# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 15.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 169 242 9.0135 11.2669 16.9004 83.7290 Constraint 259 322 9.2821 11.6026 17.4039 83.5350 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 176 279 10.9440 13.6800 20.5200 82.8174 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 242 322 9.7236 12.1545 18.2318 82.0187 Constraint 176 267 10.8516 13.5645 20.3468 81.9108 Constraint 201 322 10.5837 13.2296 19.8444 80.3060 Constraint 210 330 10.8810 13.6013 20.4019 80.1608 Constraint 190 314 11.1367 13.9209 20.8813 79.9231 Constraint 250 314 10.7704 13.4630 20.1945 79.8936 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 169 314 11.0350 13.7938 20.6906 79.7885 Constraint 292 399 9.5162 11.8953 17.8429 79.4761 Constraint 314 429 9.0863 11.3579 17.0369 79.1600 Constraint 314 421 6.1734 7.7167 11.5751 78.4437 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 292 421 6.4154 8.0192 12.0288 78.3386 Constraint 285 421 8.1609 10.2012 15.3017 78.3386 Constraint 210 429 9.1464 11.4330 17.1495 78.3386 Constraint 210 421 5.9486 7.4357 11.1536 78.3386 Constraint 182 421 9.1212 11.4015 17.1023 78.3386 Constraint 237 314 10.8338 13.5423 20.3134 78.0721 Constraint 190 303 11.2771 14.0963 21.1445 77.9980 Constraint 242 421 4.9975 6.2469 9.3703 77.3930 Constraint 267 330 11.0988 13.8735 20.8102 77.3679 Constraint 303 421 9.5276 11.9095 17.8642 77.1598 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 322 399 9.8027 12.2534 18.3801 76.5642 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 201 285 10.9193 13.6491 20.4736 76.4723 Constraint 322 421 8.0176 10.0220 15.0331 76.3505 Constraint 259 421 6.8013 8.5016 12.7524 76.3384 Constraint 259 404 10.0638 12.5798 18.8697 76.2461 Constraint 292 412 8.6583 10.8229 16.2344 76.2453 Constraint 285 412 8.9624 11.2030 16.8045 76.2453 Constraint 210 412 8.0514 10.0642 15.0963 76.2453 Constraint 128 297 9.1674 11.4592 17.1888 75.9352 Constraint 242 399 8.2128 10.2660 15.3990 75.9001 Constraint 259 330 11.2878 14.1098 21.1647 75.8382 Constraint 210 399 10.2023 12.7528 19.1293 75.7428 Constraint 182 341 10.8197 13.5246 20.2869 75.7314 Constraint 314 412 8.8608 11.0759 16.6139 75.6479 Constraint 128 272 10.0105 12.5131 18.7697 75.6352 Constraint 242 429 8.1201 10.1501 15.2251 75.6058 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 169 421 8.9666 11.2082 16.8123 75.4127 Constraint 221 421 7.8416 9.8020 14.7031 75.3386 Constraint 242 412 4.3429 5.4286 8.1429 75.2997 Constraint 201 279 11.5825 14.4782 21.7173 75.1590 Constraint 259 399 9.2037 11.5046 17.2569 74.8455 Constraint 242 404 7.9861 9.9826 14.9740 74.4972 Constraint 104 297 8.6616 10.8269 16.2404 74.4437 Constraint 259 412 6.5640 8.2050 12.3075 74.2451 Constraint 221 330 11.0419 13.8023 20.7035 74.1608 Constraint 237 421 7.3203 9.1504 13.7256 73.8931 Constraint 201 421 9.6929 12.1162 18.1743 73.8931 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 285 355 9.2698 11.5872 17.3808 73.8564 Constraint 242 435 7.1243 8.9054 13.3581 73.6212 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 303 399 9.9835 12.4794 18.7191 73.4870 Constraint 292 442 8.2901 10.3627 15.5440 73.2333 Constraint 210 442 5.2837 6.6046 9.9069 73.2333 Constraint 279 341 8.4326 10.5408 15.8111 72.9443 Constraint 128 221 8.5572 10.6964 16.0447 72.6352 Constraint 259 442 8.0525 10.0656 15.0984 72.5666 Constraint 210 435 9.0140 11.2675 16.9012 72.4735 Constraint 285 350 6.8799 8.5999 12.8999 72.4076 Constraint 242 442 4.8649 6.0811 9.1216 72.2877 Constraint 176 285 11.2711 14.0889 21.1334 72.0429 Constraint 237 412 6.7497 8.4371 12.6557 71.7999 Constraint 355 421 10.4417 13.0521 19.5782 71.6225 Constraint 250 412 6.0105 7.5132 11.2697 71.6214 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 221 412 8.5636 10.7045 16.0568 71.4582 Constraint 297 421 9.5453 11.9316 17.8974 71.4510 Constraint 292 429 10.1224 12.6530 18.9795 71.4510 Constraint 104 176 9.3061 11.6326 17.4489 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 314 442 9.6905 12.1131 18.1696 71.4419 Constraint 122 292 9.6930 12.1162 18.1743 71.3017 Constraint 122 201 9.5096 11.8870 17.8305 71.3017 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 292 355 10.7738 13.4673 20.2009 70.8565 Constraint 96 303 9.1839 11.4798 17.2198 70.8477 Constraint 96 297 8.5703 10.7129 16.0693 70.8477 Constraint 128 314 8.6412 10.8015 16.2022 70.0233 Constraint 350 421 9.8302 12.2877 18.4316 69.8710 Constraint 237 435 7.3795 9.2244 13.8366 69.8153 Constraint 237 429 9.4036 11.7545 17.6318 69.7997 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 104 221 10.8224 13.5280 20.2919 69.3491 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 88 210 9.8394 12.2993 18.4489 68.8667 Constraint 259 341 10.8629 13.5787 20.3680 68.8503 Constraint 226 421 9.6799 12.0999 18.1498 68.7999 Constraint 226 412 9.3911 11.7388 17.6082 68.7999 Constraint 169 259 10.3646 12.9558 19.4336 68.6120 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 237 442 4.1481 5.1852 7.7777 68.4818 Constraint 201 442 7.2475 9.0593 13.5890 68.4818 Constraint 169 442 6.8572 8.5715 12.8573 68.2142 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 221 442 7.6721 9.5901 14.3852 68.1401 Constraint 250 404 9.7049 12.1311 18.1966 68.0349 Constraint 96 242 8.6009 10.7511 16.1266 67.9269 Constraint 104 201 10.7524 13.4405 20.1607 67.8785 Constraint 96 221 9.4238 11.7798 17.6697 67.8477 Constraint 237 404 10.2827 12.8534 19.2801 67.7844 Constraint 104 421 9.2382 11.5478 17.3216 67.5965 Constraint 182 442 9.4320 11.7900 17.6850 67.4815 Constraint 176 442 9.7485 12.1856 18.2784 67.4734 Constraint 267 412 10.4137 13.0171 19.5257 67.4634 Constraint 128 226 10.1140 12.6425 18.9637 67.4060 Constraint 292 391 7.6033 9.5042 14.2562 67.3876 Constraint 285 391 6.6161 8.2701 12.4051 67.3876 Constraint 259 391 6.1361 7.6701 11.5051 67.3876 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 250 421 8.2163 10.2704 15.4056 67.0503 Constraint 259 435 10.0836 12.6045 18.9068 66.9935 Constraint 96 272 10.7685 13.4606 20.1909 66.8314 Constraint 96 176 9.9571 12.4464 18.6696 66.8314 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 128 242 8.7542 10.9427 16.4141 66.7240 Constraint 128 421 7.5439 9.4299 14.1448 66.5984 Constraint 242 391 5.9528 7.4410 11.1615 66.4420 Constraint 259 382 9.0582 11.3227 16.9841 66.4037 Constraint 210 391 9.1127 11.3908 17.0862 66.1731 Constraint 104 330 7.8639 9.8299 14.7448 66.1514 Constraint 242 382 8.3216 10.4019 15.6029 66.1420 Constraint 285 368 8.7224 10.9029 16.3544 66.0374 Constraint 88 314 8.4281 10.5351 15.8027 65.9549 Constraint 237 391 9.6172 12.0215 18.0322 65.8731 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 272 421 10.1928 12.7410 19.1114 65.8547 Constraint 272 341 10.8704 13.5881 20.3821 65.8294 Constraint 267 341 10.5443 13.1804 19.7705 65.8294 Constraint 136 322 8.5376 10.6720 16.0081 65.5355 Constraint 226 442 7.4966 9.3707 14.0561 65.4818 Constraint 104 303 10.0052 12.5065 18.7597 65.4648 Constraint 250 399 10.6208 13.2760 19.9139 65.4493 Constraint 292 449 8.8760 11.0950 16.6425 65.2755 Constraint 210 449 6.1451 7.6814 11.5221 65.2755 Constraint 182 449 9.8132 12.2665 18.3997 65.2755 Constraint 210 404 10.8149 13.5186 20.2779 65.2491 Constraint 176 314 11.3720 14.2150 21.3226 65.2214 Constraint 128 237 8.4146 10.5182 15.7773 65.1629 Constraint 250 442 7.5355 9.4194 14.1291 65.0656 Constraint 190 442 9.9175 12.3969 18.5953 64.8151 Constraint 96 201 10.1997 12.7497 19.1245 64.7689 Constraint 128 442 7.7213 9.6517 14.4775 64.6692 Constraint 113 421 10.3404 12.9254 19.3882 64.6382 Constraint 161 237 10.1367 12.6709 19.0064 64.5291 Constraint 292 360 7.8678 9.8347 14.7521 64.5166 Constraint 285 360 7.0526 8.8157 13.2236 64.5166 Constraint 96 435 10.4714 13.0892 19.6338 64.5052 Constraint 96 421 5.6457 7.0571 10.5856 64.5052 Constraint 96 412 9.6227 12.0284 18.0427 64.5052 Constraint 237 399 11.1374 13.9218 20.8827 64.2678 Constraint 250 391 7.6952 9.6190 14.4286 64.2508 Constraint 250 382 8.8522 11.0653 16.5979 64.2508 Constraint 314 449 9.1952 11.4940 17.2411 64.1508 Constraint 285 382 9.9250 12.4063 18.6094 64.1338 Constraint 122 421 7.4323 9.2904 13.9355 63.9402 Constraint 169 429 10.6713 13.3392 20.0088 63.5810 Constraint 169 435 10.5041 13.1302 19.6952 63.5769 Constraint 242 360 8.5295 10.6619 15.9929 63.5710 Constraint 297 360 9.5225 11.9032 17.8548 63.3022 Constraint 210 360 10.1568 12.6961 19.0441 63.3022 Constraint 267 421 10.1448 12.6810 19.0216 63.2837 Constraint 176 449 10.2896 12.8620 19.2931 63.1823 Constraint 96 442 8.3633 10.4541 15.6811 63.1717 Constraint 267 391 9.2122 11.5153 17.2729 63.0803 Constraint 360 429 8.5563 10.6954 16.0430 63.0519 Constraint 122 237 9.0051 11.2564 16.8846 62.8919 Constraint 221 391 8.8227 11.0284 16.5426 62.8731 Constraint 113 182 10.7393 13.4241 20.1361 62.7973 Constraint 96 285 9.3652 11.7065 17.5597 62.7037 Constraint 122 429 7.7925 9.7407 14.6110 62.5450 Constraint 259 360 8.0304 10.0380 15.0570 62.5164 Constraint 88 421 8.3548 10.4436 15.6653 62.5032 Constraint 279 350 8.4097 10.5121 15.7681 62.4005 Constraint 122 314 9.6210 12.0262 18.0393 62.3995 Constraint 242 368 9.4277 11.7846 17.6769 62.3566 Constraint 104 449 8.7198 10.8998 16.3496 62.3045 Constraint 314 382 9.8948 12.3685 18.5528 62.2200 Constraint 297 391 10.3378 12.9222 19.3833 62.1985 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 242 449 7.4399 9.2999 13.9499 61.7590 Constraint 88 399 8.9705 11.2132 16.8197 61.7324 Constraint 136 292 10.2545 12.8181 19.2271 61.6037 Constraint 285 442 10.2361 12.7951 19.1927 61.5858 Constraint 153 322 10.9338 13.6673 20.5009 61.4742 Constraint 128 461 8.7765 10.9707 16.4560 61.3064 Constraint 128 449 5.9601 7.4502 11.1752 61.3064 Constraint 259 368 8.9430 11.1788 16.7682 61.3020 Constraint 169 449 6.5262 8.1578 12.2367 61.2411 Constraint 122 442 8.0352 10.0440 15.0660 61.1152 Constraint 360 435 10.9216 13.6519 20.4779 61.0672 Constraint 104 341 9.9979 12.4974 18.7460 61.0540 Constraint 88 429 8.4531 10.5664 15.8496 61.0118 Constraint 128 303 11.1430 13.9287 20.8931 60.8544 Constraint 88 169 10.4987 13.1234 19.6851 60.8496 Constraint 96 259 9.3114 11.6392 17.4589 60.7035 Constraint 128 429 9.5342 11.9177 17.8766 60.6080 Constraint 237 449 7.4832 9.3540 14.0310 60.5240 Constraint 201 449 8.7607 10.9509 16.4264 60.5240 Constraint 322 429 10.0963 12.6204 18.9306 60.3858 Constraint 122 435 9.8239 12.2798 18.4198 60.3555 Constraint 128 330 10.1969 12.7461 19.1192 60.1610 Constraint 259 429 10.1551 12.6938 19.0408 60.0863 Constraint 303 368 9.5185 11.8981 17.8471 60.0484 Constraint 201 412 10.6292 13.2864 19.9297 59.8110 Constraint 136 449 9.1917 11.4896 17.2344 59.7401 Constraint 360 442 10.5240 13.1550 19.7325 59.7338 Constraint 314 375 9.6365 12.0456 18.0684 59.7075 Constraint 104 242 10.8250 13.5313 20.2970 59.5598 Constraint 96 404 10.3791 12.9739 19.4608 59.5311 Constraint 128 259 9.8912 12.3640 18.5460 59.5006 Constraint 250 435 8.6842 10.8552 16.2829 59.4926 Constraint 322 449 9.0565 11.3206 16.9809 59.4867 Constraint 322 391 9.7155 12.1444 18.2165 59.4848 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 267 350 9.5640 11.9550 17.9325 59.4371 Constraint 404 467 8.3273 10.4091 15.6137 59.2132 Constraint 96 461 7.7945 9.7431 14.6146 59.2132 Constraint 96 449 5.9865 7.4831 11.2247 59.2132 Constraint 237 297 11.6701 14.5876 21.8814 59.2056 Constraint 399 461 8.5890 10.7362 16.1043 59.1449 Constraint 88 292 10.0542 12.5677 18.8516 59.0793 Constraint 201 435 10.9776 13.7220 20.5830 58.8233 Constraint 279 391 10.4490 13.0613 19.5920 58.4075 Constraint 104 442 10.8605 13.5757 20.3635 58.3774 Constraint 153 237 8.4655 10.5819 15.8728 58.2086 Constraint 161 442 10.2742 