)A47.CB (T0311)T82.CB 7.3864 12.3107 16.0039 4.9904 Constraint (T0311)A47.CB (T0311)K81.CB 9.3340 15.5566 20.2236 4.9904 Constraint (T0311)W67.CB (T0311)T82.CB 6.8927 11.4878 14.9341 4.9890 Constraint (T0311)W67.CB (T0311)K81.CB 7.1549 11.9249 15.5023 4.9890 Constraint (T0311)M66.CB (T0311)T82.CB 7.5910 12.6517 16.4471 4.9890 Constraint (T0311)L42.CB (T0311)S75.CB 7.6514 12.7523 16.5781 4.9654 Constraint (T0311)L41.CB (T0311)S75.CB 6.1064 10.1773 13.2304 4.9654 Constraint (T0311)V22.CB (T0311)S63.CB 8.3908 13.9846 18.1800 4.9619 Constraint (T0311)T43.CB (T0311)A77.CB 7.7623 12.9371 16.8183 4.9532 Constraint (T0311)T43.CB (T0311)S86.CB 7.5651 12.6085 16.3911 4.9494 Constraint (T0311)T43.CB (T0311)V85.CB 7.5055 12.5092 16.2620 4.9494 Constraint (T0311)L42.CB (T0311)S86.CB 7.7855 12.9759 16.8686 4.9494 Constraint (T0311)L42.CB (T0311)V85.CB 7.2146 12.0243 15.6315 4.9494 Constraint (T0311)S39.CB (T0311)S86.CB 8.1945 13.6574 17.7546 4.9494 Constraint (T0311)S39.CB (T0311)V85.CB 7.7275 12.8791 16.7429 4.9494 Constraint (T0311)L24.CB (T0311)S86.CB 7.9608 13.2679 17.2483 4.9494 Constraint (T0311)A28.CB (T0311)D84.CB 9.0386 15.0643 19.5835 4.9462 Constraint (T0311)R25.CB (T0311)D84.CB 8.5407 14.2345 18.5048 4.9462 Constraint (T0311)S23.CB (T0311)D84.CB 6.6615 11.1025 14.4332 4.9462 Constraint (T0311)S36.CB (T0311)A79.CB 8.5306 14.2177 18.4830 4.9416 Constraint (T0311)L24.CB (T0311)E78.CB 8.7918 14.6529 19.0488 4.9416 Constraint (T0311)L24.CB (T0311)T49.CB 8.7128 14.5213 18.8776 4.9120 Constraint (T0311)L17.CB (T0311)T49.CB 9.2152 15.3587 19.9663 4.9120 Constraint (T0311)I12.CB (T0311)S36.CB 7.9755 13.2926 17.2803 4.9063 Constraint (T0311)P64.CB (T0311)W74.CB 7.6304 12.7173 16.5325 4.9009 Constraint (T0311)E15.CB (T0311)K81.CB 8.3825 13.9708 18.1620 4.8549 Constraint (T0311)E15.CB (T0311)E80.CB 6.2990 10.4983 13.6478 4.8549 Constraint (T0311)S62.CB (T0311)K81.CB 7.3314 12.2190 15.8847 4.8035 Constraint (T0311)N69.CB (T0311)T82.CB 7.5953 12.6588 16.4564 4.8018 Constraint (T0311)L56.CB (T0311)W74.CB 8.4392 14.0653 18.2849 4.7957 Constraint (T0311)I54.CB (T0311)L76.CB 5.6367 9.3945 12.2128 4.7881 Constraint (T0311)M31.CB (T0311)L76.CB 6.2266 10.3776 13.4909 4.7750 Constraint (T0311)L56.CB (T0311)D84.CB 8.4128 14.0214 18.2278 4.7718 Constraint (T0311)V22.CB (T0311)V83.CB 4.5521 7.5869 9.8629 4.7641 Constraint (T0311)R29.CB (T0311)E78.CB 7.7217 12.8696 16.7304 4.7635 Constraint (T0311)E26.CB (T0311)E78.CB 7.6526 12.7543 16.5805 4.7635 Constraint (T0311)L24.CB (T0311)A77.CB 8.3543 13.9238 18.1009 4.7442 Constraint (T0311)E26.CB (T0311)W67.CB 9.4126 15.6877 20.3940 4.7348 Constraint (T0311)S16.CB (T0311)A79.CB 6.4536 10.7560 13.9828 4.6683 Constraint (T0311)E19.CB (T0311)A77.CB 7.8199 13.0332 16.9431 4.6639 Constraint (T0311)K81.CB (T0311)L91.CB 9.3106 15.5177 20.1729 4.6628 Constraint (T0311)D11.CB (T0311)A77.CB 8.9287 14.8811 19.3454 4.6571 Constraint (T0311)E51.CB (T0311)A77.CB 7.5437 12.5728 16.3447 4.6523 Constraint (T0311)V58.CB (T0311)K81.CB 4.9376 8.2294 10.6982 4.6478 Constraint (T0311)A53.CB (T0311)N72.CB 8.9035 14.8392 19.2910 4.6335 Constraint (T0311)D18.CB (T0311)L76.CB 6.9676 11.6127 15.0965 4.5929 Constraint (T0311)L17.CB (T0311)L76.CB 5.8435 9.7392 12.6610 4.5929 Constraint (T0311)E15.CB (T0311)L76.CB 7.0387 11.7311 15.2504 4.5929 Constraint (T0311)Q14.CB (T0311)L76.CB 5.8378 9.7297 12.6487 4.5929 Constraint (T0311)E15.CB (T0311)I54.CB 8.5478 14.2463 18.5202 4.5856 Constraint (T0311)W67.CB (T0311)V83.CB 5.5290 9.2149 11.9794 4.5842 Constraint (T0311)M66.CB (T0311)D84.CB 8.2677 13.7795 17.9134 4.5697 Constraint (T0311)S75.CB (T0311)R87.CB 8.5949 14.3249 18.6223 4.5694 Constraint (T0311)E26.CB (T0311)L76.CB 7.2586 12.0976 15.7269 4.5660 Constraint (T0311)R25.CB (T0311)L76.CB 8.1723 13.6206 17.7068 4.5660 Constraint (T0311)L24.CB (T0311)L76.CB 6.3105 10.5176 13.6728 4.5660 Constraint (T0311)S23.CB (T0311)L76.CB 7.1935 11.9891 15.5859 4.5660 Constraint (T0311)P50.CB (T0311)L88.CB 7.9364 13.2273 17.1955 4.5633 Constraint (T0311)L88.CB (T0311)P97.CB 6.5655 10.9425 14.2253 4.5224 Constraint (T0311)R87.CB (T0311)P97.CB 8.4080 14.0134 18.2174 4.5224 Constraint (T0311)S36.CB (T0311)I54.CB 6.9788 11.6313 15.1207 4.5224 Constraint (T0311)M66.CB (T0311)E78.CB 8.0647 13.4412 17.4735 4.5111 Constraint (T0311)V59.CB (T0311)S75.CB 8.6769 14.4615 18.7999 4.4603 Constraint (T0311)D18.CB (T0311)A77.CB 6.7121 11.1868 14.5429 4.4501 Constraint (T0311)E15.CB (T0311)E78.CB 9.0493 15.0821 19.6068 4.4501 Constraint (T0311)E15.CB (T0311)A77.CB 7.0021 11.6702 15.1713 4.4501 Constraint (T0311)Q14.CB (T0311)A77.CB 6.3705 10.6175 13.8027 4.4501 Constraint (T0311)E19.CB (T0311)S75.CB 7.5556 12.5927 16.3705 4.4267 Constraint (T0311)E19.CB (T0311)N72.CB 7.0471 11.7451 15.2686 4.4267 Constraint (T0311)W67.CB (T0311)A77.CB 6.5685 10.9475 14.2317 4.4063 Constraint (T0311)D11.CB (T0311)A73.CB 7.6940 12.8233 16.6703 4.4048 Constraint (T0311)L42.CB (T0311)L88.CB 6.8992 11.4986 14.9482 4.3664 Constraint (T0311)A38.CB (T0311)L88.CB 7.8103 13.0171 16.9223 4.3664 Constraint (T0311)P35.CB (T0311)L88.CB 7.7270 12.8783 16.7418 4.3664 Constraint (T0311)F27.CB (T0311)L88.CB 7.6517 12.7528 16.5787 4.3664 Constraint (T0311)E26.CB (T0311)L88.CB 7.8299 13.0498 16.9647 4.3664 Constraint (T0311)R25.CB (T0311)L88.CB 7.3902 12.3169 16.0120 4.3664 Constraint (T0311)L24.CB (T0311)R89.CB 7.3019 12.1698 15.8207 4.3664 Constraint (T0311)L24.CB (T0311)L88.CB 5.5576 9.2626 12.0414 4.3664 Constraint (T0311)L24.CB (T0311)V85.CB 6.2176 10.3627 13.4715 4.3664 Constraint (T0311)S23.CB (T0311)L88.CB 5.8010 9.6683 12.5688 4.3664 Constraint (T0311)S23.CB (T0311)R87.CB 6.9190 11.5317 14.9913 4.3664 Constraint (T0311)S23.CB (T0311)S86.CB 7.5137 12.5228 16.2797 4.3664 Constraint (T0311)I60.CB (T0311)T82.CB 5.6426 9.4044 12.2257 4.3643 Constraint (T0311)I33.CB (T0311)E78.CB 6.6337 11.0562 14.3731 4.3587 Constraint (T0311)A30.CB (T0311)D84.CB 6.8025 11.3375 14.7387 4.3587 Constraint (T0311)V22.CB (T0311)I54.CB 8.9019 14.8365 19.2874 4.3581 Constraint (T0311)E19.CB (T0311)L76.CB 6.9537 11.5895 15.0663 4.3345 Constraint (T0311)L20.CB (T0311)N69.CB 8.3438 13.9063 18.0781 4.3335 Constraint (T0311)E19.CB (T0311)N69.CB 7.4871 12.4785 16.2221 4.3335 Constraint (T0311)E15.CB (T0311)N72.CB 7.8356 13.0594 16.9772 4.3335 Constraint (T0311)R40.CB (T0311)Q65.CB 8.9019 14.8365 19.2874 4.3057 Constraint (T0311)A38.CB (T0311)Q65.CB 8.2823 13.8039 17.9450 4.3057 Constraint (T0311)V22.CB (T0311)A77.CB 8.0406 13.4010 17.4213 4.2513 Constraint (T0311)N21.CB (T0311)E80.CB 6.2060 10.3434 13.4464 4.2513 Constraint (T0311)N21.CB (T0311)A79.CB 7.3855 12.3092 16.0020 4.2513 Constraint (T0311)N21.CB (T0311)A77.CB 7.4312 12.3853 16.1009 4.2513 Constraint (T0311)L20.CB (T0311)W74.CB 8.6270 14.3783 18.6918 4.2363 Constraint (T0311)A30.CB (T0311)M66.CB 8.7952 14.6587 19.0563 4.2144 Constraint (T0311)V22.CB (T0311)V85.CB 6.8064 11.3440 14.7472 4.1914 Constraint (T0311)Q14.CB (T0311)E80.CB 5.5331 9.2218 11.9883 4.1881 Constraint (T0311)E26.CB (T0311)V85.CB 6.8710 11.4517 14.8873 4.1837 Constraint (T0311)M52.CB (T0311)W74.CB 7.0438 11.7396 15.2615 4.1469 Constraint (T0311)L48.CB (T0311)W74.CB 7.6417 12.7362 16.5571 4.1469 Constraint (T0311)K45.CB (T0311)R87.CB 8.4171 14.0285 18.2371 4.1209 Constraint (T0311)I13.CB (T0311)A73.CB 7.8611 13.1018 17.0324 4.1096 Constraint (T0311)D11.CB (T0311)E32.CB 8.3412 13.9019 18.0725 4.1049 Constraint (T0311)S63.CB (T0311)W74.CB 8.4781 14.1302 18.3693 4.0932 Constraint (T0311)S62.CB (T0311)S75.CB 8.1715 13.6191 17.7049 4.0932 Constraint (T0311)S62.CB (T0311)W74.CB 8.2178 13.6964 17.8053 4.0932 Constraint (T0311)E19.CB (T0311)E80.CB 6.6550 11.0917 14.4192 4.0726 Constraint (T0311)E19.CB (T0311)A79.CB 7.4860 12.4766 16.2196 4.0726 Constraint (T0311)P35.CB (T0311)V58.CB 9.0726 15.1210 19.6572 4.0701 Constraint (T0311)D18.CB (T0311)S63.CB 8.6771 14.4619 18.8004 4.0344 Constraint (T0311)V59.CB (T0311)N69.CB 6.9994 11.6657 15.1654 4.0333 Constraint (T0311)R8.CB (T0311)A38.CB 8.8913 14.8189 19.2646 4.0163 Constraint (T0311)P7.CB (T0311)L48.CB 9.0132 15.0219 19.5285 4.0163 Constraint (T0311)P7.CB (T0311)L42.CB 8.0098 13.3497 17.3547 4.0163 Constraint (T0311)P7.CB (T0311)L41.CB 7.8841 13.1401 17.0821 4.0163 Constraint (T0311)P7.CB (T0311)S16.CB 7.1694 11.9490 15.5338 4.0163 Constraint (T0311)T82.CB (T0311)V92.CB 7.9329 13.2214 17.1879 3.9983 Constraint (T0311)E15.CB (T0311)V58.CB 9.2257 15.3761 19.9890 3.9980 Constraint (T0311)L70.CB (T0311)V83.CB 6.1079 10.1798 13.2338 3.9921 Constraint (T0311)L70.CB (T0311)T82.CB 5.7520 9.5866 12.4626 3.9921 Constraint (T0311)N69.CB (T0311)V83.CB 7.3939 12.3232 16.0201 3.9921 Constraint (T0311)M66.CB (T0311)K81.CB 7.1408 11.9013 15.4717 3.9909 Constraint (T0311)M52.CB (T0311)S75.CB 4.5103 7.5172 9.7723 3.9855 Constraint (T0311)E51.CB (T0311)L76.CB 6.2954 10.4923 13.6400 3.9855 Constraint (T0311)E51.CB (T0311)S75.CB 5.4707 9.1178 11.8531 3.9855 Constraint (T0311)P50.CB (T0311)L76.CB 6.4032 10.6719 13.8735 3.9855 Constraint (T0311)T49.CB (T0311)L76.CB 6.3389 10.5648 13.7342 3.9855 Constraint (T0311)T49.CB (T0311)S75.CB 5.7394 9.5656 12.4353 3.9855 Constraint (T0311)L48.CB (T0311)S75.CB 6.0760 10.1267 13.1647 3.9855 Constraint (T0311)A47.CB (T0311)S75.CB 7.6859 12.8099 16.6529 3.9855 Constraint (T0311)R40.CB (T0311)V92.CB 8.9273 14.8788 19.3425 3.9750 Constraint (T0311)K45.CB (T0311)A77.CB 6.5951 10.9918 14.2894 3.9654 Constraint (T0311)L41.CB (T0311)A77.CB 5.3612 8.9354 11.6160 3.9654 Constraint (T0311)R40.CB (T0311)A77.CB 8.1127 13.5212 17.5776 3.9654 Constraint (T0311)R40.CB (T0311)S75.CB 7.2053 12.0088 15.6115 3.9654 Constraint (T0311)S39.CB (T0311)S75.CB 8.6882 14.4803 18.8244 3.9654 Constraint (T0311)A38.CB (T0311)A77.CB 7.6169 12.6948 16.5032 3.9654 Constraint (T0311)A38.CB (T0311)S75.CB 7.6490 12.7484 16.5729 3.9654 Constraint (T0311)T37.CB (T0311)L76.CB 5.7950 9.6584 12.5559 3.9654 Constraint (T0311)T37.CB (T0311)S75.CB 7.5038 12.5064 16.2583 3.9654 Constraint (T0311)I33.CB (T0311)L76.CB 5.9812 9.9687 12.9594 3.9654 Constraint (T0311)T37.CB (T0311)K81.CB 9.3279 15.5465 20.2104 3.9647 Constraint (T0311)T43.CB (T0311)R89.CB 5.9199 9.8666 12.8265 3.9616 Constraint (T0311)T43.CB (T0311)L88.CB 6.3544 10.5907 13.7679 3.9616 Constraint (T0311)T43.CB (T0311)R87.CB 7.2200 12.0333 15.6432 3.9616 Constraint (T0311)L42.CB (T0311)R89.CB 6.9220 11.5366 14.9976 3.9616 Constraint (T0311)L42.CB (T0311)R87.CB 7.2969 12.1614 15.8099 3.9616 Constraint (T0311)S39.CB (T0311)R89.CB 7.0304 11.7173 15.2325 3.9616 Constraint (T0311)S39.CB (T0311)L88.CB 6.4095 10.6826 13.8874 3.9616 Constraint (T0311)S39.CB (T0311)R87.CB 7.5262 12.5436 16.3067 3.9616 Constraint (T0311)L24.CB (T0311)R87.CB 6.5365 10.8941 14.1623 3.9616 Constraint (T0311)K45.CB (T0311)V58.CB 7.9211 13.2018 17.1623 3.9615 Constraint (T0311)R40.CB (T0311)E78.CB 9.0215 15.0359 19.5466 3.9538 Constraint (T0311)A38.CB (T0311)E78.CB 6.8511 11.4185 14.8441 3.9538 Constraint (T0311)T37.CB (T0311)A79.CB 6.2029 10.3382 13.4397 3.9538 Constraint (T0311)T37.CB (T0311)E78.CB 7.6933 12.8222 16.6688 3.9538 Constraint (T0311)P35.CB (T0311)E78.CB 9.5347 15.8911 20.6585 3.9538 Constraint (T0311)A34.CB (T0311)A79.CB 7.3158 12.1931 15.8510 3.9538 Constraint (T0311)A34.CB (T0311)E78.CB 9.3716 15.6193 20.3051 3.9538 Constraint (T0311)M31.CB (T0311)D84.CB 8.3773 13.9622 18.1508 3.9538 Constraint (T0311)R29.CB (T0311)D84.CB 8.8359 14.7266 19.1445 3.9538 Constraint (T0311)E19.CB (T0311)E78.CB 8.7643 14.6072 18.9893 3.9514 Constraint (T0311)N21.CB (T0311)L76.CB 6.9953 11.6588 15.1565 3.9302 Constraint (T0311)D18.CB (T0311)W74.CB 7.8789 13.1315 17.0710 3.9009 Constraint (T0311)L17.CB (T0311)W74.CB 8.1084 13.5139 17.5681 3.9009 Constraint (T0311)Q14.CB (T0311)W74.CB 7.6356 12.7260 16.5437 3.9009 Constraint (T0311)R40.CB (T0311)S62.CB 8.5720 14.2867 18.5727 3.8804 Constraint (T0311)S39.CB (T0311)S63.CB 6.7078 11.1797 14.5336 3.8804 Constraint (T0311)S23.CB (T0311)P64.CB 7.7232 12.8720 16.7336 3.8804 Constraint (T0311)N21.CB (T0311)P64.CB 6.7188 11.1980 14.5574 3.8804 Constraint (T0311)V85.CB (T0311)P97.CB 8.2389 13.7315 17.8509 3.8557 Constraint (T0311)P9.CB (T0311)A28.CB 8.8317 14.7195 19.1353 3.8531 Constraint (T0311)I12.CB (T0311)S75.CB 7.9631 13.2718 17.2533 3.8058 Constraint (T0311)S62.CB (T0311)T82.CB 6.4787 10.7979 14.0373 3.8035 Constraint (T0311)K55.CB (T0311)L76.CB 6.7438 11.2397 14.6117 3.8035 Constraint (T0311)L41.CB (T0311)W74.CB 7.4373 12.3955 16.1142 3.7923 Constraint (T0311)K45.CB (T0311)M66.CB 8.4003 14.0005 18.2007 3.7876 Constraint (T0311)V22.CB (T0311)S86.CB 8.1137 13.5229 17.5797 3.7866 Constraint (T0311)D18.CB (T0311)E78.CB 8.6556 14.4260 18.7538 3.7833 Constraint (T0311)Q14.CB (T0311)V83.CB 6.1009 10.1682 13.2187 3.7833 Constraint (T0311)Q14.CB (T0311)T82.CB 7.3934 12.3224 16.0191 3.7833 Constraint (T0311)Q14.CB (T0311)K81.CB 7.3583 12.2639 15.9431 3.7833 Constraint (T0311)Q14.CB (T0311)E78.CB 7.2952 12.1587 15.8063 3.7833 Constraint (T0311)M31.CB (T0311)S75.CB 5.9151 9.8585 12.8160 3.7788 Constraint (T0311)P35.CB (T0311)L76.CB 7.4286 12.3809 16.0952 3.7564 Constraint (T0311)Q71.CB (T0311)T82.CB 7.0589 11.7648 15.2942 3.7192 Constraint (T0311)L17.CB (T0311)A79.CB 5.4537 9.0894 11.8163 3.6683 Constraint (T0311)S16.CB (T0311)K81.CB 7.9826 13.3043 17.2956 3.6683 Constraint (T0311)S16.CB (T0311)E78.CB 7.8994 13.1656 17.1153 3.6683 Constraint (T0311)I13.CB (T0311)E80.CB 6.9621 11.6035 15.0845 3.6683 Constraint (T0311)I12.CB (T0311)E78.CB 8.8913 14.8188 19.2645 3.6634 Constraint (T0311)S57.CB (T0311)S75.CB 8.2129 13.6881 17.7946 3.6498 Constraint (T0311)L56.CB (T0311)S75.CB 7.6321 12.7201 16.5361 3.6498 Constraint (T0311)I54.CB (T0311)A73.CB 8.3246 13.8743 18.0366 3.6498 Constraint (T0311)D18.CB (T0311)I33.CB 9.4606 15.7677 20.4981 3.5957 Constraint (T0311)N21.CB (T0311)T82.CB 8.6515 14.4191 18.7449 3.5846 Constraint (T0311)N21.CB (T0311)K81.CB 8.1339 13.5565 17.6235 3.5846 Constraint (T0311)S86.CB (T0311)T96.CB 8.5222 14.2037 18.4648 3.5709 Constraint (T0311)D18.CB (T0311)K55.CB 9.0849 15.1415 19.6840 3.5690 Constraint (T0311)N69.CB (T0311)E78.CB 8.0100 13.3500 17.3550 3.5642 Constraint (T0311)K45.CB (T0311)L88.CB 8.9137 14.8561 19.3129 3.5499 Constraint (T0311)K55.CB (T0311)W74.CB 8.5356 14.2260 18.4939 3.4957 Constraint (T0311)V59.CB (T0311)E78.CB 6.6720 11.1199 14.4559 3.4702 Constraint (T0311)V58.CB (T0311)E78.CB 6.9875 11.6459 15.1397 3.4702 Constraint (T0311)V59.CB (T0311)A73.CB 7.6073 12.6788 16.4824 3.4603 Constraint (T0311)V59.CB (T0311)N72.CB 7.7865 12.9775 16.8707 3.4603 Constraint (T0311)A30.CB (T0311)A77.CB 7.2724 12.1207 15.7569 3.4456 Constraint (T0311)V22.CB (T0311)N72.CB 8.5508 14.2513 18.5267 3.4267 Constraint (T0311)V22.CB (T0311)Q71.CB 7.4067 12.3446 16.0479 3.4267 Constraint (T0311)N21.CB (T0311)S75.CB 8.7875 14.6459 19.0397 3.4267 Constraint (T0311)N21.CB (T0311)N72.CB 7.3275 12.2125 15.8763 3.4267 Constraint (T0311)N21.CB (T0311)Q71.CB 6.8464 11.4106 14.8338 3.4267 Constraint (T0311)L20.CB (T0311)N72.CB 7.3033 12.1722 15.8238 3.4267 Constraint (T0311)L17.CB (T0311)N72.CB 8.4120 14.0200 18.2260 3.4267 Constraint (T0311)Q71.CB (T0311)V83.CB 6.7181 11.1968 14.5559 3.4192 Constraint (T0311)D11.CB (T0311)Q71.CB 5.3236 8.8727 11.5345 3.4048 Constraint (T0311)L24.CB (T0311)L91.CB 7.8475 13.0791 17.0029 3.3818 Constraint (T0311)S23.CB (T0311)L91.CB 8.2340 13.7234 17.8404 3.3818 Constraint (T0311)V22.CB (T0311)L88.CB 7.0531 11.7552 15.2817 3.3818 Constraint (T0311)K45.CB (T0311)P64.CB 7.7975 12.9958 16.8946 3.3806 Constraint (T0311)A28.CB (T0311)L88.CB 8.4770 14.1283 18.3668 3.3740 Constraint (T0311)A28.CB (T0311)V85.CB 8.2723 13.7871 17.9233 3.3740 Constraint (T0311)F27.CB (T0311)V85.CB 6.1813 10.3022 13.3929 3.3740 Constraint (T0311)R25.CB (T0311)V85.CB 7.2761 12.1268 15.7649 3.3740 Constraint (T0311)S23.CB (T0311)R89.CB 7.4780 12.4634 16.2024 3.3740 Constraint (T0311)I60.CB (T0311)D84.CB 8.4481 14.0802 18.3042 3.3601 Constraint (T0311)V58.CB (T0311)S75.CB 8.2414 13.7356 17.8563 3.3498 Constraint (T0311)R40.CB (T0311)M66.CB 8.2617 13.7696 17.9004 3.3076 Constraint (T0311)S39.CB (T0311)M66.CB 7.3771 12.2951 15.9837 3.3076 Constraint (T0311)F27.CB (T0311)Q65.CB 8.3187 13.8646 18.0239 3.3076 Constraint (T0311)L24.CB (T0311)M66.CB 8.2273 13.7122 17.8258 3.3076 Constraint (T0311)D18.CB (T0311)P64.CB 7.0483 11.7471 15.2713 3.2847 Constraint (T0311)I13.CB (T0311)A77.CB 8.3333 13.8889 18.0555 3.2635 Constraint (T0311)I60.CB (T0311)W74.CB 8.3861 13.9768 18.1698 3.2392 Constraint (T0311)L17.CB (T0311)A73.CB 8.0258 13.3764 17.3893 3.2028 Constraint (T0311)I12.CB (T0311)V83.CB 7.1161 11.8602 15.4183 3.1920 Constraint (T0311)Q14.CB (T0311)L88.CB 8.5587 14.2645 18.5439 3.1901 Constraint (T0311)I60.CB (T0311)S75.CB 8.8655 14.7759 19.2087 3.1623 Constraint (T0311)L48.CB (T0311)V85.CB 8.9932 14.9887 19.4854 3.1459 Constraint (T0311)L20.CB (T0311)A73.CB 8.2228 13.7047 17.8161 3.1430 Constraint (T0311)A47.CB (T0311)S86.CB 7.3376 12.2294 15.8982 3.1337 Constraint (T0311)S36.CB (T0311)V58.CB 7.3623 12.2704 15.9516 3.1096 Constraint (T0311)S39.CB (T0311)Q65.CB 7.3733 12.2889 15.9756 3.0913 Constraint (T0311)D18.CB (T0311)Q65.CB 8.4628 14.1047 18.3361 3.0913 Constraint (T0311)Q14.CB (T0311)Q65.CB 7.3823 12.3038 15.9950 3.0913 Constraint (T0311)D11.CB (T0311)S23.CB 9.5142 15.8570 20.6140 3.0904 Constraint (T0311)D11.CB (T0311)E26.CB 9.5208 15.8679 20.6283 3.0886 Constraint (T0311)L68.CB (T0311)E78.CB 8.7157 14.5262 18.8841 3.0363 Constraint (T0311)N72.CB (T0311)V83.CB 7.7179 12.8632 16.7221 3.0144 Constraint (T0311)D18.CB (T0311)A79.CB 6.7633 11.2722 14.6538 3.0016 Constraint (T0311)L17.CB (T0311)T82.CB 6.5997 10.9994 14.2992 3.0016 Constraint (T0311)S16.CB (T0311)T82.CB 7.7197 12.8662 16.7261 3.0016 Constraint (T0311)I13.CB (T0311)T82.CB 7.2921 12.1535 15.7996 3.0016 Constraint (T0311)I13.CB (T0311)A79.CB 5.1415 8.5692 11.1400 3.0016 Constraint (T0311)I13.CB (T0311)E78.CB 7.8994 13.1656 17.1153 3.0016 Constraint (T0311)I54.CB (T0311)S75.CB 5.7537 9.5895 12.4664 3.0009 Constraint (T0311)A53.CB (T0311)L76.CB 4.7330 7.8883 10.2548 3.0009 Constraint (T0311)A53.CB (T0311)S75.CB 5.1783 8.6306 11.2197 3.0009 Constraint (T0311)E51.CB (T0311)W74.CB 6.6389 11.0648 14.3842 3.0009 Constraint (T0311)P50.CB (T0311)A73.CB 5.9440 9.9066 12.8786 3.0009 Constraint (T0311)T49.CB (T0311)W74.CB 6.4152 10.6920 13.8996 3.0009 Constraint (T0311)T49.CB (T0311)A73.CB 5.7328 9.5547 12.4211 3.0009 Constraint (T0311)L48.CB (T0311)A73.CB 5.8116 9.6860 12.5918 3.0009 Constraint (T0311)A47.CB (T0311)W74.CB 7.7353 12.8921 16.7597 3.0009 Constraint (T0311)A47.CB (T0311)A73.CB 7.0257 11.7095 15.2223 3.0009 Constraint (T0311)D11.CB (T0311)N72.CB 7.5708 12.6180 16.4034 3.0000 Constraint (T0311)P9.CB (T0311)L20.CB 9.5655 15.9424 20.7251 3.0000 Constraint (T0311)P7.CB (T0311)L68.CB 5.9356 9.8927 12.8605 3.0000 Constraint (T0311)P7.CB (T0311)W67.CB 5.1750 8.6251 11.2126 3.0000 Constraint (T0311)P7.CB (T0311)M66.CB 6.1714 10.2856 13.3713 3.0000 Constraint (T0311)P7.CB (T0311)Q65.CB 7.6938 12.8230 16.6698 3.0000 Constraint (T0311)P7.CB (T0311)P64.CB 8.3841 13.9736 18.1656 3.0000 Constraint (T0311)P7.CB (T0311)S63.CB 9.1242 15.2071 19.7692 3.0000 Constraint (T0311)P7.CB (T0311)S62.CB 8.0537 13.4228 17.4497 3.0000 Constraint (T0311)P7.CB (T0311)I60.CB 8.5912 14.3187 18.6143 3.0000 Constraint (T0311)P7.CB (T0311)S57.CB 8.7634 14.6056 18.9873 3.0000 Constraint (T0311)P7.CB (T0311)L56.CB 8.8360 14.7266 19.1446 3.0000 Constraint (T0311)P7.CB (T0311)A53.CB 8.7822 14.6370 19.0281 3.0000 Constraint (T0311)P7.CB (T0311)A47.CB 8.0484 13.4139 17.4381 3.0000 Constraint (T0311)P7.CB (T0311)T43.CB 9.1684 15.2807 19.8649 3.0000 Constraint (T0311)P7.CB (T0311)E19.CB 8.4651 14.1084 18.3410 3.0000 Constraint (T0311)P7.CB (T0311)D18.CB 9.0240 15.0399 19.5519 3.0000 Constraint (T0311)P7.CB (T0311)L17.CB 8.6818 14.4697 18.8106 3.0000 Constraint (T0311)H6.CB (T0311)L68.CB 6.1345 10.2241 13.2913 3.0000 Constraint (T0311)H6.CB (T0311)W67.CB 7.1212 11.8686 15.4292 3.0000 Constraint (T0311)H6.CB (T0311)M66.CB 8.2761 13.7934 17.9315 3.0000 Constraint (T0311)H6.CB (T0311)Q65.CB 8.5226 14.2043 18.4656 3.0000 Constraint (T0311)H6.CB (T0311)P64.CB 9.4430 15.7383 20.4598 3.0000 Constraint (T0311)H6.CB (T0311)A47.CB 8.6991 14.4986 18.8481 3.0000 Constraint (T0311)H6.CB (T0311)E15.CB 8.9056 14.8427 19.2955 3.0000 Constraint (T0311)N5.CB (T0311)L68.CB 8.4486 14.0811 18.3054 3.0000 Constraint (T0311)N5.CB (T0311)W67.CB 8.2848 13.8080 17.9504 3.0000 Constraint (T0311)N5.CB (T0311)A47.CB 8.6185 14.3642 18.6735 3.0000 Constraint (T0311)N5.CB (T0311)T43.CB 9.2051 15.3418 19.9444 3.0000 Constraint (T0311)N5.CB (T0311)L42.CB 9.0136 15.0227 19.5295 3.0000 Constraint (T0311)N5.CB (T0311)E15.CB 8.2177 13.6962 17.8051 3.0000 Constraint (T0311)N5.CB (T0311)Q14.CB 8.4169 14.0281 18.2365 3.0000 Constraint (T0311)R29.CB (T0311)S62.CB 9.4898 15.8163 20.5611 3.0000 Constraint (T0311)D18.CB (T0311)R40.CB 8.9570 14.9284 19.4069 3.0000 Constraint (T0311)D11.CB (T0311)I54.CB 8.3891 13.9818 18.1763 3.0000 Constraint (T0311)L20.CB (T0311)K45.CB 8.3750 13.9584 18.1459 2.9942 Constraint (T0311)E19.CB (T0311)K45.CB 8.2531 13.7552 17.8818 2.9942 Constraint (T0311)L70.CB (T0311)K81.CB 6.9652 11.6087 15.0913 2.9922 Constraint (T0311)L68.CB (T0311)T82.CB 7.4805 12.4674 16.2077 2.9922 Constraint (T0311)A30.CB (T0311)A46.CB 9.5177 15.8629 20.6217 2.9893 Constraint (T0311)S23.CB (T0311)A46.CB 9.5404 15.9007 20.6709 2.9886 Constraint (T0311)V22.CB (T0311)A47.CB 9.3425 15.5709 20.2422 2.9886 Constraint (T0311)V22.CB (T0311)A46.CB 7.0292 11.7153 15.2299 2.9886 Constraint (T0311)V22.CB (T0311)K45.CB 8.4529 14.0882 18.3147 2.9886 Constraint (T0311)A46.CB (T0311)L76.CB 7.6712 12.7853 16.6209 2.9855 Constraint (T0311)K45.CB (T0311)K81.CB 8.2947 13.8245 17.9719 2.9840 Constraint (T0311)T43.CB (T0311)E78.CB 8.6172 14.3620 18.6706 2.9840 Constraint (T0311)K45.CB (T0311)T93.CB 8.1381 13.5635 17.6325 2.9827 Constraint (T0311)T43.CB (T0311)T93.CB 6.6246 11.0411 14.3534 2.9827 Constraint (T0311)R40.CB (T0311)T93.CB 9.0179 15.0298 19.5388 2.9827 Constraint (T0311)W74.CB (T0311)V85.CB 8.6213 14.3688 18.6795 2.9826 Constraint (T0311)K45.CB (T0311)V92.CB 8.2727 13.7878 17.9241 2.9769 Constraint (T0311)T43.CB (T0311)V92.CB 6.0050 10.0083 13.0107 2.9769 Constraint (T0311)T43.CB (T0311)L91.CB 7.8264 13.0439 16.9571 2.9769 Constraint (T0311)T43.CB (T0311)R90.CB 7.7052 12.8419 16.6945 2.9769 Constraint (T0311)L42.CB (T0311)V92.CB 7.8610 13.1017 17.0322 2.9769 Constraint (T0311)S39.CB (T0311)V92.CB 6.2692 10.4487 13.5833 2.9769 Constraint (T0311)S39.CB (T0311)L91.CB 7.9807 13.3012 17.2916 2.9769 Constraint (T0311)S39.CB (T0311)R90.CB 8.6837 14.4729 18.8148 2.9769 Constraint (T0311)A38.CB (T0311)V92.CB 8.7689 14.6149 18.9993 2.9769 Constraint (T0311)T37.CB (T0311)T82.CB 9.5182 15.8637 20.6229 2.9769 Constraint (T0311)S36.CB (T0311)V92.CB 8.0487 13.4146 17.4389 2.9769 Constraint (T0311)S36.CB (T0311)L88.CB 8.7285 14.5475 18.9117 2.9769 Constraint (T0311)P35.CB (T0311)V92.CB 7.8636 13.1060 17.0378 2.9769 Constraint (T0311)L24.CB (T0311)V92.CB 6.8781 11.4635 14.9026 2.9769 Constraint (T0311)L24.CB (T0311)R90.CB 8.7821 14.6368 19.0279 2.9769 Constraint (T0311)S23.CB (T0311)V92.CB 8.2458 13.7431 17.8660 2.9769 Constraint (T0311)L41.CB (T0311)D84.CB 9.0593 15.0989 19.6285 2.9724 Constraint (T0311)S39.CB (T0311)E78.CB 9.2086 15.3477 19.9520 2.9724 Constraint (T0311)A38.CB (T0311)R89.CB 8.3572 13.9286 18.1072 2.9692 Constraint (T0311)A38.CB (T0311)V85.CB 7.2516 12.0859 15.7117 2.9692 Constraint (T0311)P35.CB (T0311)V85.CB 7.9058 13.1764 17.1293 2.9692 Constraint (T0311)P50.CB (T0311)S75.CB 4.9584 8.2640 10.7432 2.9692 Constraint (T0311)E32.CB (T0311)K45.CB 9.2896 15.4827 20.1275 2.9634 Constraint (T0311)A30.CB (T0311)K45.CB 9.5133 15.8556 20.6122 2.9634 Constraint (T0311)R25.CB (T0311)S57.CB 9.4284 15.7141 20.4283 2.9634 Constraint (T0311)S39.CB (T0311)A77.CB 8.1095 13.5159 17.5706 2.9570 Constraint (T0311)R29.CB (T0311)S63.CB 9.5774 15.9624 20.7511 2.9118 Constraint (T0311)R25.CB (T0311)L48.CB 9.3421 15.5701 20.2412 2.9118 Constraint (T0311)S23.CB (T0311)L48.CB 9.3633 15.6056 20.2873 2.9118 Constraint (T0311)E15.CB (T0311)A47.CB 8.9439 14.9066 19.3786 2.9118 Constraint (T0311)Q14.CB (T0311)T49.CB 8.6447 14.4079 18.7303 2.9118 Constraint (T0311)E19.CB (T0311)I33.CB 9.4033 15.6721 20.3738 2.9104 Constraint (T0311)A28.CB (T0311)P64.CB 8.2392 13.7320 17.8516 2.9028 Constraint (T0311)D18.CB (T0311)A73.CB 8.9381 14.8969 19.3660 2.9028 Constraint (T0311)L20.CB (T0311)A79.CB 7.1496 11.9159 15.4907 2.8811 Constraint (T0311)L24.CB (T0311)E51.CB 8.9338 14.8896 19.3565 2.8709 Constraint (T0311)S16.CB (T0311)D84.CB 7.6287 12.7145 16.5289 2.8587 Constraint (T0311)S16.CB (T0311)V83.CB 6.1918 10.3197 13.4155 2.8587 Constraint (T0311)P9.CB (T0311)L70.CB 5.2332 8.7219 11.3385 2.8367 Constraint (T0311)P9.CB (T0311)N69.CB 6.5076 10.8460 14.0998 2.8367 Constraint (T0311)P9.CB (T0311)V22.CB 9.4997 15.8328 20.5827 2.8367 Constraint (T0311)R8.CB (T0311)A73.CB 9.2967 15.4944 20.1428 2.8367 Constraint (T0311)R8.CB (T0311)L70.CB 5.0400 8.4000 10.9200 2.8367 Constraint (T0311)R8.CB (T0311)N69.CB 6.8401 11.4002 14.8203 2.8367 Constraint (T0311)R8.CB (T0311)Q65.CB 9.3664 15.6106 20.2938 2.8367 Constraint (T0311)R8.CB (T0311)M52.CB 9.5332 15.8886 20.6552 2.8367 Constraint (T0311)E15.CB (T0311)S75.CB 9.1534 15.2557 19.8324 2.8058 Constraint (T0311)I60.CB (T0311)E78.CB 6.4246 10.7076 13.9199 2.8035 Constraint (T0311)P35.CB (T0311)I54.CB 7.8043 13.0072 16.9094 2.8035 Constraint (T0311)L42.CB (T0311)W74.CB 7.3122 12.1870 15.8431 2.7923 Constraint (T0311)A38.CB (T0311)W74.CB 8.7080 14.5133 18.8672 2.7923 Constraint (T0311)S62.CB (T0311)V85.CB 8.3448 13.9080 18.0804 2.7872 Constraint (T0311)I60.CB (T0311)R87.CB 9.2847 15.4745 20.1169 2.7872 Constraint (T0311)S57.CB (T0311)V85.CB 9.0448 15.0746 19.5970 2.7872 Constraint (T0311)L56.CB (T0311)S86.CB 8.2236 13.7061 17.8179 2.7872 Constraint (T0311)I12.CB (T0311)D84.CB 8.6666 14.4443 18.7777 2.7872 Constraint (T0311)E78.CB (T0311)R89.CB 9.4981 15.8302 20.5793 2.7852 Constraint (T0311)E15.CB (T0311)R87.CB 6.4722 10.7871 14.0232 2.7852 Constraint (T0311)Q14.CB (T0311)R87.CB 6.1143 10.1905 13.2477 2.7852 Constraint (T0311)I12.CB (T0311)R87.CB 7.9516 13.2527 17.2285 2.7852 Constraint (T0311)A30.CB (T0311)L76.CB 5.7789 9.6315 12.5209 2.7788 Constraint (T0311)R29.CB (T0311)L76.CB 7.4908 12.4847 16.2301 2.7788 Constraint (T0311)F27.CB (T0311)S75.CB 6.7707 11.2846 14.6699 2.7788 Constraint (T0311)E26.CB (T0311)A77.CB 8.4073 14.0122 18.2159 2.7788 Constraint (T0311)S23.CB (T0311)A77.CB 8.2354 13.7257 17.8434 2.7750 Constraint (T0311)N21.CB (T0311)E78.CB 8.2932 13.8221 17.9687 2.7750 Constraint (T0311)P35.CB (T0311)P50.CB 9.2737 15.4562 20.0931 2.7352 Constraint (T0311)I12.CB (T0311)K81.CB 8.3152 13.8586 18.0162 2.6673 Constraint (T0311)T82.CB (T0311)T93.CB 7.1116 11.8526 15.4084 2.6629 Constraint (T0311)R40.CB (T0311)L68.CB 9.5154 15.8590 20.6167 2.6582 Constraint (T0311)V58.CB (T0311)A73.CB 7.1438 11.9063 15.4782 2.6498 Constraint (T0311)K55.CB (T0311)A73.CB 7.2705 12.1175 15.7527 2.6498 Constraint (T0311)M31.CB (T0311)A77.CB 5.7756 9.6260 12.5138 2.6359 Constraint (T0311)S57.CB (T0311)W74.CB 7.8005 13.0009 16.9012 2.6335 Constraint (T0311)V58.CB (T0311)N72.CB 6.9200 11.5334 14.9934 2.6315 Constraint (T0311)K55.CB (T0311)N72.CB 8.3470 13.9116 18.0851 2.6315 Constraint (T0311)V22.CB (T0311)L76.CB 5.5550 9.2583 12.0358 2.5968 Constraint (T0311)L17.CB (T0311)K81.CB 6.6634 11.1056 14.4373 2.5968 Constraint (T0311)L17.CB (T0311)E78.CB 6.9220 11.5367 14.9977 2.5968 Constraint (T0311)I13.CB (T0311)L76.CB 6.4945 10.8241 14.0713 2.5968 Constraint (T0311)E15.CB (T0311)L88.CB 8.4866 14.1443 18.3875 2.5943 Constraint (T0311)L68.CB (T0311)V83.CB 6.4451 10.7419 13.9644 2.5874 Constraint (T0311)A34.CB (T0311)L70.CB 9.5583 15.9306 20.7097 2.5732 Constraint (T0311)W67.CB (T0311)R87.CB 6.0600 10.1001 13.1301 2.5710 Constraint (T0311)L70.CB (T0311)S86.CB 7.1551 11.9252 15.5027 2.5710 Constraint (T0311)N69.CB (T0311)S86.CB 8.9901 14.9835 19.4785 2.5710 Constraint (T0311)A46.CB (T0311)V58.CB 8.6168 14.3614 18.6698 2.5709 Constraint (T0311)T43.CB (T0311)P64.CB 8.6424 14.4040 18.7251 2.5709 Constraint (T0311)S23.CB (T0311)A53.CB 9.4568 15.7613 20.4896 2.5709 Constraint (T0311)N21.CB (T0311)S57.CB 9.3400 15.5667 20.2367 2.5709 Constraint (T0311)N21.CB (T0311)K55.CB 8.9980 14.9966 19.4956 2.5709 Constraint (T0311)D18.CB (T0311)V58.CB 9.3597 15.5995 20.2793 2.5709 Constraint (T0311)W67.CB (T0311)D84.CB 7.2692 12.1154 15.7500 2.5698 Constraint (T0311)A38.CB (T0311)L68.CB 8.9332 14.8887 19.3553 2.5479 Constraint (T0311)M31.CB (T0311)N69.CB 5.6086 9.3476 12.1519 2.5479 Constraint (T0311)A30.CB (T0311)N69.CB 7.6563 12.7605 16.5887 2.5479 Constraint (T0311)A30.CB (T0311)L68.CB 7.5641 12.6069 16.3890 2.5479 Constraint (T0311)A28.CB (T0311)L68.CB 8.8913 14.8188 19.2644 2.5479 Constraint (T0311)F27.CB (T0311)N69.CB 7.3195 12.1991 15.8589 2.5479 Constraint (T0311)F27.CB (T0311)L68.CB 7.5299 12.5499 16.3149 2.5479 Constraint (T0311)V22.CB (T0311)N69.CB 8.5985 14.3308 18.6300 2.5479 Constraint (T0311)L17.CB (T0311)N69.CB 7.9366 13.2276 17.1959 2.5479 Constraint (T0311)V59.CB (T0311)W74.CB 7.5311 12.5519 16.3174 2.4623 Constraint (T0311)V59.CB (T0311)S86.CB 8.8218 14.7030 19.1139 2.4539 Constraint (T0311)N21.CB (T0311)D84.CB 7.4496 12.4160 16.1408 2.4539 Constraint (T0311)N21.CB (T0311)V83.CB 7.3117 12.1862 15.8420 2.4539 Constraint (T0311)L68.CB (T0311)A79.CB 6.6990 11.1651 14.5146 2.4192 Constraint (T0311)M66.CB (T0311)L88.CB 7.5531 12.5886 16.3651 2.4029 Constraint (T0311)A28.CB (T0311)R89.CB 9.4828 15.8047 20.5462 2.3894 Constraint (T0311)F27.CB (T0311)R89.CB 8.2070 13.6783 17.7818 2.3894 Constraint (T0311)E26.CB (T0311)R89.CB 8.7792 14.6320 19.0216 2.3894 Constraint (T0311)R25.CB (T0311)R89.CB 8.6241 14.3736 18.6856 2.3894 Constraint (T0311)V22.CB (T0311)R89.CB 7.5213 12.5355 16.2962 2.3894 Constraint (T0311)A28.CB (T0311)R87.CB 8.3205 13.8676 18.0278 2.3817 Constraint (T0311)F27.CB (T0311)R87.CB 6.9008 11.5014 14.9518 2.3817 Constraint (T0311)E26.CB (T0311)R87.CB 7.4696 12.4494 16.1842 2.3817 Constraint (T0311)R25.CB (T0311)R87.CB 7.6233 12.7055 16.5171 2.3817 Constraint (T0311)K81.CB (T0311)V92.CB 8.9083 14.8472 19.3013 2.3315 Constraint (T0311)E80.CB (T0311)V92.CB 7.3376 12.2294 15.8982 2.3315 Constraint (T0311)A79.CB (T0311)V92.CB 4.8986 8.1644 10.6137 2.3315 Constraint (T0311)E78.CB (T0311)V92.CB 7.6658 12.7763 16.6092 2.3315 Constraint (T0311)E78.CB (T0311)R90.CB 7.6782 12.7970 16.6361 2.3315 Constraint (T0311)A77.CB (T0311)V92.CB 9.0586 15.0977 19.6270 2.3315 Constraint (T0311)A77.CB (T0311)R90.CB 8.6035 14.3391 18.6409 2.3315 Constraint (T0311)L76.CB (T0311)V92.CB 6.8252 11.3754 14.7880 2.3315 Constraint (T0311)L76.CB (T0311)R90.CB 7.4074 12.3457 16.0494 2.3315 Constraint (T0311)S75.CB (T0311)V92.CB 6.7127 11.1879 14.5443 2.3315 Constraint (T0311)S75.CB (T0311)R90.CB 8.3908 13.9847 18.1801 2.3315 Constraint (T0311)A53.CB (T0311)A73.CB 6.8158 11.3597 14.7676 2.3163 Constraint (T0311)M52.CB (T0311)A73.CB 4.1169 6.8615 8.9200 2.3009 Constraint (T0311)E19.CB (T0311)M52.CB 9.3095 15.5158 20.1706 2.3002 Constraint (T0311)E19.CB (T0311)D84.CB 7.0382 11.7304 15.2495 2.2630 Constraint (T0311)E19.CB (T0311)V83.CB 6.7507 11.2511 14.6264 2.2630 Constraint (T0311)E19.CB (T0311)T82.CB 8.8445 14.7409 19.1631 2.2630 Constraint (T0311)V59.CB (T0311)D84.CB 8.9335 14.8892 19.3560 2.2397 Constraint (T0311)K45.CB (T0311)Q65.CB 5.7182 9.5303 12.3894 2.2125 Constraint (T0311)D18.CB (T0311)L88.CB 7.7710 12.9517 16.8372 2.1920 Constraint (T0311)D18.CB (T0311)V85.CB 7.0186 11.6976 15.2069 2.1920 Constraint (T0311)L17.CB (T0311)R87.CB 6.7037 11.1728 14.5246 2.1920 Constraint (T0311)L17.CB (T0311)S86.CB 6.8175 11.3625 14.7713 2.1920 Constraint (T0311)L17.CB (T0311)V85.CB 6.7916 11.3194 14.7152 2.1920 Constraint (T0311)S16.CB (T0311)R87.CB 7.5323 12.5538 16.3200 2.1920 Constraint (T0311)S16.CB (T0311)S86.CB 7.6991 12.8318 16.6813 2.1920 Constraint (T0311)Q14.CB (T0311)V85.CB 7.1087 11.8479 15.4023 2.1920 Constraint (T0311)I13.CB (T0311)R87.CB 7.7291 12.8818 16.7463 2.1920 Constraint (T0311)I13.CB (T0311)S86.CB 7.1192 11.8653 15.4248 2.1920 Constraint (T0311)I13.CB (T0311)D84.CB 7.9123 13.1871 17.1432 2.1920 Constraint (T0311)I13.CB (T0311)V83.CB 5.3177 8.8629 11.5217 2.1920 Constraint (T0311)I13.CB (T0311)K81.CB 7.8189 13.0315 16.9409 2.1920 Constraint (T0311)I12.CB (T0311)T82.CB 8.1823 13.6372 17.7284 2.1920 Constraint (T0311)D11.CB (T0311)K81.CB 9.1496 15.2493 19.8240 2.1914 Constraint (T0311)M52.CB (T0311)R87.CB 7.8275 13.0459 16.9596 2.1459 Constraint (T0311)L48.CB (T0311)R87.CB 7.1248 11.8747 15.4371 2.1459 Constraint (T0311)A47.CB (T0311)R87.CB 7.4031 12.3384 16.0400 2.1459 Constraint (T0311)A47.CB (T0311)V85.CB 8.0769 13.4615 17.5000 2.1459 Constraint (T0311)M31.CB (T0311)N72.CB 7.7939 12.9898 16.8867 2.1431 Constraint (T0311)A30.CB (T0311)N72.CB 8.5336 14.2227 18.4895 2.1431 Constraint (T0311)F27.CB (T0311)N72.CB 8.7121 14.5202 18.8762 2.1431 Constraint (T0311)L20.CB (T0311)L76.CB 6.1225 10.2041 13.2653 2.1431 Constraint (T0311)S16.CB (T0311)S75.CB 8.3498 13.9163 18.0912 2.1431 Constraint (T0311)R40.CB (T0311)S63.CB 6.8715 11.4525 14.8882 2.0932 Constraint (T0311)A38.CB (T0311)S63.CB 6.3996 10.6659 13.8657 2.0932 Constraint (T0311)T37.CB (T0311)S63.CB 8.6915 14.4858 18.8316 2.0932 Constraint (T0311)S36.CB (T0311)P64.CB 9.0247 15.0411 19.5534 2.0932 Constraint (T0311)S36.CB (T0311)S63.CB 8.1210 13.5349 17.5954 2.0932 Constraint (T0311)P35.CB (T0311)Q65.CB 8.0945 13.4908 17.5380 2.0932 Constraint (T0311)P35.CB (T0311)P64.CB 7.0478 11.7463 15.2701 2.0932 Constraint (T0311)P35.CB (T0311)S63.CB 6.9754 11.6257 15.1134 2.0932 Constraint (T0311)R29.CB (T0311)P64.CB 9.4883 15.8138 20.5579 2.0932 Constraint (T0311)A28.CB (T0311)S63.CB 8.8740 14.7900 19.2269 2.0932 Constraint (T0311)E26.CB (T0311)Q65.CB 9.3160 15.5267 20.1847 2.0932 Constraint (T0311)E26.CB (T0311)P64.CB 7.2999 12.1665 15.8164 2.0932 Constraint (T0311)R25.CB (T0311)Q65.CB 9.4680 15.7800 20.5139 2.0932 Constraint (T0311)R25.CB (T0311)P64.CB 8.0795 13.4658 17.5056 2.0932 Constraint (T0311)R25.CB (T0311)S63.CB 9.3012 15.5019 20.1525 2.0932 Constraint (T0311)L24.CB (T0311)Q71.CB 8.5817 14.3028 18.5937 2.0932 Constraint (T0311)L24.CB (T0311)Q65.CB 6.2956 10.4926 13.6404 2.0932 Constraint (T0311)L24.CB (T0311)S63.CB 6.2809 10.4682 13.6087 2.0932 Constraint (T0311)S23.CB (T0311)Q71.CB 9.2792 15.4653 20.1049 2.0932 Constraint (T0311)S23.CB (T0311)Q65.CB 8.2064 13.6773 17.7804 2.0932 Constraint (T0311)S23.CB (T0311)S63.CB 8.9412 14.9020 19.3726 2.0932 Constraint (T0311)V22.CB (T0311)Q65.CB 6.6227 11.0378 14.3492 2.0932 Constraint (T0311)N21.CB (T0311)W74.CB 9.0284 15.0474 19.5616 2.0932 Constraint (T0311)N21.CB (T0311)A73.CB 9.4634 15.7724 20.5041 2.0932 Constraint (T0311)N21.CB (T0311)W67.CB 7.3952 12.3253 16.0229 2.0932 Constraint (T0311)N21.CB (T0311)M66.CB 8.2506 13.7510 17.8763 2.0932 Constraint (T0311)N21.CB (T0311)Q65.CB 5.3714 8.9524 11.6381 2.0932 Constraint (T0311)N21.CB (T0311)S63.CB 7.4758 12.4596 16.1975 2.0932 Constraint (T0311)N21.CB (T0311)S39.CB 9.3312 15.5520 20.2175 2.0932 Constraint (T0311)L20.CB (T0311)Q65.CB 7.8523 13.0872 17.0134 2.0932 Constraint (T0311)T43.CB (T0311)V58.CB 6.3002 10.5003 13.6503 2.0189 Constraint (T0311)K55.CB (T0311)S75.CB 6.6825 11.1374 14.4787 2.0163 Constraint (T0311)I54.CB (T0311)W74.CB 8.7549 14.5915 18.9689 2.0163 Constraint (T0311)A53.CB (T0311)W74.CB 7.5413 12.5688 16.3394 2.0163 Constraint (T0311)A46.CB (T0311)S75.CB 7.8475 13.0792 17.0030 2.0163 Constraint (T0311)A46.CB (T0311)W74.CB 9.5349 15.8915 20.6589 2.0163 Constraint (T0311)E51.CB (T0311)A73.CB 4.2503 7.0839 9.2090 2.0009 Constraint (T0311)A46.CB (T0311)A73.CB 7.7515 12.9191 16.7948 2.0009 Constraint (T0311)E19.CB (T0311)L48.CB 9.4506 15.7510 20.4763 2.0002 Constraint (T0311)W67.CB (T0311)L88.CB 6.3897 10.6494 13.8442 1.9981 Constraint (T0311)W67.CB (T0311)S86.CB 7.1293 11.8822 15.4469 1.9981 Constraint (T0311)W67.CB (T0311)V85.CB 6.8043 11.3405 14.7427 1.9981 Constraint (T0311)M66.CB (T0311)R87.CB 6.5706 10.9509 14.2362 1.9981 Constraint (T0311)M66.CB (T0311)S86.CB 8.7883 14.6472 19.0414 1.9981 Constraint (T0311)M66.CB (T0311)V85.CB 8.3844 13.9739 18.1661 1.9981 Constraint (T0311)Q65.CB (T0311)V92.CB 9.2122 15.3536 19.9597 1.9981 Constraint (T0311)Q65.CB (T0311)L91.CB 7.3672 12.2786 15.9622 1.9981 Constraint (T0311)Q65.CB (T0311)R90.CB 9.0739 15.1231 19.6601 1.9981 Constraint (T0311)Q65.CB (T0311)L88.CB 6.5254 10.8757 14.1384 1.9981 Constraint (T0311)P64.CB (T0311)V92.CB 8.4379 14.0631 18.2821 1.9981 Constraint (T0311)P64.CB (T0311)L91.CB 6.3856 10.6427 13.8355 1.9981 Constraint (T0311)P64.CB (T0311)R90.CB 7.7292 12.8821 16.7467 1.9981 Constraint (T0311)P64.CB (T0311)R89.CB 7.7893 12.9822 16.8768 1.9981 Constraint (T0311)P64.CB (T0311)L88.CB 5.2159 8.6931 11.3011 1.9981 Constraint (T0311)W74.CB (T0311)S86.CB 7.2563 12.0939 15.7221 1.9980 Constraint (T0311)N72.CB (T0311)S86.CB 8.6570 14.4283 18.7568 1.9980 Constraint (T0311)V83.CB (T0311)S95.CB 7.6527 12.7545 16.5809 1.9962 Constraint (T0311)K81.CB (T0311)T93.CB 7.9814 13.3023 17.2930 1.9962 Constraint (T0311)E80.CB (T0311)T93.CB 7.3247 12.2078 15.8701 1.9962 Constraint (T0311)W74.CB (T0311)T93.CB 8.2699 13.7831 17.9181 1.9962 Constraint (T0311)W74.CB (T0311)R87.CB 6.9172 11.5287 14.9873 1.9962 Constraint (T0311)K45.CB (T0311)V83.CB 9.5826 15.9709 20.7622 1.9962 Constraint (T0311)K45.CB (T0311)T82.CB 8.9837 14.9728 19.4646 1.9962 Constraint (T0311)K45.CB (T0311)E78.CB 5.8063 9.6772 12.5804 1.9962 Constraint (T0311)K45.CB (T0311)S75.CB 4.5003 7.5005 9.7507 1.9962 Constraint (T0311)T43.CB (T0311)S75.CB 5.5115 9.1859 11.9417 1.9962 Constraint (T0311)D18.CB (T0311)S75.CB 9.4639 15.7732 20.5052 1.9962 Constraint (T0311)L17.CB (T0311)S75.CB 9.4573 15.7621 20.4907 1.9962 Constraint (T0311)Q14.CB (T0311)S75.CB 6.5757 10.9595 14.2473 1.9962 Constraint (T0311)N69.CB (T0311)E80.CB 6.8261 11.3768 14.7898 1.9941 Constraint (T0311)R40.CB (T0311)L91.CB 8.8856 14.8093 19.2521 1.9904 Constraint (T0311)A47.CB (T0311)D84.CB 9.3849 15.6416 20.3340 1.9878 Constraint (T0311)A46.CB (T0311)Q94.CB 9.4372 15.7287 20.4473 1.9846 Constraint (T0311)K45.CB (T0311)Q94.CB 8.2296 13.7160 17.8308 1.9846 Constraint (T0311)K45.CB (T0311)R89.CB 8.0320 13.3867 17.4027 1.9846 Constraint (T0311)T43.CB (T0311)Q94.CB 7.1533 11.9221 15.4987 1.9846 Constraint (T0311)L42.CB (T0311)T93.CB 7.8824 13.1374 17.0786 1.9846 Constraint (T0311)L42.CB (T0311)R90.CB 8.9351 14.8918 19.3593 1.9846 Constraint (T0311)L41.CB (T0311)R89.CB 8.7178 14.5297 18.8886 1.9846 Constraint (T0311)R40.CB (T0311)R89.CB 8.6643 14.4406 18.7728 1.9846 Constraint (T0311)S39.CB (T0311)Q94.CB 7.8849 13.1415 17.0839 1.9846 Constraint (T0311)S39.CB (T0311)T93.CB 6.8167 11.3611 14.7695 1.9846 Constraint (T0311)S36.CB (T0311)Q94.CB 9.0772 15.1287 19.6672 1.9846 Constraint (T0311)S36.CB (T0311)T93.CB 9.1140 15.1899 19.7469 1.9846 Constraint (T0311)S36.CB (T0311)R89.CB 8.7194 14.5324 18.8921 1.9846 Constraint (T0311)P35.CB (T0311)T93.CB 9.3372 15.5619 20.2305 1.9846 Constraint (T0311)P35.CB (T0311)R89.CB 8.1225 13.5375 17.5987 1.9846 Constraint (T0311)R25.CB (T0311)V92.CB 8.2567 13.7612 17.8896 1.9846 Constraint (T0311)L24.CB (T0311)T93.CB 8.0505 13.4174 17.4427 1.9846 Constraint (T0311)P50.CB (T0311)W74.CB 4.9444 8.2407 10.7129 1.9846 Constraint (T0311)V59.CB (T0311)A77.CB 5.6126 9.3544 12.1607 1.9831 Constraint (T0311)S75.CB (T0311)V85.CB 8.1491 13.5819 17.6564 1.9827 Constraint (T0311)A73.CB (T0311)R87.CB 7.8066 13.0109 16.9142 1.9827 Constraint (T0311)L41.CB (T0311)R87.CB 7.6964 12.8274 16.6756 1.9827 Constraint (T0311)R40.CB (T0311)W74.CB 8.0584 13.4307 17.4599 1.9827 Constraint (T0311)T43.CB (T0311)D84.CB 6.2096 10.3492 13.4540 1.9801 