12.8428 19.2642 58.1362 Constraint 96 341 9.6214 12.0268 18.0401 58.0597 Constraint 113 449 8.4960 10.6200 15.9301 58.0524 Constraint 88 442 10.8555 13.5693 20.3540 57.9737 Constraint 128 412 10.7559 13.4449 20.1673 57.9191 Constraint 259 449 9.9164 12.3956 18.5933 57.6995 Constraint 136 297 11.1367 13.9209 20.8813 57.6655 Constraint 221 449 9.5207 11.9008 17.8513 57.6113 Constraint 242 375 10.7174 13.3967 20.0951 57.5713 Constraint 161 449 9.6908 12.1135 18.1702 57.4776 Constraint 176 421 10.8354 13.5443 20.3165 57.4690 Constraint 250 368 10.2717 12.8396 19.2594 57.4655 Constraint 201 314 11.4628 14.3285 21.4927 57.4600 Constraint 122 449 4.7874 5.9843 8.9765 57.4567 Constraint 399 467 8.7376 10.9220 16.3829 57.4260 Constraint 96 467 10.4238 13.0298 19.5447 57.4260 Constraint 221 360 10.1868 12.7335 19.1002 57.3118 Constraint 88 330 10.5982 13.2477 19.8716 57.1628 Constraint 190 421 10.7228 13.4035 20.1052 56.9121 Constraint 122 242 9.0369 11.2961 16.9441 56.9016 Constraint 153 429 9.8914 12.3643 18.5464 56.8479 Constraint 153 421 9.2888 11.6110 17.4165 56.8479 Constraint 96 350 8.8495 11.0619 16.5928 56.8453 Constraint 113 314 10.1911 12.7388 19.1082 56.8265 Constraint 96 237 9.8348 12.2935 18.4403 56.7881 Constraint 122 221 10.6902 13.3627 20.0441 56.7383 Constraint 144 322 10.9662 13.7077 20.5615 56.7220 Constraint 237 322 11.3263 14.1579 21.2368 56.3532 Constraint 226 435 10.6561 13.3201 19.9801 56.2442 Constraint 88 449 7.6015 9.5019 14.2528 56.2132 Constraint 113 429 10.8288 13.5360 20.3040 55.8708 Constraint 113 292 10.8349 13.5436 20.3154 55.6871 Constraint 259 350 8.7694 10.9617 16.4426 55.6744 Constraint 330 421 10.7598 13.4497 20.1745 55.5987 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 221 435 10.8296 13.5370 20.3055 55.4912 Constraint 122 467 8.9181 11.1476 16.7214 55.3635 Constraint 122 461 5.6204 7.0255 10.5383 55.3635 Constraint 128 285 10.6386 13.2983 19.9474 55.3564 Constraint 96 190 11.0939 13.8674 20.8011 55.3083 Constraint 80 330 8.5588 10.6984 16.0477 55.2772 Constraint 226 314 11.5439 14.4298 21.6448 55.2342 Constraint 104 461 10.2327 12.7909 19.1863 55.2279 Constraint 292 382 11.0373 13.7967 20.6950 55.2005 Constraint 104 285 11.1115 13.8894 20.8341 55.1037 Constraint 122 399 9.8709 12.3386 18.5079 55.0675 Constraint 88 461 7.2778 9.0972 13.6459 55.0217 Constraint 226 449 10.2887 12.8609 19.2914 54.9531 Constraint 322 442 10.2327 12.7908 19.1863 54.7967 Constraint 285 404 10.8523 13.5654 20.3481 54.5840 Constraint 267 360 10.0964 12.6205 18.9307 54.5190 Constraint 104 429 11.0890 13.8613 20.7919 54.5173 Constraint 210 461 9.8512 12.3139 18.4709 54.5142 Constraint 169 461 9.8059 12.2574 18.3861 54.5142 Constraint 250 360 10.6962 13.3702 20.0553 54.4751 Constraint 292 368 10.2361 12.7951 19.1926 54.3132 Constraint 272 391 10.7105 13.3881 20.0822 54.0913 Constraint 153 435 9.9517 12.4396 18.6594 53.8480 Constraint 421 480 10.3571 12.9464 19.4196 53.6219 Constraint 272 350 10.6719 13.3399 20.0098 53.4601 Constraint 122 412 10.8222 13.5278 20.2917 53.2856 Constraint 272 442 10.6522 13.3152 19.9728 53.2059 Constraint 128 435 10.6594 13.3243 19.9864 52.6271 Constraint 144 442 10.3348 12.9184 19.3777 52.5145 Constraint 412 473 8.5329 10.6662 15.9993 52.3177 Constraint 136 314 11.0714 13.8392 20.7588 52.2815 Constraint 96 391 8.8294 11.0368 16.5552 52.1638 Constraint 96 473 9.7923 12.2404 18.3606 52.1110 Constraint 96 355 9.8086 12.2607 18.3911 51.8731 Constraint 153 461 7.8545 9.8182 14.7273 51.8559 Constraint 153 449 5.6971 7.1214 10.6821 51.8559 Constraint 144 461 8.6075 10.7594 16.1391 51.8559 Constraint 144 449 7.8179 9.7724 14.6586 51.8559 Constraint 88 467 8.9040 11.1300 16.6950 51.8550 Constraint 153 292 10.5478 13.1847 19.7771 51.8500 Constraint 259 375 11.0465 13.8082 20.7123 51.6288 Constraint 182 350 10.7805 13.4756 20.2134 51.4947 Constraint 153 226 10.5868 13.2335 19.8502 51.4288 Constraint 182 391 10.9794 13.7243 20.5864 51.3913 Constraint 404 473 5.3588 6.6985 10.0477 51.3014 Constraint 80 341 10.5679 13.2099 19.8148 51.1591 Constraint 292 435 10.7219 13.4023 20.1035 50.9661 Constraint 226 391 10.8951 13.6189 20.4283 50.8842 Constraint 169 412 10.7102 13.3878 20.0817 50.8480 Constraint 136 421 10.9460 13.6825 20.5238 50.8104 Constraint 96 360 7.4454 9.3068 13.9601 50.3091 Constraint 360 449 10.1209 12.6511 18.9766 50.0571 Constraint 399 480 8.2521 10.3151 15.4727 49.9190 Constraint 279 421 10.8971 13.6214 20.4321 49.8257 Constraint 350 412 11.0778 13.8473 20.7710 49.6491 Constraint 80 297 11.1213 13.9016 20.8524 49.5420 Constraint 404 480 9.1584 11.4480 17.1721 49.5142 Constraint 399 473 4.9051 6.1314 9.1970 49.5142 Constraint 128 399 10.7648 13.4560 20.1840 49.4944 Constraint 250 429 10.4606 13.0757 19.6136 49.4872 Constraint 221 399 10.9090 13.6362 20.4543 49.4715 Constraint 259 355 10.8487 13.5609 20.3414 49.4012 Constraint 113 461 8.5515 10.6894 16.0340 49.2850 Constraint 136 442 10.9681 13.7101 20.5652 49.2160 Constraint 104 272 10.8902 13.6127 20.4191 49.0715 Constraint 242 461 10.3810 12.9763 19.4644 49.0280 Constraint 88 182 11.0117 13.7646 20.6470 48.8837 Constraint 153 242 9.9343 12.4179 18.6268 48.8558 Constraint 242 350 10.3924 12.9905 19.4857 48.7750 Constraint 279 360 10.0764 12.5955 18.8932 48.5299 Constraint 104 350 10.3982 12.9978 19.4967 48.2724 Constraint 80 449 10.5703 13.2129 19.8194 48.2366 Constraint 104 259 11.3919 14.2398 21.3598 47.9055 Constraint 113 330 11.1984 13.9980 20.9970 47.9030 Constraint 182 412 11.0825 13.8532 20.7797 47.9015 Constraint 80 292 11.0128 13.7660 20.6490 47.8843 Constraint 80 421 10.7794 13.4742 20.2113 47.7556 Constraint 221 429 10.9922 13.7402 20.6103 47.6683 Constraint 136 237 11.1589 13.9486 20.9229 47.3999 Constraint 136 461 10.6627 13.3284 19.9927 47.1443 Constraint 88 473 9.3278 11.6598 17.4897 47.1100 Constraint 122 473 9.9229 12.4036 18.6054 46.5449 Constraint 96 279 11.4466 14.3083 21.4624 46.4504 Constraint 250 449 10.4142 13.0177 19.5265 46.2112 Constraint 210 350 11.1054 13.8817 20.8226 45.8365 Constraint 292 404 10.6051 13.2564 19.8846 45.5871 Constraint 182 360 11.1334 13.9167 20.8751 45.5300 Constraint 221 350 10.4534 13.0668 19.6002 45.5061 Constraint 237 382 10.9455 13.6818 20.5228 45.3364 Constraint 322 412 10.6716 13.3395 20.0092 45.1045 Constraint 88 480 9.0401 11.3001 16.9502 44.9414 Constraint 136 221 11.5734 14.4668 21.7002 44.7870 Constraint 237 461 10.4162 13.0202 19.5303 43.7870 Constraint 104 190 10.9095 13.6369 20.4553 43.4190 Constraint 382 449 11.7177 14.6471 21.9706 43.3668 Constraint 242 473 10.7301 13.4126 20.1189 43.3275 Constraint 80 303 11.1370 13.9212 20.8818 43.3090 Constraint 314 473 10.6527 13.3159 19.9738 43.0073 Constraint 144 429 10.9751 13.7189 20.5783 42.2846 Constraint 144 421 10.7853 13.4816 20.2224 42.2846 Constraint 88 350 10.5929 13.2411 19.8617 42.2837 Constraint 136 330 11.3520 14.1900 21.2850 42.2663 Constraint 96 480 10.8271 13.5338 20.3008 41.7383 Constraint 88 360 9.0976 11.3719 17.0579 41.7361 Constraint 391 461 11.2671 14.0839 21.1259 41.1232 Constraint 80 461 10.5961 13.2451 19.8676 41.0452 Constraint 314 461 11.1484 13.9355 20.9033 40.9978 Constraint 80 350 10.4473 13.0591 19.5886 40.8786 Constraint 113 442 11.2376 14.0471 21.0706 40.6325 Constraint 169 250 11.2820 14.1025 21.1538 40.4699 Constraint 375 480 10.0903 12.6129 18.9194 40.1744 Constraint 190 449 11.1515 13.9394 20.9091 40.0510 Constraint 341 421 10.4702 13.0877 19.6316 39.9248 Constraint 382 473 9.0358 11.2947 16.9421 39.7696 Constraint 375 473 7.0909 8.8636 13.2955 39.7696 Constraint 267 368 10.5932 13.2415 19.8623 39.5300 Constraint 303 412 10.5969 13.2462 19.8693 39.3233 Constraint 285 375 10.6807 13.3509 20.0264 39.2192 Constraint 144 237 10.6340 13.2925 19.9387 39.1990 Constraint 330 391 11.0055 13.7569 20.6354 38.8695 Constraint 267 442 10.6949 13.3687 20.0530 38.8164 Constraint 122 404 11.1440 13.9300 20.8950 38.3075 Constraint 122 480 10.3853 12.9816 19.4725 38.2947 Constraint 80 360 10.4225 13.0282 19.5422 37.8079 Constraint 128 360 10.7101 13.3876 20.0814 37.7294 Constraint 104 360 10.0810 12.6013 18.9019 37.7294 Constraint 96 267 11.4575 14.3219 21.4829 37.5470 Constraint 429 489 6.4851 8.1064 12.1596 37.3601 Constraint 421 489 8.9595 11.1994 16.7991 37.3601 Constraint 104 399 10.7702 13.4627 20.1941 37.3263 Constraint 272 412 10.9374 13.6717 20.5076 37.2872 Constraint 360 473 8.8089 11.0112 16.5167 37.1987 Constraint 272 360 10.8885 13.6106 20.4159 36.7014 Constraint 80 399 11.1078 13.8848 20.8272 36.6356 Constraint 285 449 10.9524 13.6905 20.5357 36.4034 Constraint 122 297 11.4572 14.3215 21.4822 36.3596 Constraint 88 391 10.8601 13.5752 20.3627 36.0288 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 421 497 6.3341 7.9177 11.8765 35.0892 Constraint 122 360 10.4835 13.1044 19.6566 34.7295 Constraint 88 404 11.0862 13.8577 20.7866 34.7183 Constraint 128 391 10.8495 13.5618 20.3427 34.6113 Constraint 113 467 11.0825 13.8531 20.7796 34.3621 Constraint 391 473 8.3811 10.4764 15.7147 34.1966 Constraint 221 404 11.4844 14.3555 21.5332 33.8958 Constraint 128 489 10.6733 13.3417 20.0125 33.8425 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 80 182 11.3349 14.1687 21.2530 33.7071 Constraint 88 242 9.4682 11.8353 17.7530 33.4552 Constraint 88 355 10.1417 12.6772 19.0157 33.2838 Constraint 210 497 10.3590 12.9488 19.4232 33.2683 Constraint 435 497 8.5752 10.7191 16.0786 32.9959 Constraint 399 489 8.4371 10.5463 15.8195 32.9364 Constraint 96 368 10.4421 13.0526 19.5789 32.7567 Constraint 404 489 9.7088 12.1360 18.2040 32.5316 Constraint 314 435 10.0331 12.5414 18.8121 32.5135 Constraint 375 467 10.7043 13.3803 20.0705 32.3869 Constraint 80 355 10.7223 13.4029 20.1043 31.8787 Constraint 161 461 11.4511 14.3138 21.4707 31.7217 Constraint 153 467 11.2807 14.1009 21.1513 31.7217 Constraint 399 497 5.3938 6.7423 10.1134 31.6818 Constraint 368 473 9.3898 11.7373 17.6059 31.6256 Constraint 297 442 10.9148 13.6435 20.4653 31.6198 Constraint 153 412 11.3169 14.1461 21.2192 31.5532 Constraint 96 375 10.8361 13.5452 20.3177 31.4756 Constraint 96 497 6.2746 7.8432 11.7648 31.4751 Constraint 169 285 11.4697 14.3371 21.5057 31.4594 Constraint 412 497 9.0047 11.2559 16.8838 31.2770 Constraint 404 497 7.5289 9.4111 14.1167 31.2770 Constraint 80 210 11.2189 14.0236 21.0353 31.2388 Constraint 322 497 9.4809 11.8511 17.7766 31.1751 Constraint 314 497 8.5167 10.6459 15.9688 31.1751 Constraint 88 497 5.6890 7.1113 10.6669 31.1751 Constraint 122 489 7.5066 9.3833 14.0749 31.0878 Constraint 122 497 7.4785 9.3481 14.0222 30.6101 Constraint 292 497 10.6337 13.2921 19.9381 30.4316 Constraint 221 341 11.2711 14.0889 21.1333 30.2035 Constraint 355 473 10.9586 13.6982 20.5473 29.3451 Constraint 226 322 11.6020 14.5025 21.7537 29.3320 Constraint 128 473 10.9819 13.7274 20.5910 29.1732 Constraint 122 391 10.9019 13.6274 20.4411 29.0404 Constraint 279 355 10.4437 13.0547 19.5820 28.7895 Constraint 161 292 11.6871 14.6088 21.9132 28.6782 Constraint 330 399 9.9048 12.3810 18.5715 28.2020 Constraint 122 259 10.3202 12.9002 19.3503 27.8901 Constraint 104 237 10.7361 13.4201 20.1302 27.8019 Constraint 360 480 11.1444 13.9305 20.8957 27.7667 Constraint 412 489 11.4361 14.2951 21.4427 27.7112 Constraint 104 497 8.9656 11.2070 16.8104 27.6953 Constraint 285 429 10.2770 12.8463 19.2694 27.6876 Constraint 210 341 11.2812 14.1015 21.1523 27.6035 Constraint 104 489 10.8008 13.5010 20.2516 27.4316 Constraint 113 489 9.2293 11.5367 17.3050 27.3025 Constraint 297 399 10.2321 12.7901 19.1852 27.1001 Constraint 322 461 10.5571 13.1963 19.7945 26.9066 Constraint 421 511 9.2090 11.5112 17.2668 26.7157 Constraint 176 330 11.5599 14.4499 21.6749 26.6904 Constraint 360 461 10.6879 13.3599 20.0398 26.5632 Constraint 128 497 8.9174 11.1467 16.7201 26.4809 Constraint 355 497 9.3580 11.6976 17.5463 26.3547 Constraint 350 497 10.8015 13.5018 20.2527 26.3547 Constraint 242 497 9.8453 12.3066 18.4600 26.3416 Constraint 267 382 11.2725 14.0906 21.1359 26.2193 Constraint 399 511 6.6596 8.3245 12.4867 26.1224 Constraint 350 429 11.1040 13.8800 20.8201 25.8869 Constraint 429 511 7.4598 9.3247 13.9871 25.7176 Constraint 96 511 9.5073 11.8841 17.8262 25.6157 Constraint 88 511 8.2671 10.3339 15.5008 25.6157 Constraint 128 267 11.7169 14.6462 21.9693 25.5534 Constraint 80 489 10.0358 12.5448 18.8172 25.4674 Constraint 201 429 11.4202 14.2752 21.4128 25.3480 Constraint 88 341 10.9756 13.7194 20.5792 24.9348 Constraint 96 226 11.1516 13.9395 20.9092 24.8521 Constraint 404 511 8.7727 10.9659 16.4488 24.7013 Constraint 322 404 10.1139 12.6424 18.9636 24.6669 Constraint 104 355 11.4030 14.2537 21.3806 24.4581 Constraint 144 489 10.3351 12.9188 19.3782 24.3968 Constraint 314 511 10.6304 13.2880 19.9319 24.2823 Constraint 221 382 11.0458 13.8072 20.7108 24.2150 Constraint 303 382 10.1829 12.7286 19.0929 24.1949 Constraint 169 497 11.1949 13.9936 20.9904 23.8226 Constraint 113 497 8.3937 10.4921 15.7382 23.8226 Constraint 368 442 11.8091 14.7613 22.1420 23.5470 Constraint 237 360 10.8319 13.5398 20.3098 23.4294 Constraint 435 511 10.9526 13.6907 20.5361 23.0594 Constraint 297 412 10.7638 13.4547 20.1821 22.9876 Constraint 80 497 8.4564 10.5705 15.8558 22.8944 Constraint 144 467 11.3850 14.2312 21.3468 22.7217 Constraint 355 511 9.0933 11.3667 17.0500 22.2986 Constraint 303 375 9.6162 12.0202 18.0304 22.2274 Constraint 210 382 11.1519 13.9399 20.9098 22.1831 Constraint 391 497 8.8155 11.0193 16.5290 21.9372 Constraint 153 497 10.3129 12.8911 19.3367 21.8259 Constraint 144 497 9.9762 12.4702 18.7054 21.8259 Constraint 136 497 11.0062 13.7577 20.6366 21.8259 Constraint 153 489 10.7132 13.3915 20.0873 21.7294 Constraint 221 368 10.8051 13.5064 20.2596 21.6210 Constraint 88 303 11.0027 13.7533 20.6300 21.6149 Constraint 355 429 11.0267 13.7834 20.6751 21.1594 Constraint 113 399 10.9446 13.6807 20.5211 21.0385 Constraint 104 279 11.8208 14.7760 22.1639 20.9009 Constraint 113 242 10.0689 12.5861 18.8792 20.8904 Constraint 80 169 11.4478 14.3097 21.4646 20.8071 Constraint 128 279 11.8393 14.7991 22.1986 20.6333 Constraint 382 497 10.3360 12.9200 19.3799 20.6209 Constraint 375 497 8.6709 10.8386 16.2580 20.6209 Constraint 368 497 10.2157 12.7696 19.1544 20.6209 Constraint 360 497 7.4553 9.3191 13.9787 20.6209 Constraint 104 391 10.8491 13.5613 20.3420 20.6095 Constraint 88 435 10.8599 13.5749 20.3624 20.5780 Constraint 182 429 10.7561 13.4452 20.1678 20.3896 Constraint 279 368 10.9754 13.7193 20.5790 20.1447 Constraint 88 176 11.4915 14.3643 21.5465 20.0706 Constraint 391 511 10.3516 12.9395 19.4092 19.9576 Constraint 360 511 8.8341 11.0427 16.5640 19.9576 Constraint 169 267 11.6389 14.5486 21.8229 19.9392 Constraint 250 375 11.0809 13.8511 20.7766 19.8491 Constraint 267 355 10.7588 13.4485 20.1728 19.7895 Constraint 128 467 10.8773 13.5966 20.3949 19.6545 Constraint 279 412 11.1718 13.9647 20.9471 19.5197 Constraint 144 292 11.6428 14.5535 21.8303 19.1985 Constraint 303 404 9.4162 11.7703 17.6554 19.0939 Constraint 88 412 10.8809 13.6012 20.4017 19.0695 Constraint 292 375 11.2155 14.0193 21.0290 18.8198 Constraint 122 226 9.3756 11.7196 17.5793 18.8021 Constraint 113 237 9.4885 11.8606 17.7909 18.8021 Constraint 303 429 8.7989 10.9987 16.4980 18.6558 Constraint 297 429 9.6424 12.0530 18.0795 18.6558 Constraint 375 511 8.0681 10.0851 15.1277 18.6241 Constraint 368 511 10.4191 13.0238 19.5357 18.6241 Constraint 297 449 9.9191 12.3989 18.5983 18.3206 Constraint 113 201 10.4435 13.0544 19.5816 18.2238 Constraint 292 461 11.1804 13.9755 20.9633 18.2205 Constraint 190 412 11.1958 13.9947 20.9921 18.1645 Constraint 449 519 10.5041 13.1301 19.6952 18.1430 Constraint 267 399 11.1324 13.9155 20.8732 18.1279 Constraint 96 382 10.8708 13.5885 20.3827 18.0568 Constraint 128 250 11.4377 14.2972 21.4458 17.8945 Constraint 322 435 10.6532 13.3164 19.9747 17.8287 Constraint 96 250 10.8180 13.5225 20.2838 17.8106 Constraint 80 511 10.3755 12.9694 19.4541 17.4948 Constraint 136 242 11.2820 14.1025 21.1538 17.4890 Constraint 391 467 11.5849 14.4812 21.7217 17.4717 Constraint 314 489 10.4441 13.0551 19.5827 17.3437 Constraint 375 461 11.4831 14.3539 21.5309 17.1438 Constraint 122 190 10.1002 12.6253 18.9379 17.0247 Constraint 122 519 10.2606 12.8258 19.2386 16.9576 Constraint 96 519 9.7254 12.1568 18.2352 16.9576 Constraint 88 519 8.0895 10.1118 15.1677 16.9576 Constraint 382 511 10.9534 13.6918 20.5376 16.9576 Constraint 272 449 11.3020 14.1275 21.1912 16.8594 Constraint 136 272 11.5227 14.4033 21.6050 16.5012 Constraint 375 489 11.0757 13.8446 20.7669 16.3551 Constraint 122 511 9.5380 11.9225 17.8837 16.1700 Constraint 113 511 11.1552 13.9440 20.9160 16.1700 Constraint 399 519 8.9120 11.1401 16.7101 16.1480 Constraint 242 341 11.1320 13.9150 20.8724 16.1324 Constraint 429 519 8.6228 10.7785 16.1678 16.0432 Constraint 412 511 10.8278 13.5347 20.3021 16.0431 Constraint 201 391 11.2331 14.0414 21.0621 15.8928 Constraint 113 480 11.4362 14.2953 21.4430 15.8852 Constraint 113 297 11.6776 14.5970 21.8955 15.7966 Constraint 429 527 7.8000 9.7499 14.6249 15.7785 Constraint 421 527 8.1705 10.2131 15.3196 15.7785 Constraint 161 322 11.4500 14.3124 21.4687 15.7499 Constraint 80 519 10.8921 13.6151 20.4227 15.7432 Constraint 210 473 10.7547 13.4434 20.1650 15.3970 Constraint 144 242 10.7948 13.4935 20.2402 15.2015 Constraint 285 435 10.4602 13.0752 19.6128 15.1468 Constraint 122 250 10.3591 12.9489 19.4233 14.9946 Constraint 80 153 11.5835 14.4794 21.7191 14.9821 Constraint 128 350 10.5500 13.1875 19.7812 14.9756 Constraint 360 467 11.3468 14.1835 21.2753 14.9019 Constraint 360 489 9.8436 12.3045 18.4568 14.7841 Constraint 259 497 10.9810 13.7263 20.5894 14.7686 Constraint 375 442 11.8881 14.8601 22.2901 14.7035 Constraint 169 330 11.3464 14.1831 21.2746 14.5304 Constraint 421 535 9.3680 11.7101 17.5651 14.4620 Constraint 322 511 11.7371 14.6714 22.0071 14.2311 Constraint 399 527 7.4660 9.3325 13.9988 14.1644 Constraint 449 527 7.9650 9.9562 14.9343 14.1450 Constraint 122 527 8.1216 10.1520 15.2280 13.9577 Constraint 88 527 7.0190 8.7738 13.1607 13.9577 Constraint 303 442 10.3832 12.9789 19.4684 13.9359 Constraint 242 467 11.5760 14.4701 21.7051 13.8097 Constraint 122 285 10.9071 13.6339 20.4509 13.7971 Constraint 88 237 8.0795 10.0994 15.1491 13.7171 Constraint 297 368 11.2571 14.0713 21.1070 13.6453 Constraint 242 355 10.9935 13.7419 20.6128 13.4545 Constraint 210 368 10.9071 13.6339 20.4509 13.3218 Constraint 128 341 10.0723 12.5904 18.8856 13.1865 Constraint 113 473 11.4735 14.3419 21.5128 12.9803 Constraint 599 668 10.8259 13.5324 20.2985 12.8471 Constraint 449 535 10.5389 13.1736 19.7605 12.8285 Constraint 461 535 9.5576 11.9470 17.9205 12.8122 Constraint 190 330 11.6339 14.5424 21.8136 12.7643 Constraint 429 629 9.1132 11.3915 17.0873 12.7554 Constraint 330 429 9.7629 12.2036 18.3054 12.7531 Constraint 404 604 8.7244 10.9056 16.3583 12.7400 Constraint 88 201 10.1584 12.6980 19.0470 12.7007 Constraint 88 297 10.6804 13.3505 20.0257 12.6252 Constraint 322 527 8.6280 10.7850 16.1775 12.6242 Constraint 128 527 10.1410 12.6762 19.0144 12.6242 Constraint 104 527 9.8768 12.3460 18.5189 12.6242 Constraint 96 527 7.0122 8.7652 13.1479 12.6242 Constraint 429 604 6.9560 8.6950 13.0426 12.4221 Constraint 429 622 9.3040 11.6300 17.4450 12.3936 Constraint 429 613 8.3094 10.3867 15.5801 12.3936 Constraint 303 577 10.1209 12.6511 18.9766 12.3419 Constraint 421 629 9.2913 11.6141 17.4212 12.3284 Constraint 421 519 9.8136 12.2669 18.4004 12.2208 Constraint 314 599 8.8911 11.1139 16.6708 12.1323 Constraint 421 604 7.9162 9.8952 14.8428 11.9951 Constraint 153 259 11.3588 14.1985 21.2977 11.9885 Constraint 80 480 11.6927 14.6159 21.9238 11.9794 Constraint 80 473 11.7838 14.7298 22.0947 11.9794 Constraint 404 622 9.7024 12.1279 18.1919 11.9243 Constraint 404 613 9.5449 11.9312 17.8967 11.9243 Constraint 399 613 9.8897 12.3621 18.5431 11.9243 Constraint 113 350 11.1604 13.9505 20.9258 11.9008 Constraint 80 429 10.6786 13.3482 20.0224 11.9007 Constraint 88 375 10.6110 13.2637 19.8956 11.8450 Constraint 80 527 9.4109 11.7636 17.6454 11.8146 Constraint 391 489 10.9131 13.6413 20.4620 11.7842 Constraint 285 497 11.3346 14.1682 21.2523 11.7687 Constraint 210 489 11.1148 13.8935 20.8403 11.6855 Constraint 355 489 11.2316 14.0394 21.0592 11.6854 Constraint 80 467 11.6068 14.5086 21.7628 11.5634 Constraint 382 467 11.4369 14.2962 21.4442 11.5600 Constraint 279 399 10.9034 13.6293 20.4439 11.5482 Constraint 303 449 10.3717 12.9646 19.4469 11.5347 Constraint 412 480 11.7020 14.6274 21.9412 11.4544 Constraint 341 429 9.7266 12.1583 18.2374 11.4502 Constraint 404 599 7.7848 9.7310 14.5966 11.4298 Constraint 473 604 7.2151 9.0188 13.5282 11.3648 Constraint 330 449 10.2610 12.8263 19.2394 11.3293 Constraint 237 368 10.9131 13.6413 20.4620 11.3216 Constraint 350 473 9.6058 12.0072 18.0108 11.2677 Constraint 341 404 9.8839 12.3549 18.5323 11.2283 Constraint 429 535 8.4224 10.5281 15.7921 11.2228 Constraint 322 604 7.5479 9.4349 14.1524 11.1067 Constraint 314 604 8.3518 10.4397 15.6595 11.1067 Constraint 190 391 11.5441 14.4301 21.6452 11.0558 Constraint 480 629 8.7687 10.9609 16.4414 11.0028 Constraint 590 657 10.8597 13.5747 20.3620 10.9644 Constraint 399 604 8.1658 10.2072 15.3108 10.9528 Constraint 391 604 10.2272 12.7840 19.1760 10.9374 Constraint 404 535 9.3585 11.6981 17.5472 10.9228 Constraint 604 676 11.0501 13.8126 20.7190 10.8961 Constraint 350 511 10.3445 12.9306 19.3959 10.8888 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 122 272 10.8105 13.5131 20.2696 10.8052 Constraint 113 221 11.2336 14.0420 21.0629 10.8052 Constraint 88 285 8.7101 10.8876 16.3314 10.8052 Constraint 88 259 7.3254 9.1567 13.7351 10.8052 Constraint 88 250 8.5176 10.6469 15.9704 10.8052 Constraint 88 221 8.4755 10.5943 15.8915 10.8052 Constraint 360 535 7.3021 9.1276 13.6914 10.8038 Constraint 461 599 9.4613 11.8266 17.7398 10.7937 Constraint 412 622 10.5881 13.2351 19.8526 10.7432 Constraint 113 360 10.4841 13.1051 19.6577 10.7406 Constraint 201 461 11.4323 14.2904 21.4355 10.7348 Constraint 341 577 10.0625 12.5781 18.8672 10.6843 Constraint 322 489 9.6745 12.0931 18.1397 10.6823 Constraint 391 590 10.0199 12.5249 18.7874 10.6273 Constraint 303 435 9.5642 11.9552 17.9328 10.5714 Constraint 355 480 11.2041 14.0052 21.0078 10.5562 Constraint 629 706 10.9764 13.7205 20.5807 10.4756 Constraint 429 585 9.9663 12.4579 18.6868 10.4605 Constraint 429 599 7.0253 8.7816 13.1724 10.4452 Constraint 421 599 7.0454 8.8068 13.2102 10.4452 Constraint 421 590 9.7208 12.1511 18.2266 10.4452 Constraint 412 599 8.3951 10.4939 15.7409 10.4452 Constraint 404 590 8.7980 10.9975 16.4963 10.4135 Constraint 467 604 7.5563 9.4454 14.1680 10.3667 Constraint 113 519 10.6295 13.2869 19.9303 10.1701 Constraint 360 599 8.4740 10.5925 15.8887 10.0901 Constraint 480 585 7.2784 9.0980 13.6470 10.0816 Constraint 404 519 10.4721 13.0901 19.6352 10.0432 Constraint 399 535 6.0528 7.5660 11.3490 9.9942 Constraint 412 629 9.9433 12.4291 18.6436 9.9682 Constraint 391 599 8.1825 10.2281 15.3421 9.9605 Constraint 382 599 9.3709 11.7136 17.5704 9.9605 Constraint 435 527 9.2264 11.5330 17.2994 9.9417 Constraint 412 527 9.1041 11.3801 17.0702 9.9417 Constraint 322 599 9.0329 11.2912 16.9368 9.9394 Constraint 210 604 6.7710 8.4638 12.6957 9.9202 Constraint 182 604 8.8883 11.1104 16.6656 9.9202 Constraint 461 585 9.9019 12.3774 18.5661 9.8707 Constraint 69 497 5.1329 6.4161 9.6242 9.8353 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 467 10.9775 13.7219 20.5829 