Constraint (T0311)S39.CB (T0311)D84.CB 6.7419 11.2365 14.6075 1.9801 Constraint (T0311)P35.CB (T0311)D84.CB 8.5328 14.2213 18.4877 1.9801 Constraint (T0311)A38.CB (T0311)R87.CB 6.8001 11.3335 14.7335 1.9769 Constraint (T0311)S36.CB (T0311)R87.CB 8.6111 14.3518 18.6573 1.9769 Constraint (T0311)P35.CB (T0311)R87.CB 7.1820 11.9699 15.5609 1.9769 Constraint (T0311)L70.CB (T0311)L88.CB 6.9416 11.5693 15.0401 1.9759 Constraint (T0311)L70.CB (T0311)R87.CB 5.1377 8.5629 11.1317 1.9759 Constraint (T0311)L70.CB (T0311)V85.CB 7.4503 12.4172 16.1424 1.9759 Constraint (T0311)N69.CB (T0311)R87.CB 6.9416 11.5693 15.0400 1.9759 Constraint (T0311)L68.CB (T0311)K81.CB 7.2073 12.0121 15.6157 1.9759 Constraint (T0311)P35.CB (T0311)S86.CB 8.9498 14.9163 19.3912 1.9724 Constraint (T0311)A46.CB (T0311)A77.CB 9.5298 15.8831 20.6480 1.9692 Constraint (T0311)T37.CB (T0311)A77.CB 7.1750 11.9584 15.5459 1.9692 Constraint (T0311)S36.CB (T0311)S75.CB 8.7929 14.6548 19.0513 1.9692 Constraint (T0311)P35.CB (T0311)A77.CB 9.0664 15.1107 19.6439 1.9692 Constraint (T0311)P35.CB (T0311)S75.CB 8.2360 13.7267 17.8447 1.9692 Constraint (T0311)A34.CB (T0311)A77.CB 9.3209 15.5349 20.1953 1.9692 Constraint (T0311)A34.CB (T0311)L76.CB 6.1564 10.2607 13.3390 1.9692 Constraint (T0311)A34.CB (T0311)S75.CB 7.3103 12.1839 15.8391 1.9692 Constraint (T0311)I33.CB (T0311)A77.CB 6.7483 11.2472 14.6213 1.9692 Constraint (T0311)I33.CB (T0311)S75.CB 4.2500 7.0833 9.2083 1.9692 Constraint (T0311)E32.CB (T0311)A77.CB 7.8688 13.1147 17.0491 1.9692 Constraint (T0311)E32.CB (T0311)L76.CB 5.5616 9.2694 12.0502 1.9692 Constraint (T0311)E32.CB (T0311)S75.CB 3.9932 6.6553 8.6519 1.9692 Constraint (T0311)A30.CB (T0311)S75.CB 5.0798 8.4663 11.0062 1.9692 Constraint (T0311)R29.CB (T0311)A77.CB 9.0715 15.1192 19.6549 1.9692 Constraint (T0311)R29.CB (T0311)S75.CB 6.9414 11.5690 15.0397 1.9692 Constraint (T0311)A28.CB (T0311)A77.CB 7.7494 12.9156 16.7903 1.9692 Constraint (T0311)A28.CB (T0311)S75.CB 6.2885 10.4809 13.6251 1.9692 Constraint (T0311)E26.CB (T0311)S75.CB 8.2565 13.7608 17.8890 1.9692 Constraint (T0311)R25.CB (T0311)S75.CB 9.2652 15.4420 20.0746 1.9692 Constraint (T0311)L24.CB (T0311)S75.CB 8.5573 14.2622 18.5409 1.9692 Constraint (T0311)S23.CB (T0311)W67.CB 9.4821 15.8036 20.5446 1.8981 Constraint (T0311)S23.CB (T0311)S62.CB 9.3081 15.5135 20.1675 1.8981 Constraint (T0311)L20.CB (T0311)T82.CB 8.2191 13.6985 17.8081 1.8812 Constraint (T0311)L20.CB (T0311)K81.CB 7.9083 13.1805 17.1346 1.8812 Constraint (T0311)L20.CB (T0311)E80.CB 5.1243 8.5404 11.1025 1.8812 Constraint (T0311)E19.CB (T0311)K81.CB 7.4757 12.4594 16.1972 1.8582 Constraint (T0311)K45.CB (T0311)W74.CB 5.5790 9.2983 12.0878 1.8077 Constraint (T0311)E15.CB (T0311)W74.CB 7.2063 12.0104 15.6136 1.8077 Constraint (T0311)I12.CB (T0311)W74.CB 6.3204 10.5340 13.6942 1.8077 Constraint (T0311)P35.CB (T0311)T82.CB 8.7550 14.5917 18.9693 1.7974 Constraint (T0311)R25.CB (T0311)K81.CB 9.4698 15.7831 20.5180 1.7974 Constraint (T0311)S23.CB (T0311)E78.CB 8.7276 14.5459 18.9097 1.7974 Constraint (T0311)L42.CB (T0311)A73.CB 6.8967 11.4945 14.9429 1.7942 Constraint (T0311)L41.CB (T0311)A73.CB 5.1897 8.6495 11.2443 1.7942 Constraint (T0311)A38.CB (T0311)A73.CB 6.7333 11.2222 14.5888 1.7942 Constraint (T0311)I33.CB (T0311)A73.CB 6.7630 11.2716 14.6531 1.7942 Constraint (T0311)E32.CB (T0311)A73.CB 7.6687 12.7811 16.6154 1.7942 Constraint (T0311)M31.CB (T0311)W74.CB 6.5794 10.9657 14.2555 1.7942 Constraint (T0311)M31.CB (T0311)A73.CB 5.6260 9.3766 12.1896 1.7942 Constraint (T0311)A30.CB (T0311)S86.CB 8.5756 14.2926 18.5804 1.7942 Constraint (T0311)A30.CB (T0311)W74.CB 8.1448 13.5747 17.6471 1.7942 Constraint (T0311)A30.CB (T0311)A73.CB 7.2809 12.1348 15.7752 1.7942 Constraint (T0311)A28.CB (T0311)W74.CB 8.8514 14.7524 19.1781 1.7942 Constraint (T0311)A28.CB (T0311)A73.CB 7.4897 12.4829 16.2277 1.7942 Constraint (T0311)F27.CB (T0311)W74.CB 7.2668 12.1114 15.7448 1.7942 Constraint (T0311)F27.CB (T0311)A73.CB 6.2981 10.4968 13.6458 1.7942 Constraint (T0311)E26.CB (T0311)S86.CB 7.1964 11.9940 15.5922 1.7942 Constraint (T0311)L24.CB (T0311)A73.CB 8.5811 14.3018 18.5923 1.7942 Constraint (T0311)S62.CB (T0311)S86.CB 7.8746 13.1243 17.0615 1.7872 Constraint (T0311)I60.CB (T0311)R89.CB 9.2006 15.3343 19.9346 1.7872 Constraint (T0311)I60.CB (T0311)S86.CB 6.6263 11.0439 14.3571 1.7872 Constraint (T0311)I60.CB (T0311)V85.CB 7.4522 12.4204 16.1465 1.7872 Constraint (T0311)L56.CB (T0311)V85.CB 9.3966 15.6610 20.3593 1.7872 Constraint (T0311)R25.CB (T0311)I54.CB 9.2349 15.3915 20.0089 1.7872 Constraint (T0311)S23.CB (T0311)I54.CB 8.7290 14.5483 18.9128 1.7872 Constraint (T0311)N21.CB (T0311)R87.CB 8.7541 14.5901 18.9672 1.7872 Constraint (T0311)D18.CB (T0311)R87.CB 5.3338 8.8896 11.5565 1.7872 Constraint (T0311)D18.CB (T0311)S86.CB 6.4492 10.7487 13.9733 1.7872 Constraint (T0311)D18.CB (T0311)D84.CB 4.3477 7.2462 9.4200 1.7872 Constraint (T0311)D18.CB (T0311)V83.CB 3.4627 5.7712 7.5026 1.7872 Constraint (T0311)D18.CB (T0311)T82.CB 6.3913 10.6522 13.8478 1.7872 Constraint (T0311)D18.CB (T0311)K81.CB 5.9896 9.9827 12.9776 1.7872 Constraint (T0311)L17.CB (T0311)D84.CB 5.0149 8.3581 10.8656 1.7872 Constraint (T0311)L17.CB (T0311)V83.CB 3.2546 5.4244 7.0517 1.7872 Constraint (T0311)E15.CB (T0311)S86.CB 6.4762 10.7936 14.0317 1.7872 Constraint (T0311)E15.CB (T0311)D84.CB 6.4665 10.7774 14.0106 1.7872 Constraint (T0311)E15.CB (T0311)V83.CB 4.2675 7.1126 9.2463 1.7872 Constraint (T0311)E15.CB (T0311)T82.CB 7.2800 12.1334 15.7734 1.7872 Constraint (T0311)Q14.CB (T0311)R89.CB 8.2520 13.7533 17.8793 1.7872 Constraint (T0311)Q14.CB (T0311)S86.CB 4.8765 8.1274 10.5657 1.7872 Constraint (T0311)Q14.CB (T0311)D84.CB 5.7621 9.6035 12.4846 1.7872 Constraint (T0311)I12.CB (T0311)S86.CB 7.7670 12.9450 16.8285 1.7872 Constraint (T0311)L24.CB (T0311)P50.CB 9.3917 15.6528 20.3486 1.7189 Constraint (T0311)K55.CB (T0311)A77.CB 5.2375 8.7291 11.3478 1.6831 Constraint (T0311)V58.CB (T0311)D84.CB 8.3797 13.9662 18.1561 1.6667 Constraint (T0311)A79.CB (T0311)S95.CB 7.6713 12.7854 16.6211 1.6648 Constraint (T0311)A79.CB (T0311)Q94.CB 6.8672 11.4453 14.8789 1.6648 Constraint (T0311)A79.CB (T0311)T93.CB 4.6320 7.7200 10.0359 1.6648 Constraint (T0311)E78.CB (T0311)T93.CB 6.7872 11.3120 14.7056 1.6648 Constraint (T0311)L76.CB (T0311)Q94.CB 8.5807 14.3012 18.5916 1.6648 Constraint (T0311)L76.CB (T0311)T93.CB 6.7360 11.2266 14.5946 1.6648 Constraint (T0311)S75.CB (T0311)S95.CB 7.9365 13.2276 17.1958 1.6648 Constraint (T0311)S75.CB (T0311)Q94.CB 7.9681 13.2801 17.2641 1.6648 Constraint (T0311)S75.CB (T0311)T93.CB 5.7268 9.5447 12.4081 1.6648 Constraint (T0311)L68.CB (T0311)A77.CB 8.9464 14.9106 19.3838 1.6335 Constraint (T0311)V58.CB (T0311)W74.CB 6.7329 11.2215 14.5879 1.6335 Constraint (T0311)E19.CB (T0311)L88.CB 8.8372 14.7287 19.1473 1.5963 Constraint (T0311)E19.CB (T0311)S86.CB 8.4078 14.0130 18.2169 1.5963 Constraint (T0311)E19.CB (T0311)V85.CB 8.1225 13.5374 17.5987 1.5963 Constraint (T0311)D18.CB (T0311)R89.CB 8.2309 13.7182 17.8337 1.5963 Constraint (T0311)E15.CB (T0311)V85.CB 7.5511 12.5851 16.3607 1.5963 Constraint (T0311)Q14.CB (T0311)R90.CB 8.6886 14.4810 18.8253 1.5938 Constraint (T0311)L56.CB (T0311)R87.CB 7.9526 13.2543 17.2306 1.5730 Constraint (T0311)M52.CB (T0311)R90.CB 9.0806 15.1344 19.6747 1.5730 Constraint (T0311)E51.CB (T0311)L88.CB 8.6387 14.3978 18.7171 1.5730 Constraint (T0311)T49.CB (T0311)L88.CB 7.9779 13.2966 17.2855 1.5730 Constraint (T0311)L48.CB (T0311)R90.CB 9.0579 15.0966 19.6255 1.5730 Constraint (T0311)L48.CB (T0311)L88.CB 8.4127 14.0212 18.2276 1.5730 Constraint (T0311)L70.CB (T0311)R90.CB 6.5614 10.9357 14.2164 1.5710 Constraint (T0311)L70.CB (T0311)R89.CB 7.9867 13.3112 17.3046 1.5710 Constraint (T0311)L68.CB (T0311)R87.CB 6.6727 11.1211 14.4575 1.5710 Constraint (T0311)L68.CB (T0311)V85.CB 8.3247 13.8746 18.0369 1.5710 Constraint (T0311)K45.CB (T0311)L91.CB 8.7450 14.5750 18.9474 1.5653 Constraint (T0311)L20.CB (T0311)E78.CB 7.4715 12.4524 16.1882 1.4763 Constraint (T0311)L20.CB (T0311)A77.CB 5.8181 9.6968 12.6058 1.4763 Constraint (T0311)Q71.CB (T0311)L88.CB 6.7668 11.2780 14.6613 1.4029 Constraint (T0311)Q71.CB (T0311)V85.CB 7.0398 11.7330 15.2529 1.4029 Constraint (T0311)N69.CB (T0311)L91.CB 7.1219 11.8698 15.4307 1.4029 Constraint (T0311)N69.CB (T0311)L88.CB 7.5693 12.6154 16.4000 1.4029 Constraint (T0311)I33.CB (T0311)L91.CB 8.3159 13.8598 18.0178 1.4029 Constraint (T0311)M31.CB (T0311)L91.CB 8.6343 14.3905 18.7076 1.4029 Constraint (T0311)I12.CB (T0311)L88.CB 8.8541 14.7569 19.1840 1.4029 Constraint (T0311)A38.CB (T0311)L91.CB 8.6031 14.3385 18.6400 1.3971 Constraint (T0311)P35.CB (T0311)L91.CB 7.7043 12.8405 16.6927 1.3971 Constraint (T0311)R25.CB (T0311)L91.CB 7.7028 12.8379 16.6893 1.3971 Constraint (T0311)S23.CB (T0311)R90.CB 8.8279 14.7131 19.1270 1.3971 Constraint (T0311)M31.CB (T0311)R87.CB 8.6379 14.3965 18.7154 1.3894 Constraint (T0311)M31.CB (T0311)V85.CB 7.1108 11.8513 15.4066 1.3894 Constraint (T0311)A30.CB (T0311)R87.CB 7.7622 12.9370 16.8181 1.3894 Constraint (T0311)A30.CB (T0311)V85.CB 5.9672 9.9454 12.9290 1.3894 Constraint (T0311)R29.CB (T0311)V85.CB 7.7454 12.9090 16.7817 1.3894 Constraint (T0311)F27.CB (T0311)S86.CB 6.8035 11.3392 14.7409 1.3894 Constraint (T0311)R25.CB (T0311)S86.CB 8.5061 14.1768 18.4298 1.3894 Constraint (T0311)N72.CB (T0311)V92.CB 8.9548 14.9246 19.4020 1.3335 Constraint (T0311)I54.CB (T0311)N72.CB 9.0870 15.1449 19.6884 1.3335 Constraint (T0311)A30.CB (T0311)Q71.CB 8.0639 13.4398 17.4718 1.3335 Constraint (T0311)R29.CB (T0311)L68.CB 8.7102 14.5169 18.8720 1.3335 Constraint (T0311)E26.CB (T0311)L68.CB 7.6131 12.6885 16.4951 1.3335 Constraint (T0311)L24.CB (T0311)L68.CB 9.3430 15.5716 20.2431 1.3335 Constraint (T0311)S23.CB (T0311)L68.CB 9.3150 15.5250 20.1825 1.3335 Constraint (T0311)V22.CB (T0311)L68.CB 6.0250 10.0416 13.0541 1.3335 Constraint (T0311)N21.CB (T0311)N69.CB 8.5999 14.3332 18.6331 1.3335 Constraint (T0311)N21.CB (T0311)L68.CB 7.4487 12.4146 16.1389 1.3335 Constraint (T0311)L20.CB (T0311)L68.CB 4.1327 6.8878 8.9541 1.3335 Constraint (T0311)E19.CB (T0311)L68.CB 5.4265 9.0441 11.7574 1.3335 Constraint (T0311)D18.CB (T0311)N72.CB 7.8208 13.0347 16.9452 1.3335 Constraint (T0311)D18.CB (T0311)N69.CB 7.8001 13.0001 16.9001 1.3335 Constraint (T0311)D18.CB (T0311)L68.CB 7.8463 13.0772 17.0004 1.3335 Constraint (T0311)P35.CB (T0311)E51.CB 9.0520 15.0866 19.6126 1.3163 Constraint (T0311)D18.CB (T0311)M52.CB 9.0852 15.1419 19.6845 1.2981 Constraint (T0311)L17.CB (T0311)E51.CB 8.3868 13.9780 18.1714 1.2981 Constraint (T0311)E15.CB (T0311)E51.CB 8.3634 13.9391 18.1208 1.2981 Constraint (T0311)Q14.CB (T0311)E51.CB 6.4288 10.7147 13.9292 1.2981 Constraint (T0311)D11.CB (T0311)K55.CB 8.0295 13.3825 17.3972 1.2914 Constraint (T0311)T37.CB (T0311)N69.CB 8.1227 13.5379 17.5993 1.2144 Constraint (T0311)T37.CB (T0311)M66.CB 5.2763 8.7938 11.4320 1.2144 Constraint (T0311)T37.CB (T0311)Q65.CB 7.2294 12.0489 15.6636 1.2144 Constraint (T0311)S36.CB (T0311)M66.CB 8.1729 13.6215 17.7079 1.2144 Constraint (T0311)P35.CB (T0311)M66.CB 7.9600 13.2667 17.2467 1.2144 Constraint (T0311)A34.CB (T0311)N69.CB 9.2641 15.4401 20.0721 1.2144 Constraint (T0311)A34.CB (T0311)M66.CB 7.0307 11.7178 15.2332 1.2144 Constraint (T0311)A34.CB (T0311)Q65.CB 8.8074 14.6791 19.0828 1.2144 Constraint (T0311)I33.CB (T0311)N69.CB 6.0119 10.0198 13.0258 1.2144 Constraint (T0311)I33.CB (T0311)L68.CB 8.1297 13.5495 17.6144 1.2144 Constraint (T0311)I33.CB (T0311)M66.CB 3.8776 6.4627 8.4015 1.2144 Constraint (T0311)I33.CB (T0311)Q65.CB 6.0457 10.0761 13.0989 1.2144 Constraint (T0311)E32.CB (T0311)N69.CB 5.3907 8.9845 11.6798 1.2144 Constraint (T0311)E32.CB (T0311)L68.CB 7.7543 12.9239 16.8010 1.2144 Constraint (T0311)E32.CB (T0311)W67.CB 7.9392 13.2320 17.2015 1.2144 Constraint (T0311)E32.CB (T0311)M66.CB 4.8094 8.0157 10.4204 1.2144 Constraint (T0311)E32.CB (T0311)Q65.CB 5.3397 8.8995 11.5693 1.2144 Constraint (T0311)M31.CB (T0311)Q65.CB 4.9438 8.2397 10.7116 1.2144 Constraint (T0311)A30.CB (T0311)Q65.CB 8.8595 14.7659 19.1956 1.2144 Constraint (T0311)R29.CB (T0311)L70.CB 8.2188 13.6980 17.8074 1.2144 Constraint (T0311)R29.CB (T0311)N69.CB 7.2601 12.1001 15.7302 1.2144 Constraint (T0311)R29.CB (T0311)M66.CB 7.0179 11.6965 15.2054 1.2144 Constraint (T0311)R29.CB (T0311)Q65.CB 8.8378 14.7296 19.1485 1.2144 Constraint (T0311)A28.CB (T0311)Q71.CB 9.1841 15.3069 19.8989 1.2144 Constraint (T0311)A28.CB (T0311)N69.CB 6.2102 10.3504 13.4555 1.2144 Constraint (T0311)A28.CB (T0311)M66.CB 4.9386 8.2310 10.7004 1.2144 Constraint (T0311)A28.CB (T0311)Q65.CB 7.5802 12.6336 16.4237 1.2144 Constraint (T0311)E26.CB (T0311)L70.CB 8.2418 13.7363 17.8572 1.2144 Constraint (T0311)E26.CB (T0311)N69.CB 8.3786 13.9644 18.1537 1.2144 Constraint (T0311)E26.CB (T0311)M66.CB 8.5581 14.2634 18.5424 1.2144 Constraint (T0311)R25.CB (T0311)L70.CB 8.7808 14.6347 19.0251 1.2144 Constraint (T0311)R25.CB (T0311)N69.CB 9.2047 15.3412 19.9435 1.2144 Constraint (T0311)R25.CB (T0311)M66.CB 8.1927 13.6545 17.7508 1.2144 Constraint (T0311)L24.CB (T0311)N69.CB 8.5925 14.3208 18.6171 1.2144 Constraint (T0311)S23.CB (T0311)L70.CB 9.5129 15.8549 20.6113 1.2144 Constraint (T0311)N21.CB (T0311)V85.CB 8.0900 13.4834 17.5284 1.2144 Constraint (T0311)L20.CB (T0311)V85.CB 7.1964 11.9940 15.5922 1.2144 Constraint (T0311)E19.CB (T0311)R87.CB 6.9251 11.5419 15.0044 1.1914 Constraint (T0311)E15.CB (T0311)R89.CB 8.7227 14.5379 18.8993 1.1914 Constraint (T0311)D11.CB (T0311)R89.CB 8.6594 14.4323 18.7619 1.1914 Constraint (T0311)D11.CB (T0311)L88.CB 9.1769 15.2948 19.8833 1.1914 Constraint (T0311)D11.CB (T0311)R87.CB 6.5045 10.8409 14.0931 1.1914 Constraint (T0311)D11.CB (T0311)S86.CB 5.4884 9.1473 11.8915 1.1914 Constraint (T0311)D11.CB (T0311)V85.CB 8.4672 14.1120 18.3456 1.1914 Constraint (T0311)D11.CB (T0311)D84.CB 8.1069 13.5115 17.5649 1.1914 Constraint (T0311)D11.CB (T0311)V83.CB 5.2670 8.7783 11.4118 1.1914 Constraint (T0311)D11.CB (T0311)T82.CB 6.9732 11.6219 15.1085 1.1914 Constraint (T0311)D11.CB (T0311)E80.CB 8.1082 13.5137 17.5678 1.1914 Constraint (T0311)D11.CB (T0311)A79.CB 6.9217 11.5362 14.9971 1.1914 Constraint (T0311)A46.CB (T0311)S86.CB 7.4767 12.4611 16.1994 1.1459 Constraint (T0311)A46.CB (T0311)V85.CB 9.5705 15.9509 20.7362 1.1459 Constraint (T0311)K45.CB (T0311)S86.CB 9.1352 15.2254 19.7930 1.1459 Constraint (T0311)E26.CB (T0311)S95.CB 8.4394 14.0656 18.2853 1.0715 Constraint (T0311)V22.CB (T0311)S95.CB 8.8726 14.7876 19.2239 1.0715 Constraint (T0311)N21.CB (T0311)S95.CB 7.6392 12.7320 16.5516 1.0715 Constraint (T0311)N21.CB (T0311)Q94.CB 7.7286 12.8809 16.7452 1.0715 Constraint (T0311)L20.CB (T0311)S95.CB 8.9004 14.8340 19.2842 1.0715 Constraint (T0311)L20.CB (T0311)Q94.CB 9.0343 15.0571 19.5742 1.0715 Constraint (T0311)L20.CB (T0311)D84.CB 7.8256 13.0427 16.9555 1.0715 Constraint (T0311)L20.CB (T0311)V83.CB 7.5718 12.6196 16.4055 1.0715 Constraint (T0311)A47.CB (T0311)N72.CB 8.4388 14.0647 18.2841 1.0163 Constraint (T0311)A47.CB (T0311)V59.CB 7.7471 12.9119 16.7854 1.0163 Constraint (T0311)A47.CB (T0311)V58.CB 8.4009 14.0014 18.2018 1.0163 Constraint (T0311)A46.CB (T0311)N72.CB 7.2575 12.0958 15.7246 1.0163 Constraint (T0311)T43.CB (T0311)L68.CB 9.5717 15.9529 20.7388 1.0163 Constraint (T0311)P9.CB (T0311)S36.CB 8.4415 14.0691 18.2899 1.0163 Constraint (T0311)P9.CB (T0311)A34.CB 8.9574 14.9290 19.4077 1.0163 Constraint (T0311)R8.CB (T0311)E51.CB 9.3203 15.5338 20.1940 1.0163 Constraint (T0311)R8.CB (T0311)P50.CB 6.2114 10.3523 13.4580 1.0163 Constraint (T0311)R8.CB (T0311)T49.CB 8.3229 13.8715 18.0330 1.0163 Constraint (T0311)R8.CB (T0311)T37.CB 8.4795 14.1325 18.3722 1.0163 Constraint (T0311)R8.CB (T0311)I33.CB 8.9454 14.9090 19.3818 1.0163 Constraint (T0311)R8.CB (T0311)M31.CB 8.6998 14.4997 18.8496 1.0163 Constraint (T0311)P7.CB (T0311)P50.CB 7.5639 12.6065 16.3884 1.0163 Constraint (T0311)P7.CB (T0311)R40.CB 8.2882 13.8137 17.9579 1.0163 Constraint (T0311)P7.CB (T0311)A38.CB 8.4923 14.1539 18.4001 1.0163 Constraint (T0311)P7.CB (T0311)T37.CB 7.3335 12.2226 15.8893 1.0163 Constraint (T0311)P7.CB (T0311)I33.CB 6.8905 11.4842 14.9295 1.0163 Constraint (T0311)P7.CB (T0311)E32.CB 7.5694 12.6157 16.4004 1.0163 Constraint (T0311)P7.CB (T0311)M31.CB 6.0230 10.0384 13.0499 1.0163 Constraint (T0311)P7.CB (T0311)A30.CB 8.6900 14.4834 18.8284 1.0163 Constraint (T0311)P7.CB (T0311)A28.CB 9.1337 15.2229 19.7897 1.0163 Constraint (T0311)P7.CB (T0311)F27.CB 8.4215 14.0358 18.2466 1.0163 Constraint (T0311)H6.CB (T0311)L41.CB 9.2149 15.3582 19.9656 1.0163 Constraint (T0311)H6.CB (T0311)I33.CB 8.8694 14.7823 19.2170 1.0163 Constraint (T0311)H6.CB (T0311)E32.CB 8.4933 14.1556 18.4022 1.0163 Constraint (T0311)H6.CB (T0311)M31.CB 7.8484 13.0807 17.0049 1.0163 Constraint (T0311)L17.CB (T0311)R89.CB 7.5626 12.6043 16.3855 1.0005 Constraint (T0311)L17.CB (T0311)L88.CB 6.2481 10.4136 13.5376 1.0005 Constraint (T0311)S16.CB (T0311)V85.CB 6.2701 10.4502 13.5853 1.0005 Constraint (T0311)I13.CB (T0311)R89.CB 8.3827 13.9712 18.1625 1.0005 Constraint (T0311)I13.CB (T0311)L88.CB 7.4646 12.4410 16.1733 1.0005 Constraint (T0311)I13.CB (T0311)V85.CB 6.4628 10.7714 14.0028 1.0005 Constraint (T0311)Q65.CB (T0311)R89.CB 8.0006 13.3343 17.3346 1.0000 Constraint (T0311)S63.CB (T0311)L91.CB 8.6240 14.3733 18.6853 1.0000 Constraint (T0311)S63.CB (T0311)L88.CB 6.9542 11.5904 15.0675 1.0000 Constraint (T0311)S63.CB (T0311)S86.CB 8.5233 14.2055 18.4672 1.0000 Constraint (T0311)S63.CB (T0311)V85.CB 7.4686 12.4477 16.1820 1.0000 Constraint (T0311)S62.CB (T0311)L88.CB 9.5464 15.9106 20.6838 1.0000 Constraint (T0311)S62.CB (T0311)R87.CB 8.1881 13.6469 17.7410 1.0000 Constraint (T0311)V58.CB (T0311)L91.CB 9.4684 15.7806 20.5148 1.0000 Constraint (T0311)S57.CB (T0311)L91.CB 8.7770 14.6283 19.0167 1.0000 Constraint (T0311)S57.CB (T0311)R90.CB 9.2107 15.3511 19.9564 1.0000 Constraint (T0311)S57.CB (T0311)L88.CB 7.8911 13.1518 17.0974 1.0000 Constraint (T0311)K55.CB (T0311)R90.CB 9.4136 15.6893 20.3961 1.0000 Constraint (T0311)K55.CB (T0311)R87.CB 7.2652 12.1086 15.7412 1.0000 Constraint (T0311)K55.CB (T0311)D84.CB 8.2856 13.8093 17.9521 1.0000 Constraint (T0311)I54.CB (T0311)V92.CB 9.4962 15.8270 20.5750 1.0000 Constraint (T0311)I54.CB (T0311)L91.CB 6.7536 11.2559 14.6327 1.0000 Constraint (T0311)I54.CB (T0311)R90.CB 6.5152 10.8587 14.1163 1.0000 Constraint (T0311)I54.CB (T0311)R89.CB 8.2007 13.6678 17.7682 1.0000 Constraint (T0311)I54.CB (T0311)L88.CB 6.8625 11.4376 14.8688 1.0000 Constraint (T0311)A53.CB (T0311)L91.CB 8.5091 14.1818 18.4363 1.0000 Constraint (T0311)A53.CB (T0311)R90.CB 7.5349 12.5582 16.3257 1.0000 Constraint (T0311)A53.CB (T0311)R89.CB 8.3085 13.8474 18.0017 1.0000 Constraint (T0311)A53.CB (T0311)L88.CB 7.4189 12.3648 16.0742 1.0000 Constraint (T0311)M52.CB (T0311)D84.CB 7.9791 13.2985 17.2880 1.0000 Constraint (T0311)E51.CB (T0311)L91.CB 8.1662 13.6103 17.6934 1.0000 Constraint (T0311)E51.CB (T0311)R90.CB 6.5540 10.9234 14.2004 1.0000 Constraint (T0311)E51.CB (T0311)R89.CB 8.8150 14.6916 19.0991 1.0000 Constraint (T0311)P50.CB (T0311)V92.CB 8.0299 13.3832 17.3982 1.0000 Constraint (T0311)P50.CB (T0311)L91.CB 6.3844 10.6406 13.8328 1.0000 Constraint (T0311)P50.CB (T0311)R90.CB 4.4345 7.3909 9.6081 1.0000 Constraint (T0311)P50.CB (T0311)R89.CB 5.8941 9.8234 12.7705 1.0000 Constraint (T0311)T49.CB (T0311)L91.CB 9.4892 15.8153 20.5599 1.0000 Constraint (T0311)T49.CB (T0311)R90.CB 7.2067 12.0111 15.6145 1.0000 Constraint (T0311)T49.CB (T0311)R89.CB 8.4975 14.1626 18.4114 1.0000 Constraint (T0311)A46.CB (T0311)V83.CB 8.2471 13.7452 17.8688 1.0000 Constraint (T0311)S86.CB (T0311)P97.CB 7.7919 12.9864 16.8824 0.9981 Constraint (T0311)V85.CB (T0311)T96.CB 4.2996 7.1659 9.3157 0.9981 Constraint (T0311)V85.CB (T0311)S95.CB 7.2851 12.1418 15.7844 0.9981 Constraint (T0311)V83.CB (T0311)P97.CB 5.7616 9.6027 12.4835 0.9981 Constraint (T0311)V83.CB (T0311)T96.CB 4.4874 7.4790 9.7227 0.9981 Constraint (T0311)T82.CB (T0311)P97.CB 8.5573 14.2622 18.5409 0.9981 Constraint (T0311)T82.CB (T0311)T96.CB 7.2331 12.0552 15.6717 0.9981 Constraint (T0311)T82.CB (T0311)S95.CB 6.3376 10.5627 13.7315 0.9981 Constraint (T0311)T82.CB (T0311)Q94.CB 6.9638 11.6063 15.0882 0.9981 Constraint (T0311)K81.CB (T0311)P97.CB 7.6964 12.8274 16.6756 0.9981 Constraint (T0311)K81.CB (T0311)T96.CB 7.6088 12.6813 16.4857 0.9981 Constraint (T0311)K81.CB (T0311)S95.CB 9.3450 15.5750 20.2475 0.9981 Constraint (T0311)E80.CB (T0311)P97.CB 6.0446 10.0744 13.0967 0.9981 Constraint (T0311)E80.CB (T0311)T96.CB 6.6447 11.0744 14.3968 0.9981 Constraint (T0311)E80.CB (T0311)S95.CB 9.5772 15.9620 20.7506 0.9981 Constraint (T0311)E80.CB (T0311)Q94.CB 8.8528 14.7546 19.1810 0.9981 Constraint (T0311)A79.CB (T0311)P97.CB 8.5509 14.2516 18.5270 0.9981 Constraint (T0311)A79.CB (T0311)T96.CB 8.1890 13.6484 17.7429 0.9981 Constraint (T0311)E78.CB (T0311)S95.CB 7.7374 12.8956 16.7643 0.9981 Constraint (T0311)E78.CB (T0311)Q94.CB 8.4569 14.0948 18.3232 0.9981 Constraint (T0311)E78.CB (T0311)L91.CB 8.8054 14.6757 19.0784 0.9981 Constraint (T0311)A77.CB (T0311)P97.CB 9.3442 15.5736 20.2457 0.9981 Constraint (T0311)A77.CB (T0311)T93.CB 6.7646 11.2744 14.6567 0.9981 Constraint (T0311)A77.CB (T0311)L91.CB 8.8182 14.6970 19.1061 0.9981 Constraint (T0311)A77.CB (T0311)L88.CB 9.0386 15.0643 19.5836 0.9981 Constraint (T0311)L76.CB (T0311)S95.CB 9.1854 15.3090 19.9017 0.9981 Constraint (T0311)L76.CB (T0311)L91.CB 6.3326 10.5543 13.7207 0.9981 Constraint (T0311)L76.CB (T0311)R89.CB 8.9392 14.8986 19.3682 0.9981 Constraint (T0311)L76.CB (T0311)L88.CB 8.5231 14.2051 18.4667 0.9981 Constraint (T0311)S75.CB (T0311)L91.CB 7.8754 13.1256 17.0633 0.9981 Constraint (T0311)S75.CB (T0311)L88.CB 9.1645 15.2742 19.8565 0.9981 Constraint (T0311)S75.CB (T0311)S86.CB 7.7208 12.8680 16.7284 0.9981 Constraint (T0311)W74.CB (T0311)T96.CB 9.2006 15.3343 19.9346 0.9981 Constraint (T0311)W74.CB (T0311)L91.CB 7.9173 13.1955 17.1541 0.9981 Constraint (T0311)W74.CB (T0311)R90.CB 7.0846 11.8077 15.3501 0.9981 Constraint (T0311)W74.CB (T0311)R89.CB 8.6159 14.3598 18.6678 0.9981 Constraint (T0311)W74.CB (T0311)L88.CB 7.7278 12.8796 16.7435 0.9981 Constraint (T0311)A73.CB (T0311)L91.CB 8.2169 13.6949 17.8033 0.9981 Constraint (T0311)A73.CB (T0311)R90.CB 8.1196 13.5327 17.5925 0.9981 Constraint (T0311)A73.CB (T0311)L88.CB 9.1009 15.1682 19.7186 0.9981 Constraint (T0311)A73.CB (T0311)S86.CB 8.3626 13.9377 18.1190 0.9981 Constraint (T0311)N72.CB (T0311)T96.CB 9.4282 15.7136 20.4277 0.9981 Constraint (T0311)N72.CB (T0311)L91.CB 8.6862 14.4771 18.8202 0.9981 Constraint (T0311)N72.CB (T0311)R90.CB 9.3279 15.5465 20.2105 0.9981 Constraint (T0311)N72.CB (T0311)L88.CB 8.7482 14.5804 18.9545 0.9981 Constraint (T0311)N72.CB (T0311)R87.CB 6.4934 10.8224 14.0691 0.9981 Constraint (T0311)N72.CB (T0311)V85.CB 9.4178 15.6963 20.4052 0.9981 Constraint (T0311)Q71.CB (T0311)P97.CB 8.7355 14.5592 18.9269 0.9981 Constraint (T0311)Q71.CB (T0311)T96.CB 6.6901 11.1501 14.4951 0.9981 Constraint (T0311)Q71.CB (T0311)T93.CB 7.2854 12.1424 15.7851 0.9981 Constraint (T0311)Q71.CB (T0311)V92.CB 9.3654 15.6090 20.2917 0.9981 Constraint (T0311)Q71.CB (T0311)L91.CB 6.5145 10.8576 14.1148 0.9981 Constraint (T0311)Q71.CB (T0311)R90.CB 6.9052 11.5087 14.9614 0.9981 Constraint (T0311)Q71.CB (T0311)R89.CB 7.8254 13.0423 16.9550 0.9981 Constraint (T0311)Q71.CB (T0311)R87.CB 3.7025 6.1708 8.0220 0.9981 Constraint (T0311)Q71.CB (T0311)S86.CB 5.8881 9.8135 12.7576 0.9981 Constraint (T0311)L70.CB (T0311)T96.CB 7.2372 12.0620 15.6806 0.9981 Constraint (T0311)L70.CB (T0311)T93.CB 6.7001 11.1668 14.5168 0.9981 Constraint (T0311)L70.CB (T0311)V92.CB 7.6309 12.7181 16.5336 0.9981 Constraint (T0311)L70.CB (T0311)L91.CB 4.7582 7.9303 10.3094 0.9981 Constraint (T0311)N69.CB (T0311)T96.CB 8.3599 13.9331 18.1131 0.9981 Constraint (T0311)N69.CB (T0311)T93.CB 7.7595 12.9326 16.8123 0.9981 Constraint (T0311)N69.CB (T0311)V92.CB 9.1531 15.2551 19.8316 0.9981 Constraint (T0311)N69.CB (T0311)R90.CB 7.7493 12.9155 16.7902 0.9981 Constraint (T0311)L68.CB (T0311)P97.CB 8.7145 14.5241 18.8813 0.9981 Constraint (T0311)L68.CB (T0311)T96.CB 6.4659 10.7766 14.0095 0.9981 Constraint (T0311)L68.CB (T0311)S95.CB 8.9744 14.9573 19.4445 0.9981 Constraint (T0311)L68.CB (T0311)T93.CB 6.7604 11.2673 14.6475 0.9981 Constraint (T0311)L68.CB (T0311)V92.CB 9.3190 15.5316 20.1911 0.9981 Constraint (T0311)L68.CB (T0311)L91.CB 6.5565 10.9275 14.2057 0.9981 Constraint (T0311)L68.CB (T0311)R90.CB 8.2989 13.8315 17.9810 0.9981 Constraint (T0311)L68.CB (T0311)R89.CB 9.2086 15.3476 19.9519 0.9981 Constraint (T0311)L68.CB (T0311)L88.CB 6.4428 10.7380 13.9594 0.9981 Constraint (T0311)L68.CB (T0311)S86.CB 8.3357 13.8928 18.0606 0.9981 Constraint (T0311)W67.CB (T0311)P97.CB 7.0488 11.7480 15.2723 0.9981 Constraint (T0311)W67.CB (T0311)T96.CB 4.0424 6.7373 8.7585 0.9981 Constraint (T0311)W67.CB (T0311)S95.CB 6.8049 11.3416 14.7440 0.9981 Constraint (T0311)W67.CB (T0311)Q94.CB 7.4263 12.3772 16.0904 0.9981 Constraint (T0311)W67.CB (T0311)T93.CB 3.8640 6.4400 8.3720 0.9981 Constraint (T0311)W67.CB (T0311)V92.CB 6.2667 10.4446 13.5779 0.9981 Constraint (T0311)W67.CB (T0311)L91.CB 3.5414 5.9023 7.6730 0.9981 Constraint (T0311)W67.CB (T0311)R90.CB 5.4149 9.0248 11.7322 0.9981 Constraint (T0311)W67.CB (T0311)R89.CB 6.1396 10.2326 13.3024 0.9981 Constraint (T0311)M66.CB (T0311)T96.CB 6.3546 10.5910 13.7683 0.9981 Constraint (T0311)M66.CB (T0311)S95.CB 8.0122 13.3536 17.3597 0.9981 Constraint (T0311)M66.CB (T0311)Q94.CB 8.5617 14.2695 18.5504 0.9981 Constraint (T0311)M66.CB (T0311)T93.CB 4.9689 8.2816 10.7661 0.9981 Constraint (T0311)M66.CB (T0311)V92.CB 6.1811 10.3018 13.3923 0.9981 Constraint (T0311)M66.CB (T0311)L91.CB 3.7954 6.3257 8.2234 0.9981 Constraint (T0311)M66.CB (T0311)R90.CB 6.3482 10.5803 13.7544 0.9981 Constraint (T0311)M66.CB (T0311)R89.CB 7.9912 13.3186 17.3142 0.9981 Constraint (T0311)Q65.CB (T0311)T96.CB 7.1099 11.8499 15.4048 0.9981 Constraint (T0311)Q65.CB (T0311)S95.CB 8.4862 14.1437 18.3868 0.9981 Constraint (T0311)Q65.CB (T0311)T93.CB 6.5793 10.9655 14.2551 0.9981 Constraint (T0311)P64.CB (T0311)P97.CB 6.0818 10.1364 13.1773 0.9981 Constraint (T0311)P64.CB (T0311)T96.CB 3.7492 6.2487 8.1233 0.9981 Constraint (T0311)P64.CB (T0311)S95.CB 5.4893 9.1489 11.8935 0.9981 Constraint (T0311)P64.CB (T0311)Q94.CB 7.3551 12.2585 15.9360 0.9981 Constraint (T0311)P64.CB (T0311)T93.CB 4.1585 6.9308 9.0101 0.9981 Constraint (T0311)T43.CB (T0311)W74.CB 5.5069 9.1782 11.9317 0.9981 Constraint (T0311)T43.CB (T0311)Q65.CB 5.5208 9.2013 11.9616 0.9981 Constraint (T0311)L41.CB (T0311)T93.CB 7.7128 12.8546 16.7110 0.9981 Constraint (T0311)L41.CB (T0311)V92.CB 7.8526 13.0877 17.0140 0.9981 Constraint (T0311)L41.CB (T0311)L91.CB 7.2366 12.0609 15.6792 0.9981 Constraint (T0311)L41.CB (T0311)R90.CB 9.0056 15.0093 19.5121 0.9981 Constraint (T0311)S39.CB (T0311)W74.CB 8.8954 14.8256 19.2733 0.9981 Constraint (T0311)T37.CB (T0311)V92.CB 8.6649 14.4414 18.7739 0.9981 Constraint (T0311)T37.CB (T0311)L91.CB 7.7905 12.9841 16.8794 0.9981 Constraint (T0311)E19.CB (T0311)I54.CB 8.6648 14.4414 18.7738 0.9981 Constraint (T0311)D18.CB (T0311)I54.CB 6.3377 10.5629 13.7318 0.9981 Constraint (T0311)D18.CB (T0311)E51.CB 7.4599 12.4331 16.1630 0.9981 Constraint (T0311)Q14.CB (T0311)T93.CB 8.7963 14.6605 19.0586 0.9981 Constraint (T0311)Q14.CB (T0311)L91.CB 8.8735 14.7891 19.2259 0.9981 Constraint (T0311)I12.CB (T0311)T93.CB 9.5899 15.9832 20.7781 0.9981 Constraint (T0311)I12.CB (T0311)V92.CB 9.5154 15.8590 20.6167 0.9981 Constraint (T0311)I12.CB (T0311)L91.CB 7.8601 13.1001 17.0301 0.9981 Constraint (T0311)I12.CB (T0311)R90.CB 9.2345 15.3909 20.0082 0.9981 Constraint (T0311)L42.CB (T0311)L91.CB 8.1125 13.5209 17.5771 0.9923 Constraint (T0311)L41.CB (T0311)L88.CB 8.7385 14.5641 18.9333 0.9923 Constraint (T0311)R40.CB (T0311)L88.CB 8.6883 14.4805 18.8246 0.9923 Constraint (T0311)S36.CB (T0311)L91.CB 7.7965 12.9942 16.8924 0.9923 Constraint (T0311)A46.CB (T0311)D84.CB 8.7199 14.5332 18.8932 0.9878 Constraint (T0311)A46.CB (T0311)E80.CB 9.2241 15.3734 19.9855 0.9878 Constraint (T0311)K45.CB (T0311)D84.CB 9.5185 15.8642 20.6234 0.9878 Constraint (T0311)T43.CB (T0311)V83.CB 5.8334 9.7224 12.6391 0.9878 Constraint (T0311)T43.CB (T0311)T82.CB 8.4557 14.0928 18.3207 0.9878 Constraint (T0311)T43.CB (T0311)K81.CB 7.7099 12.8499 16.7048 0.9878 Constraint (T0311)R40.CB (T0311)S86.CB 8.5999 14.3331 18.6331 0.9878 Constraint (T0311)R40.CB (T0311)D84.CB 7.9091 13.1819 17.1364 0.9878 Constraint (T0311)R40.CB (T0311)V83.CB 7.5345 12.5575 16.3248 0.9878 Constraint (T0311)S39.CB (T0311)T82.CB 7.7049 12.8415 16.6940 0.9878 Constraint (T0311)S39.CB (T0311)K81.CB 8.1155 13.5258 17.5835 0.9878 Constraint (T0311)S36.CB (T0311)S86.CB 7.8190 13.0316 16.9411 0.9878 Constraint (T0311)S36.CB (T0311)D84.CB 8.7391 14.5652 18.9347 0.9878 Constraint (T0311)S36.CB (T0311)V83.CB 6.9417 11.5694 15.0403 0.9878 Constraint (T0311)A34.CB (T0311)V83.CB 8.7564 14.5941 18.9723 0.9878 Constraint (T0311)A73.CB (T0311)V85.CB 8.7327 14.5545 18.9209 0.9846 Constraint (T0311)M52.CB (T0311)V85.CB 9.5575 15.9291 20.7078 0.9846 Constraint (T0311)L41.CB (T0311)S86.CB 9.0503 15.0838 19.6090 0.9846 Constraint (T0311)L41.CB (T0311)V85.CB 6.9025 11.5041 14.9554 0.9846 Constraint (T0311)R40.CB (T0311)R87.CB 7.6438 12.7396 16.5615 0.9846 Constraint (T0311)R40.CB (T0311)V85.CB 8.7472 14.5787 18.9523 0.9846 Constraint (T0311)A38.CB (T0311)S86.CB 7.7919 12.9866 16.8825 0.9846 Constraint (T0311)T37.CB (T0311)R87.CB 8.6310 14.3850 18.7005 0.9846 Constraint (T0311)T37.CB (T0311)V85.CB 8.3540 13.9233 18.1003 0.9846 Constraint (T0311)T37.CB (T0311)W74.CB 7.3909 12.3182 16.0137 0.9846 Constraint (T0311)T37.CB (T0311)A73.CB 5.4030 9.0051 11.7066 0.9846 Constraint (T0311)S36.CB (T0311)V85.CB 9.3052 15.5086 20.1612 0.9846 