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 449 9.2700 11.5876 17.3813 9.8353 Constraint 69 210 10.9415 13.6768 20.5153 9.8353 Constraint 467 613 10.0130 12.5163 18.7744 9.7938 Constraint 467 599 8.5578 10.6973 16.0460 9.7938 Constraint 467 590 9.9819 12.4773 18.7160 9.7938 Constraint 467 585 8.5179 10.6474 15.9711 9.7938 Constraint 473 629 7.0993 8.8741 13.3112 9.7919 Constraint 473 622 8.8626 11.0783 16.6174 9.7919 Constraint 113 259 11.2560 14.0700 21.1051 9.7889 Constraint 88 226 9.9281 12.4101 18.6151 9.7889 Constraint 375 535 7.6801 9.6002 14.4003 9.7875 Constraint 322 535 10.2675 12.8344 19.2515 9.7875 Constraint 314 535 8.6973 10.8716 16.3074 9.7875 Constraint 96 535 9.4754 11.8443 17.7664 9.7875 Constraint 421 622 9.5719 11.9649 17.9473 9.7529 Constraint 404 527 8.8396 11.0495 16.5742 9.7432 Constraint 314 629 11.2033 14.0042 21.0063 9.7057 Constraint 322 613 10.2262 12.7828 19.1742 9.6935 Constraint 412 604 9.1757 11.4696 17.2044 9.6350 Constraint 375 519 10.4509 13.0637 19.5955 9.6242 Constraint 360 527 6.7205 8.4006 12.6010 9.6242 Constraint 480 604 6.3188 7.8985 11.8478 9.5777 Constraint 480 613 8.1995 10.2493 15.3740 9.5613 Constraint 557 629 10.8904 13.6130 20.4194 9.5538 Constraint 330 577 10.4785 13.0981 19.6471 9.5384 Constraint 176 604 9.4772 11.8465 17.7697 9.5154 Constraint 404 585 10.2766 12.8458 19.2687 9.4452 Constraint 429 590 8.1800 10.2249 15.3374 9.4289 Constraint 421 613 9.3320 11.6650 17.4976 9.4196 Constraint 480 599 8.2758 10.3448 15.5172 9.4095 Constraint 399 599 6.7817 8.4771 12.7156 9.3807 Constraint 461 604 8.9683 11.2104 16.8156 9.3668 Constraint 391 527 8.2269 10.2836 15.4255 9.1373 Constraint 577 657 10.1055 12.6319 18.9478 9.1268 Constraint 399 590 8.0835 10.1044 15.1565 9.0311 Constraint 467 629 8.7295 10.9118 16.3678 9.0066 Constraint 88 599 10.6604 13.3255 19.9883 8.9881 Constraint 153 314 11.0812 13.8515 20.7773 8.9804 Constraint 382 604 10.9909 13.7386 20.6080 8.9605 Constraint 382 590 10.3060 12.8825 19.3237 8.9442 Constraint 375 590 8.6890 10.8613 16.2919 8.9442 Constraint 368 590 10.0019 12.5024 18.7536 8.9442 Constraint 360 590 9.3545 11.6931 17.5397 8.9442 Constraint 360 604 10.0319 12.5399 18.8098 8.9288 Constraint 88 368 11.1265 13.9081 20.8622 8.9202 Constraint 292 489 11.1763 13.9704 20.9556 8.8807 Constraint 122 330 11.0496 13.8120 20.7180 8.8649 Constraint 69 412 11.0216 13.7770 20.6655 8.8530 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 88 604 10.2446 12.8058 19.2087 8.8452 Constraint 182 399 10.6942 13.3677 20.0516 8.8113 Constraint 473 599 6.3405 7.9256 11.8884 8.7919 Constraint 473 585 7.3218 9.1522 13.7283 8.7775 Constraint 322 590 10.5457 13.1821 19.7731 8.7250 Constraint 303 599 11.1668 13.9585 20.9377 8.7250 Constraint 182 622 11.4161 14.2701 21.4052 8.7160 Constraint 322 629 9.8702 12.3378 18.5066 8.7057 Constraint 292 604 7.8768 9.8460 14.7689 8.7057 Constraint 259 473 11.4644 14.3305 21.4958 8.7056 Constraint 341 412 9.9563 12.4454 18.6681 8.6573 Constraint 435 629 9.3794 11.7242 17.5864 8.6503 Constraint 350 449 10.8965 13.6206 20.4310 8.6473 Constraint 442 527 8.5808 10.7261 16.0891 8.6083 Constraint 480 622 9.6058 12.0073 18.0109 8.5777 Constraint 250 350 11.6238 14.5297 21.7946 8.5730 Constraint 382 461 11.7507 14.6883 22.0325 8.5730 Constraint 355 519 8.3103 10.3878 15.5817 8.5730 Constraint 226 429 11.5844 14.4805 21.7207 8.5364 Constraint 201 604 8.6062 10.7578 16.1366 8.5275 Constraint 604 698 10.6979 13.3723 20.0585 8.4775 Constraint 604 687 10.1169 12.6461 18.9692 8.4775 Constraint 435 599 9.5751 11.9689 17.9533 8.4606 Constraint 153 527 10.5372 13.1715 19.7573 8.3846 Constraint 449 604 10.1550 12.6938 19.0407 8.3546 Constraint 473 613 8.0398 10.0497 15.0746 8.3505 Constraint 489 599 10.1966 12.7457 19.1186 8.3207 Constraint 599 698 10.9525 13.6907 20.5360 8.3094 Constraint 599 687 9.8595 12.3243 18.4865 8.3094 Constraint 272 355 11.4584 14.3229 21.4844 8.2627 Constraint 144 552 10.5911 13.2389 19.8584 8.2363 Constraint 435 535 10.4008 13.0010 19.5014 8.2228 Constraint 144 527 9.1182 11.3978 17.0967 8.1702 Constraint 176 412 11.3368 14.1711 21.2566 8.1440 Constraint 242 622 8.2205 10.2756 15.4134 8.1330 Constraint 237 622 5.5461 6.9326 10.3989 8.1330 Constraint 210 622 7.2815 9.1019 13.6529 8.1330 Constraint 391 519 10.6288 13.2860 19.9290 8.1209 Constraint 360 519 8.8336 11.0420 16.5630 8.1209 Constraint 242 535 10.3394 12.9242 19.3863 8.1209 Constraint 242 527 9.1051 11.3814 17.0721 8.1209 Constraint 237 473 11.8648 14.8310 22.2466 8.0912 Constraint 161 242 11.6576 14.5720 21.8580 8.0000 Constraint 368 599 8.4425 10.5531 15.8297 7.9759 Constraint 404 629 7.5461 9.4327 14.1490 7.9596 Constraint 375 604 9.0556 11.3195 16.9793 7.9442 Constraint 292 599 8.1619 10.2024 15.3036 7.9432 Constraint 210 599 6.2021 7.7526 11.6288 7.9432 Constraint 182 599 8.6422 10.8027 16.2041 7.9432 Constraint 412 535 9.5794 11.9742 17.9613 7.9228 Constraint 69 242 11.2930 14.1162 21.1743 7.9062 Constraint 473 552 10.2672 12.8340 19.2509 7.9009 Constraint 237 497 11.5777 14.4721 21.7081 7.8960 Constraint 221 355 11.7625 14.7032 22.0547 7.8954 Constraint 88 267 10.6743 13.3429 20.0144 7.8949 Constraint 169 391 10.9577 13.6971 20.5457 7.8629 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 237 604 7.9192 9.8990 14.8485 7.8119 Constraint 657 735 10.6937 13.3671 20.0506 7.8108 Constraint 391 535 8.0297 10.0371 15.0556 7.8038 Constraint 355 535 6.2150 7.7687 11.6530 7.8038 Constraint 355 527 7.2573 9.0717 13.6075 7.8038 Constraint 350 527 8.2521 10.3151 15.4726 7.8038 Constraint 341 535 11.0303 13.7878 20.6818 7.8038 Constraint 467 622 10.4079 13.0099 19.5148 7.7939 Constraint 461 629 9.6422 12.0528 18.0791 7.7939 Constraint 330 497 11.3332 14.1665 21.2497 7.7675 Constraint 136 429 11.4323 14.2904 21.4356 7.7604 Constraint 176 303 11.8576 14.8220 22.2329 7.7399 Constraint 292 622 10.7554 13.4443 20.1664 7.7282 Constraint 259 622 11.0070 13.7588 20.6382 7.7282 Constraint 250 622 10.3527 12.9409 19.4114 7.7282 Constraint 237 613 8.0272 10.0340 15.0510 7.7282 Constraint 226 622 9.0967 11.3709 17.0564 7.7282 Constraint 221 622 10.3385 12.9231 19.3847 7.7282 Constraint 210 613 7.8764 9.8455 14.7682 7.7282 Constraint 201 622 7.5784 9.4730 14.2095 7.7282 Constraint 201 613 9.8964 12.3705 18.5558 7.7282 Constraint 190 604 10.6091 13.2614 19.8921 7.7282 Constraint 176 622 10.7279 13.4099 20.1149 7.7282 Constraint 210 629 6.1498 7.6872 11.5308 7.7179 Constraint 169 489 11.8848 14.8560 22.2840 7.6642 Constraint 552 622 11.1482 13.9353 20.9029 7.6607 Constraint 399 585 8.6944 10.8680 16.3020 7.6580 Constraint 435 604 8.5093 10.6367 15.9550 7.6503 Constraint 169 604 8.1601 10.2001 15.3001 7.6331 Constraint 360 585 9.5800 11.9750 17.9625 7.6263 Constraint 303 552 10.3788 12.9735 19.4602 7.5740 Constraint 629 720 11.4430 14.3037 21.4556 7.5692 Constraint 629 713 10.6751 13.3439 20.0158 7.5692 Constraint 161 421 11.0945 13.8681 20.8022 7.5629 Constraint 585 657 10.3817 12.9771 19.4657 7.5557 Constraint 279 577 10.4570 13.0713 19.6069 7.5423 Constraint 176 599 9.2430 11.5538 17.3307 7.5384 Constraint 341 604 10.9449 13.6812 20.5217 7.5116 Constraint 182 435 11.1363 13.9204 20.8805 7.5113 Constraint 421 585 10.5917 13.2396 19.8594 7.4606 Constraint 144 535 9.3839 11.7299 17.5948 7.4267 Constraint 322 467 11.3310 14.1637 21.2456 7.3602 Constraint 330 461 11.5586 14.4483 21.6724 7.2919 Constraint 279 442 11.4941 14.3676 21.5514 7.2627 Constraint 88 585 10.2695 12.8368 19.2553 7.2490 Constraint 644 720 11.5476 14.4344 21.6517 7.2378 Constraint 242 330 11.7306 14.6632 21.9948 7.1664 Constraint 461 552 9.4034 11.7542 17.6313 7.0932 Constraint 489 604 9.2741 11.5927 17.3890 7.0840 Constraint 136 527 10.8612 13.5765 20.3648 7.0512 Constraint 113 527 6.8302 8.5378 12.8067 7.0512 Constraint 80 242 9.0879 11.3598 17.0397 7.0153 Constraint 442 622 7.2932 9.1165 13.6748 7.0079 Constraint 242 604 7.3116 9.1396 13.7093 7.0023 Constraint 104 511 11.8616 14.8270 22.2405 6.9916 Constraint 480 636 7.5827 9.4784 14.2175 6.9903 Constraint 467 636 9.4404 11.8005 17.7008 6.9903 Constraint 429 636 9.9775 12.4719 18.7079 6.9750 Constraint 375 599 6.4431 8.0539 12.0808 6.9596 Constraint 375 585 9.3838 11.7298 17.5947 6.9596 Constraint 330 604 9.2492 11.5615 17.3423 6.9186 Constraint 314 613 9.5004 11.8754 17.8132 6.9186 Constraint 303 604 9.9661 12.4577 18.6865 6.9186 Constraint 297 604 8.7965 10.9956 16.4934 6.9186 Constraint 292 629 9.0597 11.3246 16.9869 6.9186 Constraint 292 613 10.1483 12.6854 19.0281 6.9186 Constraint 272 629 10.5541 13.1926 19.7889 6.9186 Constraint 272 604 10.2624 12.8280 19.2419 6.9186 Constraint 259 613 11.4374 14.2967 21.4451 6.9186 Constraint 242 613 8.5151 10.6439 15.9658 6.9186 Constraint 221 629 8.9446 11.1808 16.7712 6.9186 Constraint 221 613 11.4558 14.3198 21.4797 6.9186 Constraint 190 629 8.8907 11.1133 16.6700 6.9186 Constraint 182 629 8.5058 10.6323 15.9485 6.9186 Constraint 182 613 11.5669 14.4587 21.6880 6.9186 Constraint 176 629 7.6662 9.5828 14.3741 6.9186 Constraint 104 519 11.7616 14.7020 22.0530 6.9065 Constraint 210 467 10.3746 12.9682 19.4524 6.9031 Constraint 473 577 8.4748 10.5936 15.8903 6.8967 Constraint 467 577 8.4751 10.5939 15.8908 6.8967 Constraint 461 577 8.6836 10.8545 16.2817 6.8967 Constraint 88 190 11.2118 14.0147 21.0221 6.8786 Constraint 69 382 10.9036 13.6295 20.4442 6.8531 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 69 136 11.8420 14.8026 22.2038 6.8354 Constraint 449 599 8.9915 11.2393 16.8590 6.7939 Constraint 382 527 9.6385 12.0481 18.0722 6.7875 Constraint 341 527 8.9465 11.1831 16.7747 6.7875 Constraint 341 519 10.6890 13.3612 20.0418 6.7875 Constraint 330 527 9.1345 11.4181 17.1272 6.7875 Constraint 330 489 10.9966 13.7458 20.6187 6.7875 Constraint 322 519 9.2756 11.5945 17.3917 6.7875 Constraint 314 527 5.3157 6.6447 9.9670 6.7875 Constraint 314 519 8.5039 10.6299 15.9448 6.7875 Constraint 303 527 9.4890 11.8612 17.7918 6.7875 Constraint 297 527 9.9482 12.4353 18.6530 6.7875 Constraint 292 527 7.8984 9.8730 14.8095 6.7875 Constraint 285 527 10.0309 12.5387 18.8080 6.7875 Constraint 259 527 9.4405 11.8006 17.7010 6.7875 Constraint 221 527 9.9513 12.4391 18.6587 6.7875 Constraint 210 527 8.8065 11.0081 16.5121 6.7875 Constraint 182 527 11.1923 13.9903 20.9855 6.7875 Constraint 473 636 8.0893 10.1117 15.1675 6.7775 Constraint 473 590 6.7083 8.3854 12.5781 6.7775 Constraint 226 604 10.1803 12.7254 19.0881 6.7404 Constraint 322 585 8.7301 10.9127 16.3690 6.7403 Constraint 297 599 9.8936 12.3670 18.5505 6.7288 Constraint 169 599 8.7472 10.9340 16.4010 6.6408 Constraint 297 435 9.5767 11.9709 17.9564 6.6156 Constraint 297 382 10.8040 13.5050 20.2575 6.6043 Constraint 368 535 6.7314 8.4143 12.6214 6.5894 Constraint 350 535 8.2245 10.2806 15.4209 6.5894 Constraint 489 629 9.1735 11.4668 17.2003 6.5841 Constraint 651 729 11.6905 14.6131 21.9196 6.5711 Constraint 292 473 9.8835 12.3544 18.5316 6.5622 Constraint 341 552 10.3358 12.9197 19.3796 6.5576 Constraint 330 552 9.5099 11.8874 17.8310 6.5576 Constraint 297 552 11.1116 13.8895 20.8343 6.5576 Constraint 279 552 11.8258 14.7823 22.1735 6.5576 Constraint 497 577 9.6883 12.1104 18.1655 6.5535 Constraint 412 590 8.8280 11.0350 16.5525 6.4549 Constraint 182 473 9.9456 12.4320 18.6479 6.4513 Constraint 435 622 8.2862 10.3577 15.5366 6.4350 Constraint 480 590 7.4438 9.3048 13.9572 6.3932 Constraint 113 190 11.2955 14.1194 21.1791 6.3785 Constraint 221 604 8.6602 10.8252 16.2378 6.3356 Constraint 104 535 10.0305 12.5381 18.8072 6.3076 Constraint 144 226 10.6249 13.2812 19.9218 6.1990 Constraint 144 221 11.3069 14.1337 21.2005 6.1990 Constraint 535 604 10.5012 13.1265 19.6897 6.1986 Constraint 221 599 7.4811 9.3513 14.0270 6.1561 Constraint 201 599 7.3043 9.1304 13.6956 6.1561 Constraint 190 599 9.1083 11.3854 17.0780 6.1561 Constraint 355 599 8.8097 11.0121 16.5182 6.1526 Constraint 368 651 9.5549 11.9436 17.9154 6.1363 Constraint 341 497 10.5883 13.2354 19.8531 6.1124 Constraint 467 544 9.6385 12.0481 18.0721 6.1096 Constraint 489 585 9.9037 12.3796 18.5694 6.1063 Constraint 467 552 9.9413 12.4266 18.6399 6.0932 Constraint 442 629 7.5537 9.4421 14.1631 6.0201 Constraint 375 449 11.8070 14.7587 22.1381 5.9999 Constraint 399 629 6.6990 8.3737 12.5606 5.9904 Constraint 399 622 7.9379 9.9223 14.8835 5.9904 Constraint 391 622 10.5615 13.2019 19.8029 5.9904 Constraint 382 629 8.0709 10.0886 15.1329 5.9904 Constraint 382 622 9.2868 11.6085 17.4128 5.9904 Constraint 375 636 8.4615 10.5769 15.8654 5.9904 Constraint 375 629 5.0053 6.2566 9.3849 5.9904 Constraint 375 622 5.3508 6.6885 10.0328 5.9904 Constraint 375 613 8.4017 10.5021 15.7531 5.9904 Constraint 368 622 8.1084 10.1355 15.2032 5.9904 Constraint 350 442 11.8495 14.8119 22.2179 5.9890 Constraint 122 350 10.3168 12.8960 19.3440 5.9890 Constraint 153 272 11.1097 13.8872 20.8307 5.9886 Constraint 153 250 11.8692 14.8365 22.2547 5.9886 Constraint 480 657 9.9417 12.4271 18.6407 5.9884 Constraint 473 657 8.6288 10.7860 16.1791 5.9884 Constraint 473 651 9.7258 12.1573 18.2359 5.9884 Constraint 473 644 9.7751 12.2189 18.3283 5.9884 Constraint 136 341 9.4715 11.8393 17.7590 5.9828 Constraint 330 412 10.6475 13.3093 19.9640 5.9804 Constraint 412 613 8.8327 11.0409 16.5614 5.9657 Constraint 314 590 9.2488 11.5610 17.3415 5.9500 Constraint 322 636 10.2336 12.7920 19.1880 5.9340 Constraint 182 636 10.2565 12.8206 19.2309 5.9340 Constraint 285 604 9.5678 11.9598 17.9397 5.9308 Constraint 267 604 11.7413 14.6766 22.0149 5.9308 Constraint 259 629 10.1702 12.7128 19.0692 5.9308 Constraint 259 604 8.7441 10.9302 16.3952 5.9308 Constraint 250 629 10.5993 13.2492 19.8738 5.9308 Constraint 250 604 10.6904 13.3630 20.0445 5.9308 Constraint 242 629 7.7726 9.7158 14.5737 5.9308 Constraint 237 629 4.8393 6.0491 9.0736 5.9308 Constraint 226 629 7.5958 9.4948 14.2422 5.9308 Constraint 201 629 4.5201 5.6501 8.4752 5.9308 Constraint 69 442 11.3318 14.1648 21.2472 5.8367 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 421 11.1855 13.9819 20.9728 5.8367 Constraint 58 350 10.2080 12.7601 19.1401 5.8367 Constraint 58 136 11.9186 14.8983 22.3474 5.8367 Constraint 58 128 11.0615 13.8269 20.7403 5.8367 Constraint 242 599 5.0650 6.3313 9.4970 5.8350 Constraint 242 590 7.1438 8.9298 13.3946 5.8350 Constraint 237 599 4.6977 5.8722 8.8083 5.8350 Constraint 80 259 10.9914 13.7392 20.6089 5.8238 Constraint 435 577 10.3075 12.8843 19.3265 5.8015 Constraint 303 497 10.8916 13.6145 20.4217 5.7707 Constraint 585 651 11.4971 14.3714 21.5571 5.7660 Constraint 322 577 6.4211 8.0264 12.0396 5.7525 Constraint 314 577 6.2239 7.7798 11.6697 5.7525 Constraint 297 577 8.9637 11.2046 16.8069 5.7525 Constraint 292 577 7.8052 9.7565 14.6348 5.7525 Constraint 322 622 11.1286 13.9107 20.8661 5.7519 Constraint 272 599 9.4698 11.8372 17.7558 5.7513 Constraint 421 552 10.5967 13.2459 19.8688 5.7430 Constraint 80 375 11.3218 14.1523 21.2284 5.7352 Constraint 250 473 11.8016 14.7520 22.1280 5.7057 Constraint 136 604 9.1653 11.4567 17.1850 5.6645 Constraint 122 604 8.7890 10.9862 16.4794 5.6645 Constraint 88 161 11.6330 14.5413 21.8119 5.6050 Constraint 571 636 11.3009 14.1262 21.1893 5.5730 Constraint 557 636 11.7358 14.6698 22.0047 5.5730 Constraint 382 535 8.0655 10.0818 15.1227 5.5730 Constraint 375 527 7.3826 9.2282 13.8423 5.5730 Constraint 368 527 7.6702 9.5877 14.3816 5.5730 Constraint 368 519 11.1153 13.8941 20.8412 5.5730 Constraint 350 519 10.0360 12.5450 18.8174 5.5730 Constraint 330 544 11.0412 13.8015 20.7023 5.5730 Constraint 330 519 10.3375 12.9218 19.3827 5.5730 Constraint 303 535 11.4345 14.2931 21.4396 5.5730 Constraint 303 519 11.8115 14.7644 22.1466 5.5730 Constraint 297 544 11.4538 14.3173 21.4759 5.5730 Constraint 292 535 10.3627 12.9534 19.4300 5.5730 Constraint 285 535 11.1821 13.9776 20.9664 5.5730 Constraint 259 535 10.6369 13.2961 19.9442 5.5730 Constraint 237 375 11.5884 14.4855 21.7283 5.5730 Constraint 226 404 11.4848 14.3560 21.5340 5.5730 Constraint 226 399 11.9469 14.9336 22.4005 5.5730 Constraint 226 382 10.9655 13.7069 20.5604 5.5730 Constraint 226 360 11.2744 14.0930 21.1395 5.5730 Constraint 182 544 11.8311 14.7889 22.1833 5.5730 Constraint 169 399 11.1914 13.9892 20.9839 5.5628 Constraint 122 535 8.6109 10.7636 16.1454 5.5479 Constraint 182 404 10.2375 12.7969 19.1953 5.3744 Constraint 210 636 8.6386 10.7982 16.1974 5.3510 Constraint 88 382 11.2306 14.0382 21.0573 5.3062 Constraint 113 391 11.2880 14.1100 21.1650 5.2920 Constraint 128 585 9.3195 11.6494 17.4740 5.2597 Constraint 122 585 9.7205 12.1507 18.2260 5.2597 Constraint 449 544 10.7465 13.4331 20.1496 5.2536 Constraint 421 577 8.6697 10.8371 16.2557 5.2494 Constraint 442 577 10.1751 12.7189 19.0783 5.2475 Constraint 297 497 11.2554 14.0692 21.1038 5.2057 Constraint 182 497 11.1679 13.9599 20.9399 5.2057 Constraint 104 404 10.4081 13.0101 19.5152 5.1895 Constraint 169 622 8.1270 10.1587 15.2381 5.1792 Constraint 169 636 8.1773 10.2217 15.3325 5.1689 Constraint 259 599 7.1941 8.9927 13.4890 5.1683 Constraint 250 599 7.7196 9.6494 14.4742 5.1683 Constraint 237 590 6.8283 8.5354 12.8031 5.1683 Constraint 226 599 7.1801 8.9751 13.4627 5.1683 Constraint 210 590 7.9284 9.9106 14.8658 5.1683 Constraint 122 552 9.2933 11.6166 17.4249 5.1431 Constraint 122 544 9.8603 12.3254 18.4880 5.1431 Constraint 113 552 9.7968 12.2460 18.3689 5.1431 Constraint 88 544 8.8191 11.0239 16.5359 5.1431 Constraint 360 577 8.7455 10.9319 16.3978 5.1315 Constraint 489 577 8.9441 11.1802 16.7702 5.1095 Constraint 461 544 9.7102 12.1378 18.2067 5.0932 Constraint 128 535 9.7688 12.2110 18.3164 5.0932 Constraint 153 473 10.9633 13.7041 20.5562 5.0932 Constraint 480 577 7.3762 9.2202 13.8303 5.0913 Constraint 104 412 10.3785 12.9731 19.4597 5.0605 Constraint 368 604 10.4292 13.0364 19.5547 5.0067 Constraint 350 599 11.2053 14.0066 21.0099 5.0067 Constraint 104 467 9.9312 12.4140 18.6210 5.0051 Constraint 144 435 11.6140 14.5175 21.7762 5.0001 Constraint 113 599 10.3931 12.9914 19.4871 4.9977 Constraint 104 599 8.5214 10.6518 15.9777 4.9977 Constraint 153 399 11.3865 14.2331 21.3496 4.9920 Constraint 153 391 11.3498 14.1873 21.2809 4.9920 Constraint 122 368 11.5126 14.3908 21.5861 4.9920 Constraint 480 651 11.1891 13.9864 20.9795 4.9904 Constraint 480 644 9.9362 12.4203 18.6304 4.9904 Constraint 467 657 10.6977 13.3722 20.0583 4.9904 Constraint 429 657 10.8751 13.5938 20.3907 4.9904 Constraint 404 657 8.2415 10.3018 15.4527 4.9904 Constraint 404 651 8.5264 10.6580 15.9870 4.9904 Constraint 404 644 10.8862 13.6078 20.4116 4.9904 Constraint 404 636 8.8537 11.0672 16.6007 4.9904 Constraint 399 657 10.2999 12.8749 19.3123 4.9904 Constraint 399 651 9.4730 11.8412 17.7618 4.9904 Constraint 399 644 10.8733 13.5916 20.3875 4.9904 Constraint 399 636 9.2793 11.5992 17.3988 4.9904 Constraint 391 651 11.4119 14.2649 21.3973 4.9904 Constraint 391 629 8.9083 11.1354 16.7031 4.9904 Constraint 382 657 10.1528 12.6910 19.0365 4.9904 Constraint 382 651 8.6567 10.8208 16.2312 4.9904 Constraint 382 636 11.4064 14.2580 21.3871 4.9904 Constraint 375 657 7.6568 9.5711 14.3566 4.9904 Constraint 375 651 5.6128 7.0160 10.5241 4.9904 Constraint 375 644 8.0069 10.0087 15.0130 4.9904 Constraint 368 644 11.3548 14.1935 21.2903 4.9904 Constraint 368 629 7.8009 9.7511 14.6266 4.9904 Constraint 368 613 11.0169 13.7711 20.6567 4.9904 Constraint 360 629 8.3166 10.3957 15.5936 4.9904 Constraint 360 622 8.3688 10.4611 15.6916 4.9904 Constraint 360 613 10.3323 12.9154 19.3731 4.9904 Constraint 355 622 9.8485 12.3107 18.4660 4.9904 Constraint 355 590 9.2739 11.5923 17.3885 4.9904 Constraint 497 622 9.1902 11.4878 17.2316 4.9890 Constraint 497 613 9.5399 11.9249 17.8873 4.9890 Constraint 330 599 11.1801 13.9752 20.9628 4.9686 Constraint 314 571 8.1418 10.1773 15.2659 4.9654 Constraint 330 585 10.3497 12.9371 19.4057 4.9532 Constraint 330 651 10.0868 12.6085 18.9128 4.9494 Constraint 330 644 10.0074 12.5092 18.7638 4.9494 Constraint 297 644 10.3033 12.8791 19.3187 4.9494 Constraint 292 636 11.2831 14.1039 21.1558 4.9462 Constraint 272 399 11.8015 14.7519 22.1278 4.9462 Constraint 201 636 8.4016 10.5020 15.7529 4.9462 Constraint 190 636 11.3876 14.2345 21.3517 4.9462 Constraint 176 636 8.8820 11.1025 16.6537 4.9462 Constraint 279 599 11.3741 14.2177 21.3265 4.9416 Constraint 182 590 11.7223 14.6529 21.9794 4.9416 Constraint 613 687 10.4969 13.1211 19.6817 4.9253 Constraint 272 368 11.7729 14.7161 22.0742 4.9120 Constraint 88 279 10.6340 13.2926 19.9388 4.9063 Constraint 88 272 10.0123 12.5153 18.7730 4.9063 Constraint 136 489 11.7540 14.6926 22.0388 4.8980 Constraint 259 461 11.3160 14.1451 21.2176 4.8980 Constraint 322 382 9.9816 12.4770 18.7154 4.8853 Constraint 113 604 8.3987 10.4983 15.7475 4.8549 Constraint 297 404 6.9130 8.6412 12.9618 4.8224 Constraint 497 590 9.8651 12.3314 18.4971 4.8111 Constraint 88 552 8.2304 10.2880 15.4319 4.8096 Constraint 449 577 9.8104 12.2630 18.3945 4.8035 Constraint 429 577 7.7205 9.6506 14.4760 4.8035 Constraint 404 577 7.5156 9.3945 14.0917 4.7881 Constraint 226 613 11.5648 14.4560 21.6839 4.7744 Constraint 190 622 10.9811 13.7264 20.5896 4.7744 Constraint 169 613 9.0549 11.3186 16.9779 4.7744 Constraint 169 629 6.0695 7.5869 11.3803 4.7641 Constraint 226 590 10.2957 12.8696 19.3043 4.7635 Constraint 221 590 10.1472 12.6840 19.0259 4.7635 Constraint 201 590 10.2034 12.7543 19.1314 4.7635 Constraint 128 404 10.5355 13.1694 19.7541 4.7605 Constraint 182 585 11.1390 13.9238 20.8857 4.7442 Constraint 622 698 10.7150 13.3937 20.0906 4.7344 Constraint 169 473 9.3364 11.6705 17.5057 4.6642 Constraint 144 585 10.4265 13.0332 19.5497 4.6639 Constraint 80 585 11.9049 14.8811 22.3217 4.6571 Constraint 442 613 6.5871 8.2339 12.3508 4.6478 Constraint 435 613 6.5835 8.2294 12.3441 4.6478 Constraint 429 544 10.6980 13.3724 20.0587 4.6335 Constraint 136 577 9.2902 11.6127 17.4191 4.5929 Constraint 128 577 7.7914 9.7392 14.6088 4.5929 Constraint 122 577 8.5034 10.6292 15.9439 4.5929 Constraint 113 577 9.3849 11.7311 17.5966 4.5929 Constraint 104 577 7.7838 9.7297 14.5946 4.5929 Constraint 497 629 7.3720 9.2149 13.8224 4.5842 Constraint 221 577 9.5710 11.9638 17.9457 4.5660 Constraint 210 577 7.1799 8.9749 13.4624 4.5660 Constraint 201 577 9.6781 12.0976 18.1464 4.5660 Constraint 182 577 8.4141 10.5176 15.7764 4.5660 Constraint 176 577 9.5913 11.9891 17.9837 4.5660 Constraint 527 599 7.9348 9.9185 14.8777 4.5288 Constraint 657 742 11.2107 14.0134 21.0201 4.5224 Constraint 279 404 9.3050 11.6313 17.4469 4.5224 Constraint 489 590 10.7530 13.4412 20.1618 4.5111 Constraint 136 585 8.9495 11.1868 16.7802 4.4501 Constraint 113 613 11.1001 13.8751 20.8127 4.4501 Constraint 144 571 10.0741 12.5927 18.8890 4.4267 Constraint 161 272 11.7503 14.6879 22.0318 4.4156 Constraint 497 585 8.7580 10.9475 16.4212 4.4063 Constraint 80 552 10.2587 12.8233 19.2350 4.4048 Constraint 88 577 8.8147 11.0184 16.5275 4.4015 Constraint 449 629 8.9875 11.2344 16.8516 4.3765 Constraint 322 668 9.1989 11.4986 17.2479 4.3664 Constraint 292 668 10.4137 13.0171 19.5257 4.3664 Constraint 272 668 10.3027 12.8783 19.3175 4.3664 Constraint 210 668 10.2023 12.7528 19.1292 4.3664 Constraint 190 668 9.8535 12.3169 18.4754 4.3664 Constraint 182 676 9.7358 12.1698 18.2547 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 182 644 8.2901 10.3627 15.5440 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 176 651 10.0183 12.5228 18.7842 4.3664 Constraint 176 644 7.9308 9.9135 14.8702 4.3664 Constraint 449 622 7.5235 9.4044 14.1065 4.3643 Constraint 250 590 8.4623 10.5778 15.8667 4.3587 Constraint 237 636 9.0700 11.3375 17.0062 4.3587 Constraint 322 473 9.0236 11.2795 16.9192 4.3581 Constraint 144 577 9.2716 11.5895 17.3842 4.3345 Constraint 144 519 9.9828 12.4785 18.7178 4.3335 Constraint 113 544 10.4475 13.0594 19.5891 4.3335 Constraint 104 435 10.4857 13.1072 19.6608 4.2827 Constraint 80 237 10.0697 12.5872 18.8808 4.2801 Constraint 489 571 9.9818 12.4773 18.7159 4.2555 Constraint 161 604 8.2747 10.3434 15.5150 4.2513 Constraint 161 585 9.9082 12.3853 18.5780 4.2513 Constraint 153 557 11.5026 14.3783 21.5675 4.2363 Constraint 144 557 9.7204 12.1505 18.2258 4.2363 Constraint 442 604 5.0805 6.3507 9.5260 4.2330 Constraint 519 599 9.6551 12.0689 18.1033 4.2288 Constraint 113 535 8.7450 10.9312 16.3969 4.2144 Constraint 88 535 4.6155 5.7693 8.6540 4.2144 Constraint 242 489 9.3217 11.6522 17.4782 4.2144 Constraint 341 511 11.4916 14.3645 21.5467 4.2143 Constraint 113 341 9.1359 11.4199 17.1299 4.2087 Constraint 104 604 7.3774 9.2218 13.8326 4.1881 Constraint 201 644 9.1614 11.4517 17.1776 4.1837 Constraint 355 577 10.1465 12.6831 19.0246 4.1315 Constraint 314 480 9.8323 12.2904 18.4357 4.1106 Constraint 461 571 10.8953 13.6191 20.4287 4.0932 Constraint 480 571 7.2944 9.1179 13.6769 4.0913 Constraint 480 557 9.5814 11.9767 17.9651 4.0913 Constraint 473 557 9.7842 12.2302 18.3453 4.0913 Constraint 144 599 9.9813 12.4766 18.7149 4.0726 Constraint 442 519 9.3326 11.6657 17.4986 4.0333 Constraint 442 511 9.6069 12.0086 18.0130 4.0333 Constraint 355 449 11.2284 14.0355 21.0533 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 527 622 7.6693 9.5866 14.3800 3.9921 Constraint 314 467 10.6103 13.2629 19.8943 3.9913 Constraint 382 644 11.7792 14.7240 22.0861 3.9904 Constraint 375 668 10.3304 12.9130 19.3695 3.9904 Constraint 497 604 7.7369 9.6711 14.5067 3.9890 Constraint 391 577 6.3172 7.8965 11.8447 3.9855 Constraint 391 571 6.0137 7.5172 11.2758 3.9855 Constraint 382 577 8.3938 10.4923 15.7385 3.9855 Constraint 382 571 7.2942 9.1178 13.6767 3.9855 Constraint 375 577 8.5375 10.6719 16.0079 3.9855 Constraint 368 585 10.3025 12.8781 19.3172 3.9855 Constraint 368 577 8.4518 10.5648 15.8472 3.9855 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 360 571 8.1014 10.1267 15.1900 3.9855 Constraint 577 651 11.4720 14.3400 21.5100 3.9807 Constraint 322 571 9.7276 12.1595 18.2392 3.9654 Constraint 314 585 7.1483 8.9354 13.4031 3.9654 Constraint 303 585 10.8170 13.5212 20.2819 3.9654 Constraint 303 571 9.6071 12.0088 18.0132 3.9654 Constraint 297 571 11.5842 14.4803 21.7204 3.9654 Constraint 285 577 7.7267 9.6584 14.4876 3.9654 Constraint 259 577 7.9750 9.9687 14.9531 3.9654 Constraint 242 577 7.5285 9.4107 14.1160 3.9654 Constraint 314 622 11.3247 14.1559 21.2338 3.9647 Constraint 250 613 11.6269 14.5336 21.8004 3.9647 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 330 668 8.4725 10.5907 15.8860 3.9616 Constraint 330 657 9.6266 12.0333 18.0499 3.9616 Constraint 322 676 9.2293 11.5366 17.3049 3.9616 Constraint 322 644 8.8373 11.0466 16.5699 3.9616 Constraint 297 676 9.3739 11.7173 17.5760 3.9616 Constraint 297 668 8.5461 10.6826 16.0239 3.9616 Constraint 182 657 8.7153 10.8941 16.3412 3.9616 Constraint 182 651 10.1414 12.6767 19.0151 3.9616 Constraint 176 657 8.8945 11.1181 16.6771 3.9616 Constraint 341 435 10.5614 13.2018 19.8026 3.9615 Constraint 322 651 9.9168 12.3960 18.5939 3.9570 Constraint 297 651 10.5918 13.2398 19.8596 3.9570 Constraint 292 590 9.1348 11.4185 17.1278 3.9538 Constraint 285 599 8.2706 10.3382 15.5073 3.9538 Constraint 285 590 10.2577 12.8222 19.2333 3.9538 Constraint 267 599 9.7545 12.1931 18.2896 3.9538 Constraint 259 590 8.4681 10.5851 15.8777 3.9538 Constraint 242 636 11.1697 13.9622 20.9433 3.9538 Constraint 226 636 11.7812 14.7266 22.0898 3.9538 Constraint 297 629 10.4905 13.1131 19.6697 3.9416 Constraint 279 604 11.8156 14.7695 22.1542 3.9416 Constraint 136 557 10.5052 13.1315 19.6973 3.9009 Constraint 128 557 10.8112 13.5139 20.2709 3.9009 Constraint 104 557 10.1808 12.7260 19.0889 3.9009 Constraint 122 303 11.6113 14.5142 21.7712 3.8875 Constraint 113 250 10.7836 13.4795 20.2192 3.8843 Constraint 113 226 10.4470 13.0588 19.5882 3.8843 Constraint 297 473 9.2068 11.5085 17.2628 3.8804 Constraint 176 473 10.2976 12.8720 19.3080 3.8804 Constraint 161 473 8.9584 11.1980 16.7970 3.8804 Constraint 668 742 8.0642 10.0802 15.1203 3.8557 Constraint 104 585 7.9375 9.9219 14.8829 3.8543 Constraint 96 552 10.3102 12.8877 19.3316 3.8096 Constraint 96 544 10.7789 13.4736 20.2104 3.8096 Constraint 88 571 10.6174 13.2718 19.9077 3.8058 Constraint 461 613 8.9899 11.2374 16.8560 3.8035 Constraint 412 577 8.9918 11.2397 16.8596 3.8035 Constraint 314 557 9.9164 12.3955 18.5933 3.7923 Constraint 169 651 10.8183 13.5229 20.2843 3.7866 Constraint 391 480 9.6597 12.0746 18.1120 3.7854 Constraint 382 480 8.9259 11.1574 16.7361 3.7854 Constraint 104 629 8.1346 10.1682 15.2523 3.7833 Constraint 104 613 9.8111 12.2639 18.3958 3.7833 Constraint 272 577 9.9047 12.3809 18.5714 3.7564 Constraint 190 577 10.6239 13.2799 19.9198 3.7564 Constraint 128 604 6.7616 8.4520 12.6780 3.6683 Constraint 122 599 7.6473 9.5591 14.3386 3.6683 Constraint 391 585 8.2307 10.2884 15.4326 3.6523 Constraint 429 552 9.6549 12.0686 18.1030 3.6498 Constraint 489 622 9.3085 11.6356 17.4534 3.5874 Constraint 527 629 7.7048 9.6310 14.4465 3.5873 Constraint 519 629 9.5483 11.9354 17.9031 3.5873 Constraint 489 613 9.2044 11.5055 17.2583 3.5861 Constraint 161 622 11.5353 14.4191 21.6287 3.5846 Constraint 161 599 9.4206 11.7758 17.6637 3.5846 Constraint 442 599 6.6175 8.2719 12.4079 3.4702 Constraint 442 590 8.8959 11.1199 16.6799 3.4702 Constraint 577 644 10.4182 13.0227 19.5341 3.4640 Constraint 421 557 10.8962 13.6203 20.4304 3.4623 Constraint 442 552 10.1430 12.6788 19.0182 3.4603 Constraint 442 535 9.6752 12.0940 18.1411 3.4603 Constraint 210 585 9.0224 11.2781 16.9171 3.4456 Constraint 544 613 11.5412 14.4265 21.6397 3.4267 Constraint 169 535 9.8756 12.3446 18.5168 3.4267 Constraint 161 571 11.7167 14.6459 21.9689 3.4267 Constraint 161 544 9.7700 12.2125 18.3188 3.4267 Constraint 153 544 9.7377 12.1722 18.2583 3.4267 Constraint 153 535 8.3365 10.4206 15.6309 3.4267 Constraint 144 544 8.6042 10.7552 16.1328 3.4267 Constraint 128 544 11.2160 14.0200 21.0300 3.4267 Constraint 535 629 8.9575 11.1968 16.7952 3.4192 Constraint 535 622 9.1784 11.4730 17.2095 3.4192 Constraint 497 599 7.5294 9.4118 14.1177 3.4160 Constraint 80 535 7.0981 8.8727 13.3090 3.4048 Constraint 182 698 10.4633 13.0791 19.6187 3.3818 Constraint 176 698 10.9787 13.7234 20.5851 3.3818 Constraint 169 668 9.4042 11.7552 17.6328 3.3818 Constraint 169 657 10.6660 13.3325 19.9988 3.3818 Constraint 169 644 8.3176 10.3969 15.5954 3.3818 Constraint 341 473 10.3967 12.9958 19.4937 3.3806 Constraint 221 668 11.3027 14.1283 21.1925 3.3740 Constraint 210 644 8.2418 10.3022 15.4533 3.3740 Constraint 201 668 9.7874 12.2342 18.3513 3.3740 Constraint 176 676 9.9707 12.4634 18.6951 3.3740 Constraint 449 613 7.8648 9.8310 14.7465 3.3479 Constraint 297 489 9.8361 12.2951 18.4427 3.3076 Constraint 292 480 10.5327 13.1659 19.7488 3.3076 Constraint 210 480 11.0917 13.8646 20.7969 3.3076 Constraint 182 489 10.9697 13.7122 20.5683 3.3076 Constraint 122 382 11.3904 14.2380 21.3570 3.2918 Constraint 136 473 9.3977 11.7471 17.6207 3.2847 Constraint 104 473 8.3938 10.4922 15.7383 3.2847 Constraint 169 585 10.3040 12.8800 19.3200 3.2635 Constraint 113 585 8.3316 10.4145 15.6217 3.2586 Constraint 449 557 11.1814 13.9768 20.9652 3.2392 Constraint 449 552 9.2180 11.5225 17.2838 3.2392 Constraint 128 552 10.7011 13.3764 20.0646 3.2028 Constraint 88 629 9.4882 11.8602 17.7903 3.1920 Constraint 104 590 9.2638 11.5797 17.3696 3.1876 Constraint 221 497 10.7200 13.4000 20.1000 3.1125 Constraint 279 435 9.8163 12.2704 18.4056 3.1096 Constraint 279 429 9.3524 11.6905 17.5357 3.1096 Constraint 473 571 9.0198 11.2747 16.9121 3.0932 Constraint 467 571 10.7020 13.3775 20.0663 3.0932 Constraint 467 557 11.0494 13.8117 20.7175 3.0932 Constraint 80 391 11.3611 14.2014 21.3021 3.0918 Constraint 297 480 9.8311 12.2889 18.4334 3.0913 Constraint 136 480 11.2838 14.1047 21.1571 3.0913 Constraint 128 480 9.5417 11.9272 17.8908 3.0913 Constraint 104 480 9.8431 12.3038 18.4557 3.0913 Constraint 80 250 10.5806 13.2257 19.8386 3.0886 Constraint 80 221 11.7502 14.6878 22.0317 3.0886 Constraint 144 604 7.8189 9.7737 14.6605 3.0726 Constraint 169 467 10.2509 12.8136 19.2204 3.0638 Constraint 279 382 10.1301 12.6626 18.9939 3.0352 Constraint 330 404 6.7153 8.3942 12.5913 3.0170 Constraint 128 622 8.7995 10.9994 16.4991 3.0016 Constraint 128 599 6.0804 7.6005 11.4008 3.0016 Constraint 96 604 8.6259 10.7824 16.1735 3.0016 Constraint 96 599 6.8554 8.5692 12.8538 3.0016 Constraint 96 590 10.5325 13.1656 19.7485 3.0016 Constraint 399 577 6.3107 7.8883 11.8325 3.0009 Constraint 399 571 6.9044 8.6306 12.9458 3.0009 Constraint 391 557 8.3220 10.4025 15.6038 3.0009 Constraint 382 557 8.8518 11.0648 16.5972 3.0009 Constraint 375 552 7.9253 9.9066 14.8599 3.0009 Constraint 368 557 8.5536 10.6920 16.0380 3.0009 Constraint 360 552 7.7488 9.6860 14.5290 3.0009 Constraint 355 557 10.3137 12.8921 19.3382 3.0009 Constraint 399 544 11.5292 14.4115 21.6173 3.0000 Constraint 80 544 10.0944 12.6180 18.9270 3.0000 Constraint 58 449 11.6382 14.5478 21.8216 3.0000 Constraint 58 297 11.6184 14.5230 21.7845 3.0000 Constraint 58 292 11.5763 14.4704 21.7056 3.0000 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 449 11.4549 14.3187 21.4780 3.0000 Constraint 51 429 11.6845 14.6056 21.9084 3.0000 Constraint 51 421 11.7813 14.7266 22.0899 3.0000 Constraint 51 399 11.7096 14.6370 21.9555 3.0000 Constraint 51 360 11.9208 14.9010 22.3516 3.0000 Constraint 51 355 10.7311 13.4139 20.1209 3.0000 Constraint 51 322 10.2102 12.7628 19.1442 3.0000 Constraint 51 144 11.2868 14.1084 21.1627 3.0000 Constraint 51 128 11.5757 14.4697 21.7045 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 355 11.5988 14.4986 21.7478 3.0000 Constraint 41 113 11.8742 14.8427 22.2641 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 355 11.4914 14.3642 21.5463 3.0000 Constraint 33 113 10.9570 13.6962 20.5443 3.0000 Constraint 33 104 11.2225 14.0281 21.0421 3.0000 Constraint 250 461 11.7322 14.6652 21.9978 3.0000 Constraint 144 314 11.8104 14.7630 22.1445 3.0000 Constraint 136 303 11.9427 14.9284 22.3926 3.0000 Constraint 80 404 11.1854 13.9818 20.9726 3.0000 Constraint 153 341 11.1667 13.9584 20.9376 2.9942 Constraint 144 341 11.0042 13.7552 20.6328 2.9942 Constraint 122 341 9.7213 12.1516 18.2274 2.9942 Constraint 527 613 9.2869 11.6087 17.4130 2.9922 Constraint 527 604 8.0927 10.1159 15.1738 2.9922 Constraint 519 622 8.7912 10.9890 16.4835 2.9922 Constraint 511 622 9.9739 12.4674 18.7011 2.9922 Constraint 511 604 9.5759 11.9698 17.9547 2.9922 Constraint 169 360 11.8041 14.7551 22.1326 2.9918 Constraint 144 399 11.2628 14.0785 21.1178 2.9918 Constraint 122 375 11.4970 14.3712 21.5568 2.9918 Constraint 169 350 9.3723 11.7153 17.5730 2.9886 Constraint 169 341 11.2706 14.0882 21.1323 2.9886 Constraint 153 297 11.2337 14.0421 21.0631 2.9886 Constraint 136 350 11.9285 14.9106 22.3660 2.9886 Constraint 122 267 11.8454 14.8067 22.2101 2.9886 Constraint 104 250 11.8150 14.7688 22.1532 2.9886 Constraint 382 585 8.8013 11.0017 16.5025 2.9855 Constraint 350 577 10.2282 12.7853 19.1779 2.9855 Constraint 421 636 10.6345 13.2931 19.9396 2.9846 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 341 706 11.0302 13.7878 20.6817 2.9769 Constraint 330 706 8.0066 10.0083 15.0124 2.9769 Constraint 330 698 10.4351 13.0439 19.5659 2.9769 Constraint 330 687 10.2735 12.8419 19.2629 2.9769 Constraint 322 706 10.4814 13.1017 19.6525 2.9769 Constraint 297 706 8.3589 10.4487 15.6730 2.9769 Constraint 297 698 10.6410 13.3012 19.9518 2.9769 Constraint 297 687 11.5783 14.4729 21.7094 2.9769 Constraint 279 706 10.7316 13.4146 20.1218 2.9769 Constraint 279 668 11.6380 14.5475 21.8212 2.9769 Constraint 272 706 10.4848 13.1060 19.6590 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 182 687 11.7095 14.6368 21.9552 2.9769 Constraint 292 644 9.6688 12.0859 18.1289 2.9692 Constraint 272 644 10.5411 13.1764 19.7646 2.9692 Constraint 190 644 9.3636 11.7045 17.5568 2.9692 Constraint 375 571 6.6112 8.2640 12.3960 2.9692 Constraint 341 449 9.4944 11.8680 17.8020 2.9634 Constraint 341 442 10.5785 13.2231 19.8347 2.9634 Constraint 267 449 11.6909 14.6136 21.9204 2.9634 Constraint 176 429 11.7498 14.6872 22.0308 2.9634 Constraint 297 585 10.8127 13.5159 20.2738 2.9570 Constraint 237 467 8.9897 11.2372 16.8557 2.9118 Constraint 210 355 11.3323 14.1654 21.2481 2.9118 Constraint 201 467 10.6024 13.2530 19.8795 2.9118 Constraint 201 360 11.1123 13.8903 20.8355 2.9118 Constraint 182 368 11.2270 14.0337 21.0506 2.9118 Constraint 113 355 11.9253 14.9066 22.3599 2.9118 Constraint 104 368 11.5263 14.4079 21.6119 2.9118 Constraint 104 226 10.5899 13.2373 19.8560 2.9118 Constraint 285 473 11.7878 14.7348 22.1022 2.9028 Constraint 104 552 10.6484 13.3105 19.9658 2.9028 Constraint 182 382 11.9117 14.8896 22.3344 2.8709 Constraint 122 613 10.1844 12.7305 19.0958 2.8587 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 69 221 11.4968 14.3710 21.5564 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 80 285 11.2886 14.1108 21.1662 2.8352 Constraint 461 622 7.2822 9.1028 13.6541 2.8035 Constraint 449 585 10.6824 13.3531 20.0296 2.8035 Constraint 272 404 10.4058 13.0072 19.5108 2.8035 Constraint 267 404 11.0540 13.8175 20.7263 2.8035 Constraint 169 590 10.6511 13.3139 19.9709 2.7942 Constraint 322 557 9.7496 12.1870 18.2806 2.7923 Constraint 461 636 10.0711 12.5889 18.8833 2.7872 Constraint 449 636 11.0017 13.7522 20.6283 2.7872 Constraint 429 651 11.5057 14.3822 21.5733 2.7872 Constraint 421 651 10.9648 13.7061 20.5591 2.7872 Constraint 113 657 8.6297 10.7871 16.1806 2.7852 Constraint 104 657 8.1524 10.1905 15.2858 2.7852 Constraint 88 657 10.6022 13.2527 19.8791 2.7852 Constraint 237 585 9.1171 11.3963 17.0945 2.7788 Constraint 237 577 7.7052 9.6315 14.4472 2.7788 Constraint 210 571 9.0276 11.2846 16.9268 2.7788 Constraint 201 585 11.2098 14.0122 21.0183 2.7788 Constraint 176 585 10.9806 13.7257 20.5886 2.7750 Constraint 161 613 10.4402 13.0503 19.5754 2.7750 Constraint 161 590 11.0577 13.8221 20.7331 2.7750 Constraint 144 590 11.3200 14.1500 21.2251 2.7600 Constraint 599 676 10.8103 13.5128 20.2692 2.7363 Constraint 297 375 8.3638 10.4548 15.6822 2.7352 Constraint 279 375 9.3027 11.6283 17.4425 2.7352 Constraint 267 375 10.7887 13.4859 20.2288 2.7352 Constraint 330 442 11.2881 14.1102 21.1652 2.7112 Constraint 435 552 9.5251 11.9063 17.8595 2.6498 Constraint 421 544 9.1767 11.4709 17.2063 2.6498 Constraint 242 585 7.7008 9.6260 14.4390 2.6359 Constraint 429 557 10.4007 13.0009 19.5014 2.6335 Constraint 435 544 9.2267 11.5334 17.3000 2.6315 Constraint 435 519 8.0731 10.0914 15.1370 2.6315 Constraint 412 519 9.3292 11.6615 17.4922 2.6315 Constraint 169 577 7.4066 9.2583 13.8874 2.5968 Constraint 161 577 7.7613 9.7016 14.5524 2.5968 Constraint 136 599 8.5090 10.6362 15.9543 2.5968 Constraint 128 590 9.2294 11.5367 17.3051 2.5968 Constraint 96 577 8.6593 10.8241 16.2362 2.5968 Constraint 511 629 8.5935 10.7419 16.1128 2.5874 Constraint 250 355 11.9794 14.9742 22.4613 2.5732 Constraint 497 657 8.0800 10.1001 15.1501 2.5710 Constraint 527 651 9.5402 11.9252 17.8878 2.5710 Constraint 350 435 11.4891 14.3614 21.5421 2.5709 Constraint 330 473 11.5232 14.4040 21.6059 2.5709 Constraint 176 435 11.7765 14.7206 22.0810 2.5709 Constraint 176 391 11.8745 14.8431 22.2646 2.5709 Constraint 169 404 11.3725 14.2156 21.3234 2.5709 Constraint 161 435 11.1912 13.9890 20.9835 2.5709 Constraint 161 412 11.9973 14.9966 22.4949 2.5709 Constraint 136 412 11.8994 14.8742 22.3113 2.5709 Constraint 489 636 9.6836 12.1045 18.1568 2.5698 Constraint 242 519 7.4781 9.3476 14.0214 2.5479 Constraint 242 511 7.2780 9.0975 13.6463 2.5479 Constraint 210 519 9.7593 12.1991 18.2987 2.5479 Constraint 210 511 10.0399 12.5499 18.8249 2.5479 Constraint 128 519 10.5821 13.2276 19.8414 2.5479 Constraint 136 226 9.5431 11.9289 17.8933 2.5369 Constraint 122 590 9.6373 12.0467 18.0700 2.4769 Constraint 442 557 10.0415 12.5519 18.8278 2.4623 Constraint 435 590 8.1920 10.2401 15.3601 2.4539 Constraint 161 629 9.7489 12.1862 18.2793 2.4539 Constraint 96 585 10.6765 13.3456 20.0184 2.4539 Constraint 511 599 8.9321 11.1651 16.7476 2.4192 Constraint 489 668 10.0708 12.5886 18.8828 2.4029 Constraint 210 676 10.9426 13.6783 20.5175 2.3894 Constraint 190 676 11.4988 14.3736 21.5603 2.3894 Constraint 169 676 10.0284 12.5355 18.8033 2.3894 Constraint 221 657 11.0941 13.8676 20.8014 2.3817 Constraint 210 657 9.2011 11.5014 17.2521 2.3817 Constraint 201 657 9.9595 12.4494 18.6741 2.3817 Constraint 435 571 10.4769 13.0961 19.6441 2.3335 Constraint 622 706 9.0959 11.3699 17.0548 2.3315 Constraint 604 706 9.7835 12.2294 18.3440 2.3315 Constraint 599 706 6.5315 8.1644 12.2466 2.3315 Constraint 590 706 10.2211 12.7763 19.1645 2.3315 Constraint 590 687 10.2376 12.7970 19.1955 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 577 687 9.8766 12.3457 18.5186 2.3315 Constraint 571 706 8.9503 11.1879 16.7818 2.3315 Constraint 571 687 11.1877 13.9847 20.9770 2.3315 Constraint 399 552 9.0877 11.3597 17.0395 2.3163 Constraint 442 544 9.3927 11.7408 17.6113 2.3144 Constraint 144 629 9.0009 11.2511 16.8766 2.2630 Constraint 519 590 9.8904 12.3630 18.5444 2.2308 Constraint 341 480 7.6242 9.5303 14.2955 2.2125 Constraint 303 480 11.2534 14.0667 21.1001 2.2125 Constraint 128 657 8.9382 11.1728 16.7592 2.1920 Constraint 128 651 9.0900 11.3625 17.0438 2.1920 Constraint 128 644 9.0555 11.3194 16.9791 2.1920 Constraint 122 657 10.0431 12.5538 18.8307 2.1920 Constraint 122 651 10.2654 12.8318 19.2477 2.1920 Constraint 122 636 9.5847 11.9809 17.9714 2.1920 Constraint 122 629 7.0419 8.8024 13.2036 2.1920 Constraint 122 622 9.6509 12.0637 18.0955 2.1920 Constraint 104 668 10.8116 13.5145 20.2717 2.1920 Constraint 104 644 9.4783 11.8479 17.7718 2.1920 Constraint 96 657 10.3054 12.8818 19.3226 2.1920 Constraint 96 622 8.6153 10.7691 16.1537 2.1920 Constraint 96 613 10.4252 13.0315 19.5472 2.1920 Constraint 88 622 10.9098 13.6372 20.4558 2.1920 Constraint 355 604 11.5152 14.3940 21.5911 2.1623 Constraint 360 657 9.4997 11.8747 17.8120 2.1459 Constraint 360 651 9.9310 12.4137 18.6206 2.1459 Constraint 355 651 8.4145 10.5181 15.7771 2.1459 Constraint 242 544 10.3918 12.9898 19.4847 2.1431 Constraint 237 544 11.3781 14.2227 21.3340 2.1431 Constraint 153 577 8.1633 10.2041 15.3061 2.1431 Constraint 153 552 10.1294 12.6617 18.9926 2.1431 Constraint 341 657 10.1245 12.6556 18.9834 2.1305 Constraint 461 557 9.7020 12.1276 18.1913 2.0932 Constraint 303 473 10.8114 13.5143 20.2714 2.0932 Constraint 303 467 9.1620 11.4525 17.1787 2.0932 Constraint 303 461 10.6501 13.3126 19.9690 2.0932 Constraint 297 467 6.0963 7.6204 11.4305 2.0932 Constraint 297 461 9.0964 11.3705 17.0558 2.0932 Constraint 292 467 8.5327 10.6659 15.9989 2.0932 Constraint 285 467 11.5887 14.4858 21.7288 2.0932 Constraint 279 467 10.8279 13.5349 20.3024 2.0932 Constraint 272 480 10.7926 13.4908 20.2362 2.0932 Constraint 272 473 9.3970 11.7463 17.6194 2.0932 Constraint 272 467 9.3005 11.6257 17.4385 2.0932 Constraint 272 435 11.5268 14.4086 21.6128 2.0932 Constraint 272 429 9.3583 11.6979 17.5469 2.0932 Constraint 267 429 11.2334 14.0418 21.0626 2.0932 Constraint 221 473 10.3193 12.8991 19.3486 2.0932 Constraint 221 467 11.8320 14.7900 22.1849 2.0932 Constraint 201 473 9.7332 12.1665 18.2497 2.0932 Constraint 190 473 10.7726 13.4658 20.1987 2.0932 Constraint 182 535 11.4422 14.3028 21.4542 2.0932 Constraint 182 480 8.3941 10.4926 15.7389 2.0932 Constraint 182 467 8.3746 10.4682 15.7024 2.0932 Constraint 176 480 10.9418 13.6773 20.5159 2.0932 Constraint 176 467 11.9216 14.9020 22.3530 2.0932 Constraint 169 480 8.8303 11.0378 16.5568 2.0932 Constraint 161 535 7.2072 9.0090 13.5135 2.0932 Constraint 161 497 9.8602 12.3253 18.4880 2.0932 Constraint 161 489 11.0008 13.7510 20.6265 2.0932 Constraint 161 480 7.1619 8.9524 13.4285 2.0932 Constraint 161 467 9.9677 12.4596 18.6894 2.0932 Constraint 153 480 10.4698 13.0872 19.6308 2.0932 Constraint 144 480 10.1906 12.7382 19.1073 2.0932 Constraint 144 473 9.3012 11.6265 17.4398 2.0932 Constraint 136 552 11.7767 14.7209 22.0814 2.0932 Constraint 136 535 9.2858 11.6072 17.4109 2.0932 Constraint 330 435 8.4002 10.5003 15.7504 2.0189 Constraint 449 571 11.4189 14.2736 21.4104 2.0163 Constraint 421 571 8.2589 10.3236 15.4854 2.0163 Constraint 412 571 8.9100 11.1374 16.7062 2.0163 Constraint 404 552 9.9416 12.4270 18.6405 2.0163 Constraint 355 571 8.3311 10.4139 15.6208 2.0163 Constraint 350 571 10.4634 13.0792 19.6189 2.0163 Constraint 391 613 11.7800 14.7249 22.0874 2.0041 Constraint 391 552 4.4313 5.5392 8.3088 2.0009 Constraint 382 552 5.6671 7.0839 10.6258 2.0009 Constraint 368 552 5.4283 6.7854 10.1781 2.0009 Constraint 355 552 7.9621 9.9526 14.9289 2.0009 Constraint 350 552 10.3353 12.9191 19.3786 2.0009 Constraint 88 613 10.7137 13.3921 20.0882 2.0005 Constraint 144 412 11.4344 14.2930 21.4395 2.0002 Constraint 497 651 9.5058 11.8822 17.8234 1.9981 Constraint 497 644 9.0724 11.3405 17.0108 1.9981 Constraint 489 657 8.7607 10.9509 16.4264 1.9981 Constraint 489 644 11.1791 13.9739 20.9609 1.9981 Constraint 480 698 9.8229 12.2786 18.4179 1.9981 Constraint 480 668 8.7005 10.8757 16.3135 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 687 10.3057 12.8821 19.3231 1.9981 Constraint 473 676 10.3858 12.9822 19.4733 1.9981 Constraint 473 668 6.9545 8.6931 13.0397 1.9981 Constraint 557 651 9.6751 12.0939 18.1408 1.9980 Constraint 552 629 10.5665 13.2081 19.8122 1.9980 Constraint 544 651 11.5427 14.4283 21.6425 1.9980 Constraint 544 629 9.4176 11.7720 17.6580 1.9980 Constraint 544 622 9.3960 11.7451 17.6176 1.9980 Constraint 629 729 10.2036 12.7545 19.1318 1.9962 Constraint 622 713 8.5429 10.6786 16.0179 1.9962 Constraint 604 713 9.7662 12.2078 18.3117 1.9962 Constraint 571 657 9.7346 12.1683 18.2525 1.9962 Constraint 341 622 11.9782 14.9728 22.4591 1.9962 Constraint 341 613 10.5304 13.1630 19.7445 1.9962 Constraint 341 599 8.8635 11.0793 16.6190 1.9962 Constraint 341 590 7.7418 9.6772 14.5158 1.9962 Constraint 341 585 5.2670 6.5837 9.8755 1.9962 Constraint 341 571 6.0004 7.5005 11.2508 1.9962 Constraint 330 590 11.0894 13.8618 20.7927 1.9962 Constraint 330 571 7.3487 9.1859 13.7788 1.9962 Constraint 113 590 11.7426 14.6783 22.0174 1.9962 Constraint 104 571 8.7676 10.9595 16.4392 1.9962 Constraint 519 604 9.1014 11.3768 17.0652 1.9941 Constraint 303 706 11.2303 14.0379 21.0568 1.9904 Constraint 341 720 10.9728 13.7160 20.5740 1.9846 Constraint 341 676 10.7094 13.3867 20.0800 1.9846 Constraint 330 720 9.5377 11.9221 17.8831 1.9846 Constraint 322 713 10.5099 13.1374 19.7061 1.9846 Constraint 322 687 11.9134 14.8918 22.3377 1.9846 Constraint 314 676 11.6238 14.5297 21.7945 1.9846 Constraint 303 676 11.5525 14.4406 21.6609 1.9846 Constraint 303 590 11.6005 14.5006 21.7508 1.9846 Constraint 297 720 10.5132 13.1415 19.7122 1.9846 Constraint 297 713 9.0889 11.3611 17.0417 1.9846 Constraint 292 706 11.4552 14.3190 21.4784 1.9846 Constraint 292 676 10.3952 12.9940 19.4911 1.9846 Constraint 279 676 11.6259 14.5324 21.7986 1.9846 Constraint 272 676 10.8300 13.5375 20.3062 1.9846 Constraint 221 636 11.8726 14.8408 22.2611 1.9846 Constraint 190 706 11.0090 13.7612 20.6418 1.9846 Constraint 182 713 10.7340 13.4174 20.1262 1.9846 Constraint 176 706 10.2032 12.7540 19.1310 1.9846 Constraint 404 571 5.4508 6.8135 10.2203 1.9846 Constraint 375 557 6.5926 8.2407 12.3610 1.9846 Constraint 360 557 7.7178 9.6473 14.4709 1.9846 Constraint 571 644 10.8655 13.5819 20.3728 1.9827 Constraint 557 644 10.9058 13.6323 20.4484 1.9827 Constraint 314 657 10.2619 12.8274 19.2411 1.9827 Constraint 303 557 10.7445 13.4307 20.1460 1.9827 Constraint 330 636 8.2794 10.3492 15.5239 1.9801 Constraint 297 636 8.9892 11.2365 16.8548 1.9801 Constraint 272 636 11.3771 14.2213 21.3320 1.9801 Constraint 322 657 7.2372 9.0465 13.5697 1.9769 Constraint 297 657 7.8177 9.7722 14.6583 1.9769 Constraint 292 657 9.0668 11.3335 17.0002 1.9769 Constraint 279 657 11.4814 14.3518 21.5277 1.9769 Constraint 272 657 9.5760 11.9699 17.9549 1.9769 Constraint 190 657 9.6770 12.0963 18.1444 1.9769 Constraint 527 668 9.2554 11.5693 17.3539 1.9759 Constraint 527 657 6.8503 8.5629 12.8443 1.9759 Constraint 527 644 9.9338 12.4172 18.6259 1.9759 Constraint 519 657 9.2554 11.5693 17.3539 1.9759 Constraint 292 585 7.8920 9.8650 14.7975 1.9692 Constraint 292 571 7.9270 9.9088 14.8632 1.9692 Constraint 285 585 9.5667 11.9584 17.9376 1.9692 Constraint 285 571 7.7020 9.6275 14.4412 1.9692 Constraint 279 571 11.7239 14.6548 21.9823 1.9692 Constraint 272 571 10.9814 13.7267 20.5900 1.9692 Constraint 267 577 8.2086 10.2607 15.3911 1.9692 Constraint 267 571 9.7471 12.1839 18.2759 1.9692 Constraint 259 585 8.9977 11.2472 16.8708 1.9692 Constraint 259 571 5.6666 7.0833 10.6250 1.9692 Constraint 250 585 10.4917 13.1147 19.6720 1.9692 Constraint 250 577 7.4155 9.2694 13.9041 1.9692 Constraint 250 571 5.3243 6.6553 9.9830 1.9692 Constraint 242 571 3.7085 4.6356 6.9534 1.9692 Constraint 237 571 6.7731 8.4663 12.6995 1.9692 Constraint 226 577 9.1179 11.3974 17.0961 1.9692 Constraint 226 571 9.2552 11.5690 17.3535 1.9692 Constraint 221 585 10.3325 12.9156 19.3734 1.9692 Constraint 221 571 8.3847 10.4809 15.7213 1.9692 Constraint 201 571 11.0086 13.7608 20.6411 1.9692 Constraint 182 571 11.4098 14.2622 21.3934 1.9692 Constraint 136 467 10.7044 13.3805 20.0708 1.9412 Constraint 221 461 11.7402 14.6753 22.0129 1.8981 Constraint 182 461 11.4084 14.2605 21.3907 1.8981 Constraint 153 622 10.9588 13.6985 20.5478 1.8812 Constraint 153 604 6.8323 8.5404 12.8106 1.8812 Constraint 153 599 7.8215 9.7769 14.6653 1.8812 Constraint 144 636 8.6981 10.8727 16.3090 1.8582 Constraint 144 613 9.9675 12.4594 18.6891 1.8582 Constraint 341 557 7.4387 9.2983 13.9475 1.8077 Constraint 113 557 9.6084 12.0104 18.0157 1.8077 Constraint 88 557 8.4272 10.5340 15.8010 1.8077 Constraint 272 622 11.6734 14.5917 21.8876 1.7974 Constraint 176 613 11.5056 14.3821 21.5731 1.7974 Constraint 322 552 9.1956 11.4945 17.2418 1.7942 Constraint 314 552 6.9196 8.6495 12.9742 1.7942 Constraint 292 552 8.9778 11.2222 16.8333 1.7942 Constraint 259 552 9.0173 11.2716 16.9074 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 242 557 8.7726 10.9657 16.4486 1.7942 Constraint 242 552 7.5013 9.3766 14.0649 1.7942 Constraint 237 557 10.8597 13.5747 20.3620 1.7942 Constraint 237 552 9.7078 12.1348 18.2022 1.7942 Constraint 221 557 11.8019 14.7524 22.1286 1.7942 Constraint 221 552 9.9863 12.4829 18.7243 1.7942 Constraint 210 557 9.6891 12.1114 18.1671 1.7942 Constraint 210 552 8.3974 10.4968 15.7451 1.7942 Constraint 201 651 9.5952 11.9940 17.9910 1.7942 Constraint 461 651 10.4994 13.1243 19.6864 1.7872 Constraint 461 644 10.2116 12.7645 19.1468 1.7872 Constraint 461 590 3.3842 4.2303 6.3454 1.7872 Constraint 449 651 8.8351 11.0439 16.5658 1.7872 Constraint 449 644 9.9363 12.4204 18.6306 1.7872 Constraint 449 590 6.2744 7.8430 11.7645 1.7872 Constraint 442 651 11.4213 14.2766 21.4149 1.7872 Constraint 176 404 11.6386 14.5483 21.8225 1.7872 Constraint 161 657 11.6721 14.5901 21.8852 1.7872 Constraint 161 636 9.0330 11.2913 16.9369 1.7872 Constraint 136 657 7.1117 8.8896 13.3344 1.7872 Constraint 136 651 8.5990 10.7487 16.1230 1.7872 Constraint 136 636 5.7969 7.2462 10.8693 1.7872 Constraint 136 629 4.6170 5.7712 8.6569 1.7872 Constraint 136 622 8.5217 10.6522 15.9783 1.7872 Constraint 136 613 7.9862 9.9827 14.9741 1.7872 Constraint 128 636 6.6865 8.3581 12.5372 1.7872 Constraint 128 629 4.3395 5.4244 8.1365 1.7872 Constraint 128 613 7.3990 9.2487 13.8731 1.7872 Constraint 113 651 8.6349 10.7936 16.1904 1.7872 Constraint 113 636 8.6219 10.7774 16.1661 1.7872 Constraint 113 629 5.6900 7.1126 10.6688 1.7872 Constraint 113 622 9.7067 12.1334 18.2001 1.7872 Constraint 104 676 11.0027 13.7533 20.6300 1.7872 Constraint 104 651 6.5019 8.1274 12.1911 1.7872 Constraint 104 636 7.6828 9.6035 14.4053 1.7872 Constraint 104 622 6.9782 8.7228 13.0841 1.7872 Constraint 96 651 8.8209 11.0261 16.5391 1.7872 Constraint 96 636 10.0943 12.6179 18.9268 1.7872 Constraint 96 629 5.9742 7.4678 11.2016 1.7872 Constraint 88 651 10.3560 12.9450 19.4175 1.7872 Constraint 535 613 8.4687 10.5859 15.8789 1.7029 Constraint 442 585 6.5729 8.2162 12.3243 1.6831 Constraint 435 585 8.1151 10.1439 15.2158 1.6831 Constraint 412 585 6.9833 8.7291 13.0936 1.6831 Constraint 88 590 11.0768 13.8460 20.7690 1.6673 Constraint 636 713 11.3874 14.2342 21.3513 1.6648 Constraint 599 720 9.1563 11.4453 17.1680 1.6648 Constraint 599 713 6.1760 7.7200 11.5799 1.6648 Constraint 571 729 10.5821 13.2276 19.8414 1.6648 Constraint 571 720 10.6241 13.2801 19.9202 1.6648 Constraint 571 713 7.6358 9.5447 14.3171 1.6648 Constraint 511 585 11.9285 14.9106 22.3659 1.6335 Constraint 435 557 8.9772 11.2215 16.8322 1.6335 Constraint 412 544 10.5079 13.1349 19.7024 1.6335 Constraint 144 651 11.2104 14.0130 21.0195 1.5963 Constraint 136 676 10.9746 13.7182 20.5773 1.5963 Constraint 136 668 9.5754 11.9692 17.9539 1.5963 Constraint 136 644 8.3078 10.3848 15.5772 1.5963 Constraint 113 668 10.7266 13.4082 20.1124 1.5963 Constraint 113 644 10.0681 12.5851 18.8777 1.5963 Constraint 88 636 11.1846 13.9807 20.9711 1.5957 Constraint 113 412 11.8314 14.7893 22.1839 1.5938 Constraint 497 636 7.9848 9.9810 14.9715 1.5730 Constraint 421 657 10.6034 13.2543 19.8814 1.5730 Constraint 391 657 9.7675 12.2094 18.3140 1.5730 Constraint 382 668 11.5182 14.3978 21.5967 1.5730 Constraint 368 657 8.6963 10.8704 16.3056 1.5730 Constraint 651 735 9.5817 11.9772 17.9657 1.5710 Constraint 519 651 11.7646 14.7058 22.0586 1.5710 Constraint 511 657 8.8969 11.1211 16.6817 1.5710 Constraint 511 644 11.0996 13.8746 20.8118 1.5710 Constraint 341 698 11.6600 14.5750 21.8624 1.5653 Constraint 341 668 10.8043 13.5053 20.2580 1.5653 Constraint 153 613 9.9345 12.4181 18.6271 1.4763 Constraint 153 590 9.9619 12.4524 18.6786 1.4763 Constraint 153 585 7.7574 9.6968 14.5452 1.4763 Constraint 590 668 11.5410 14.4262 21.6393 1.4029 Constraint 519 668 10.0923 12.6154 18.9231 1.4029 Constraint 259 698 11.0879 13.8598 20.7897 1.4029 Constraint 242 698 11.5124 14.3905 21.5857 1.4029 Constraint 88 668 11.8055 14.7569 22.1354 1.4029 Constraint 292 698 11.4708 14.3385 21.5077 1.3971 Constraint 272 698 10.2724 12.8405 19.2608 1.3971 Constraint 190 698 10.2704 12.8379 19.2569 1.3971 Constraint 176 687 11.7705 14.7131 22.0696 1.3971 Constraint 242 657 11.5172 14.3965 21.5947 1.3894 Constraint 237 651 11.2275 14.0344 21.0516 1.3894 Constraint 237 644 7.9563 9.9454 14.9180 1.3894 Constraint 221 644 9.3308 11.6635 17.4952 1.3894 Constraint 210 651 9.0713 11.3392 17.0087 1.3894 Constraint 190 651 11.3414 14.1768 21.2652 1.3894 Constraint 613 706 11.5459 14.4324 21.6486 1.3335 Constraint 544 706 11.9397 14.9246 22.3869 1.3335 Constraint 237 535 10.7519 13.4398 20.1598 1.3335 Constraint 237 511 7.9993 9.9992 14.9988 1.3335 Constraint 226 511 11.6136 14.5169 21.7754 1.3335 Constraint 201 511 10.1508 12.6885 19.0328 1.3335 Constraint 169 544 10.1009 12.6262 18.9392 1.3335 Constraint 169 519 10.5864 13.2330 19.8495 1.3335 Constraint 169 511 8.0333 10.0416 15.0624 1.3335 Constraint 161 519 11.4665 14.3332 21.4998 1.3335 Constraint 161 511 9.9317 12.4146 18.6219 1.3335 Constraint 153 571 9.7223 12.1529 18.2294 1.3335 Constraint 153 519 7.4040 9.2550 13.8824 1.3335 Constraint 153 511 5.5102 6.8878 10.3317 1.3335 Constraint 144 511 7.2353 9.0441 13.5662 1.3335 Constraint 136 544 10.4278 13.0347 19.5521 1.3335 Constraint 136 519 10.4001 13.0001 19.5002 1.3335 Constraint 136 511 10.4618 13.0772 19.6158 1.3335 Constraint 128 511 8.5913 10.7391 16.1086 1.3335 Constraint 442 571 9.5507 11.9384 17.9075 1.3163 Constraint 412 552 7.1245 8.9057 13.3585 1.3163 Constraint 136 399 10.3314 12.9142 19.3713 1.2981 Constraint 128 382 11.1824 13.9780 20.9670 1.2981 Constraint 104 382 8.5718 10.7147 16.0721 1.2981 Constraint 80 412 10.7060 13.3825 20.0737 1.2914 Constraint 382 519 9.7185 12.1481 18.2221 1.2144 Constraint 382 489 7.2620 9.0775 13.6162 1.2144 Constraint 368 489 9.4669 11.8337 17.7505 1.2144 Constraint 368 480 7.0504 8.8130 13.2195 1.2144 Constraint 350 489 8.9427 11.1784 16.7676 1.2144 Constraint 350 480 10.1186 12.6482 18.9723 1.2144 Constraint 341 489 7.8308 9.7886 14.6828 1.2144 Constraint 303 489 8.7292 10.9115 16.3673 1.2144 Constraint 292 519 9.0591 11.3239 16.9859 1.2144 Constraint 292 511 11.8080 14.7600 22.1400 1.2144 Constraint 285 519 10.8303 13.5379 20.3069 1.2144 Constraint 285 489 7.0351 8.7938 13.1908 1.2144 Constraint 285 480 9.6392 12.0489 18.0734 1.2144 Constraint 279 489 10.8972 13.6215 20.4322 1.2144 Constraint 272 489 10.6134 13.2667 19.9001 1.2144 Constraint 267 489 9.3743 11.7178 17.5767 1.2144 Constraint 267 480 11.7432 14.6791 22.0186 1.2144 Constraint 259 519 8.0159 10.0198 15.0297 1.2144 Constraint 259 511 10.8396 13.5495 20.3243 1.2144 Constraint 259 489 5.1701 6.4627 9.6940 1.2144 Constraint 259 480 8.0609 10.0761 15.1141 1.2144 Constraint 250 527 9.9982 12.4978 18.7467 1.2144 Constraint 250 519 7.1876 8.9845 13.4767 1.2144 Constraint 250 511 10.3391 12.9239 19.3858 1.2144 Constraint 250 497 10.5856 13.2320 19.8479 1.2144 Constraint 250 489 6.4126 8.0157 12.0236 1.2144 Constraint 250 480 7.1196 8.8995 13.3492 1.2144 Constraint 242 480 6.5917 8.2397 12.3595 1.2144 Constraint 237 527 9.7272 12.1589 18.2384 1.2144 Constraint 237 519 8.1344 10.1680 15.2520 1.2144 Constraint 237 489 9.6479 12.0599 18.0898 1.2144 Constraint 237 480 11.8127 14.7659 22.1488 1.2144 Constraint 226 527 10.9584 13.6980 20.5470 1.2144 Constraint 226 519 9.6801 12.1001 18.1502 1.2144 Constraint 226 489 9.3572 11.6965 17.5447 1.2144 Constraint 226 480 11.7837 14.7296 22.0944 1.2144 Constraint 226 303 11.8452 14.8066 22.2098 1.2144 Constraint 221 519 8.2803 10.3504 15.5256 1.2144 Constraint 221 511 11.6886 14.6108 21.9162 1.2144 Constraint 221 489 6.5848 8.2310 12.3466 1.2144 Constraint 221 480 10.1069 12.6336 18.9504 1.2144 Constraint 210 535 10.7663 13.4578 20.1868 1.2144 Constraint 201 527 10.9891 13.7363 20.6045 1.2144 Constraint 201 519 11.1715 13.9644 20.9466 1.2144 Constraint 201 489 11.4107 14.2634 21.3951 1.2144 Constraint 190 527 11.7078 14.6347 21.9520 1.2144 Constraint 190 489 10.9236 13.6545 20.4817 1.2144 Constraint 182 519 11.4567 14.3208 21.4813 1.2144 Constraint 169 527 10.3805 12.9757 19.4635 1.2144 Constraint 161 644 10.7867 13.4834 20.2250 1.2144 Constraint 144 657 9.2335 11.5419 17.3128 1.1914 Constraint 144 622 11.3565 14.1957 21.2935 1.1914 Constraint 136 590 9.1766 11.4707 17.2060 1.1914 Constraint 113 676 11.6303 14.5379 21.8069 1.1914 Constraint 80 676 11.5458 14.4323 21.6484 1.1914 Constraint 80 657 8.6727 10.8409 16.2613 1.1914 Constraint 80 651 7.3178 9.1473 13.7209 1.1914 Constraint 80 644 11.2896 14.1120 21.1680 1.1914 Constraint 80 636 10.8092 13.5115 20.2672 1.1914 Constraint 80 629 7.0227 8.7783 13.1675 1.1914 Constraint 80 622 9.2976 11.6219 17.4329 1.1914 Constraint 80 604 10.8109 13.5137 20.