Constraint (T0311)P35.CB (T0311)A73.CB 8.9173 14.8621 19.3208 0.9846 Constraint (T0311)A34.CB (T0311)V85.CB 9.2588 15.4313 20.0606 0.9846 Constraint (T0311)A34.CB (T0311)W74.CB 9.5689 15.9481 20.7325 0.9846 Constraint (T0311)A34.CB (T0311)A73.CB 8.0042 13.3403 17.3424 0.9846 Constraint (T0311)I33.CB (T0311)R87.CB 9.1315 15.2191 19.7849 0.9846 Constraint (T0311)I33.CB (T0311)V85.CB 7.6528 12.7547 16.5811 0.9846 Constraint (T0311)I33.CB (T0311)W74.CB 6.7854 11.3089 14.7016 0.9846 Constraint (T0311)E32.CB (T0311)V85.CB 9.1119 15.1865 19.7424 0.9846 Constraint (T0311)E32.CB (T0311)W74.CB 7.0945 11.8241 15.3713 0.9846 Constraint (T0311)A28.CB (T0311)S86.CB 9.1359 15.2265 19.7945 0.9846 Constraint (T0311)L70.CB (T0311)D84.CB 6.9639 11.6065 15.0884 0.9778 Constraint (T0311)N69.CB (T0311)V85.CB 8.3603 13.9339 18.1140 0.9778 Constraint (T0311)N69.CB (T0311)D84.CB 7.4386 12.3977 16.1170 0.9778 Constraint (T0311)N69.CB (T0311)K81.CB 4.7852 7.9754 10.3680 0.9778 Constraint (T0311)E15.CB (T0311)R40.CB 9.0163 15.0271 19.5352 0.8957 Constraint (T0311)E15.CB (T0311)T37.CB 8.0939 13.4899 17.5368 0.8957 Constraint (T0311)E15.CB (T0311)P35.CB 7.9146 13.1910 17.1483 0.8957 Constraint (T0311)E15.CB (T0311)A34.CB 9.2190 15.3649 19.9744 0.8957 Constraint (T0311)P50.CB (T0311)N72.CB 9.1565 15.2609 19.8392 0.8096 Constraint (T0311)L41.CB (T0311)N72.CB 9.3358 15.5597 20.2276 0.8096 Constraint (T0311)I33.CB (T0311)N72.CB 9.4323 15.7204 20.4365 0.8096 Constraint (T0311)E32.CB (T0311)N72.CB 8.7678 14.6130 18.9969 0.8096 Constraint (T0311)R29.CB (T0311)A73.CB 7.7199 12.8665 16.7264 0.8096 Constraint (T0311)A28.CB (T0311)N72.CB 9.1790 15.2983 19.8878 0.8096 Constraint (T0311)E26.CB (T0311)W74.CB 9.5788 15.9646 20.7540 0.8096 Constraint (T0311)E26.CB (T0311)A73.CB 7.3237 12.2062 15.8680 0.8096 Constraint (T0311)R25.CB (T0311)E78.CB 9.4174 15.6956 20.4043 0.8096 Constraint (T0311)R25.CB (T0311)A73.CB 8.9673 14.9455 19.4292 0.8096 Constraint (T0311)L24.CB (T0311)W74.CB 8.9768 14.9614 19.4498 0.8096 Constraint (T0311)S23.CB (T0311)A73.CB 9.3556 15.5927 20.2705 0.8096 Constraint (T0311)V22.CB (T0311)W74.CB 7.8370 13.0616 16.9801 0.8096 Constraint (T0311)V22.CB (T0311)A73.CB 7.0584 11.7641 15.2933 0.8096 Constraint (T0311)N21.CB (T0311)S86.CB 8.6812 14.4686 18.8092 0.8096 Constraint (T0311)L20.CB (T0311)S86.CB 7.7251 12.8751 16.7376 0.8096 Constraint (T0311)S16.CB (T0311)W74.CB 4.1224 6.8707 8.9319 0.8096 Constraint (T0311)I13.CB (T0311)S75.CB 6.9404 11.5674 15.0376 0.8096 Constraint (T0311)I13.CB (T0311)W74.CB 3.8897 6.4829 8.4278 0.8096 Constraint (T0311)N72.CB (T0311)Q94.CB 9.4953 15.8255 20.5732 0.6667 Constraint (T0311)V59.CB (T0311)V85.CB 8.9941 14.9902 19.4872 0.6667 Constraint (T0311)V58.CB (T0311)V85.CB 9.2907 15.4846 20.1299 0.6667 Constraint (T0311)A30.CB (T0311)P97.CB 9.1044 15.1740 19.7262 0.6667 Constraint (T0311)R29.CB (T0311)P97.CB 9.5149 15.8582 20.6157 0.6667 Constraint (T0311)E26.CB (T0311)P97.CB 7.7146 12.8577 16.7150 0.6667 Constraint (T0311)E26.CB (T0311)T96.CB 8.8741 14.7901 19.2272 0.6667 Constraint (T0311)S23.CB (T0311)P97.CB 8.4542 14.0903 18.3173 0.6667 Constraint (T0311)S23.CB (T0311)T96.CB 8.9962 14.9936 19.4917 0.6667 Constraint (T0311)V22.CB (T0311)P97.CB 8.4170 14.0283 18.2368 0.6667 Constraint (T0311)V22.CB (T0311)T96.CB 8.7929 14.6549 19.0513 0.6667 Constraint (T0311)N21.CB (T0311)P97.CB 7.0907 11.8178 15.3632 0.6667 Constraint (T0311)N21.CB (T0311)T96.CB 6.3519 10.5866 13.7625 0.6667 Constraint (T0311)N21.CB (T0311)T93.CB 9.4442 15.7403 20.4624 0.6667 Constraint (T0311)L20.CB (T0311)P97.CB 9.0866 15.1443 19.6875 0.6667 Constraint (T0311)L20.CB (T0311)T96.CB 8.9835 14.9726 19.4643 0.6667 Constraint (T0311)I60.CB (T0311)R90.CB 9.3141 15.5235 20.1805 0.5957 Constraint (T0311)D18.CB (T0311)R90.CB 8.6571 14.4285 18.7570 0.5957 Constraint (T0311)E15.CB (T0311)R90.CB 8.0757 13.4595 17.4973 0.5957 Constraint (T0311)D11.CB (T0311)R90.CB 7.0848 11.8080 15.3504 0.5957 Constraint (T0311)L68.CB (T0311)D84.CB 6.3063 10.5105 13.6637 0.5730 Constraint (T0311)V59.CB (T0311)R87.CB 8.7274 14.5456 18.9093 0.5730 Constraint (T0311)M52.CB (T0311)P97.CB 9.5025 15.8375 20.5887 0.5730 Constraint (T0311)M52.CB (T0311)L88.CB 7.1222 11.8703 15.4314 0.5730 Constraint (T0311)T49.CB (T0311)P97.CB 8.6090 14.3483 18.6528 0.5730 Constraint (T0311)L48.CB (T0311)P97.CB 8.4593 14.0989 18.3286 0.5730 Constraint (T0311)L48.CB (T0311)T96.CB 9.4056 15.6760 20.3788 0.5730 Constraint (T0311)L48.CB (T0311)L91.CB 9.5813 15.9688 20.7594 0.5730 Constraint (T0311)A47.CB (T0311)P97.CB 5.2933 8.8221 11.4688 0.5730 Constraint (T0311)A47.CB (T0311)T96.CB 6.8689 11.4481 14.8825 0.5730 Constraint (T0311)A47.CB (T0311)L91.CB 8.3085 13.8475 18.0017 0.5730 Constraint (T0311)A47.CB (T0311)R90.CB 8.0214 13.3691 17.3798 0.5730 Constraint (T0311)A47.CB (T0311)L88.CB 4.0421 6.7369 8.7579 0.5730 Constraint (T0311)A46.CB (T0311)P97.CB 7.5627 12.6045 16.3858 0.5730 Constraint (T0311)A46.CB (T0311)T96.CB 9.4520 15.7534 20.4794 0.5730 Constraint (T0311)A46.CB (T0311)L88.CB 6.8657 11.4429 14.8758 0.5730 Constraint (T0311)A46.CB (T0311)R87.CB 4.6813 7.8022 10.1428 0.5730 Constraint (T0311)K45.CB (T0311)P97.CB 9.1906 15.3177 19.9130 0.5730 Constraint (T0311)K45.CB (T0311)R90.CB 9.1972 15.3286 19.9272 0.5730 Constraint (T0311)Q71.CB (T0311)D84.CB 9.4922 15.8204 20.5665 0.4048 Constraint (T0311)I33.CB (T0311)L88.CB 8.3662 13.9437 18.1268 0.4048 Constraint (T0311)E32.CB (T0311)L91.CB 8.0959 13.4932 17.5411 0.4048 Constraint (T0311)E32.CB (T0311)L88.CB 8.4982 14.1636 18.4127 0.4048 Constraint (T0311)E32.CB (T0311)R87.CB 9.1733 15.2888 19.8755 0.4048 Constraint (T0311)M31.CB (T0311)L88.CB 6.8667 11.4446 14.8779 0.4048 Constraint (T0311)A30.CB (T0311)S95.CB 9.1074 15.1791 19.7328 0.4048 Constraint (T0311)A30.CB (T0311)L91.CB 3.2277 5.3795 6.9934 0.4048 Constraint (T0311)A30.CB (T0311)R90.CB 5.6370 9.3949 12.2134 0.4048 Constraint (T0311)A30.CB (T0311)R89.CB 6.3493 10.5822 13.7568 0.4048 Constraint (T0311)A30.CB (T0311)L88.CB 3.8435 6.4058 8.3276 0.4048 Constraint (T0311)R29.CB (T0311)S95.CB 9.1456 15.2426 19.8154 0.4048 Constraint (T0311)R29.CB (T0311)L91.CB 4.8275 8.0458 10.4596 0.4048 Constraint (T0311)R29.CB (T0311)R90.CB 7.9994 13.3324 17.3321 0.4048 Constraint (T0311)R29.CB (T0311)R89.CB 8.2464 13.7440 17.8671 0.4048 Constraint (T0311)R29.CB (T0311)L88.CB 6.0878 10.1463 13.1902 0.4048 Constraint (T0311)R29.CB (T0311)R87.CB 7.5869 12.6448 16.4382 0.4048 Constraint (T0311)R29.CB (T0311)S86.CB 9.1456 15.2426 19.8154 0.4048 Constraint (T0311)A28.CB (T0311)L91.CB 6.9050 11.5083 14.9608 0.4048 Constraint (T0311)F27.CB (T0311)L91.CB 5.4716 9.1193 11.8552 0.4048 Constraint (T0311)F27.CB (T0311)R90.CB 7.5060 12.5100 16.2630 0.4048 Constraint (T0311)E26.CB (T0311)Q94.CB 8.5587 14.2645 18.5439 0.4048 Constraint (T0311)E26.CB (T0311)L91.CB 3.4166 5.6944 7.4027 0.4048 Constraint (T0311)E26.CB (T0311)R90.CB 6.2783 10.4639 13.6031 0.4048 Constraint (T0311)R25.CB (T0311)S95.CB 8.4396 14.0661 18.2859 0.4048 Constraint (T0311)R25.CB (T0311)R90.CB 9.3432 15.5721 20.2437 0.4048 Constraint (T0311)S23.CB (T0311)S95.CB 7.3333 12.2222 15.8888 0.4048 Constraint (T0311)S23.CB (T0311)Q94.CB 9.2396 15.3993 20.0191 0.4048 Constraint (T0311)V22.CB (T0311)Q94.CB 9.1473 15.2456 19.8192 0.4048 Constraint (T0311)V22.CB (T0311)L91.CB 6.1474 10.2457 13.3194 0.4048 Constraint (T0311)V22.CB (T0311)R90.CB 7.3206 12.2011 15.8614 0.4048 Constraint (T0311)N21.CB (T0311)L91.CB 8.6900 14.4834 18.8284 0.4048 Constraint (T0311)N21.CB (T0311)R90.CB 9.1999 15.3331 19.9330 0.4048 Constraint (T0311)N21.CB (T0311)R89.CB 6.0361 10.0601 13.0781 0.4048 Constraint (T0311)N21.CB (T0311)L88.CB 7.1234 11.8723 15.4339 0.4048 Constraint (T0311)L20.CB (T0311)L91.CB 7.4382 12.3970 16.1161 0.4048 Constraint (T0311)L20.CB (T0311)R90.CB 7.3048 12.1747 15.8271 0.4048 Constraint (T0311)L20.CB (T0311)R89.CB 4.3156 7.1927 9.3506 0.4048 Constraint (T0311)L20.CB (T0311)L88.CB 4.7110 7.8517 10.2072 0.4048 Constraint (T0311)L20.CB (T0311)R87.CB 7.2188 12.0313 15.6407 0.4048 Constraint (T0311)E19.CB (T0311)R89.CB 7.2443 12.0738 15.6959 0.4048 Constraint (T0311)L17.CB (T0311)L91.CB 7.8628 13.1047 17.0361 0.4048 Constraint (T0311)L17.CB (T0311)R90.CB 9.1396 15.2327 19.8025 0.4048 Constraint (T0311)S16.CB (T0311)L91.CB 8.9760 14.9599 19.4479 0.4048 Constraint (T0311)S16.CB (T0311)R90.CB 9.2319 15.3865 20.0024 0.4048 Constraint (T0311)S16.CB (T0311)R89.CB 7.0398 11.7329 15.2528 0.4048 Constraint (T0311)S16.CB (T0311)L88.CB 5.5026 9.1709 11.9222 0.4048 Constraint (T0311)I13.CB (T0311)L91.CB 9.5056 15.8426 20.5954 0.4048 Constraint (T0311)I12.CB (T0311)V85.CB 7.5639 12.6064 16.3884 0.4048 Constraint (T0311)D11.CB (T0311)S75.CB 9.3305 15.5508 20.2160 0.4048 Constraint (T0311)D11.CB (T0311)W74.CB 6.4564 10.7606 13.9888 0.4048 Constraint (T0311)N5.CB (T0311)P50.CB 8.2643 13.7738 17.9060 0.3388 Constraint (T0311)N5.CB (T0311)L48.CB 9.5980 15.9967 20.7957 0.3388 Constraint (T0311)N5.CB (T0311)L41.CB 8.2140 13.6901 17.7971 0.3388 Constraint (T0311)N5.CB (T0311)R40.CB 9.1352 15.2254 19.7930 0.3388 Constraint (T0311)N5.CB (T0311)T37.CB 7.4972 12.4954 16.2440 0.3388 Constraint (T0311)N5.CB (T0311)A34.CB 9.0852 15.1419 19.6845 0.3388 Constraint (T0311)N5.CB (T0311)I33.CB 6.7696 11.2826 14.6674 0.3388 Constraint (T0311)N5.CB (T0311)E32.CB 6.7494 11.2491 14.6238 0.3388 Constraint (T0311)N5.CB (T0311)M31.CB 6.9810 11.6350 15.1255 0.3388 Constraint (T0311)S16.CB (T0311)S36.CB 8.6164 14.3607 18.6689 0.3000 Constraint (T0311)D11.CB (T0311)E51.CB 7.4352 12.3919 16.1095 0.1000 Constraint (T0311)D11.CB (T0311)P35.CB 9.2592 15.4320 20.0616 0.1000 Constraint (T0311)D11.CB (T0311)A34.CB 9.2638 15.4397 20.0716 0.1000 Constraint (T0311)D11.CB (T0311)R29.CB 8.4872 14.1453 18.3889 0.1000 Constraint (T0311)D11.CB (T0311)R25.CB 9.4421 15.7368 20.4579 0.1000 Constraint (T0311)D11.CB (T0311)N21.CB 8.7790 14.6316 19.0211 0.1000 Constraint (T0311)T96.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: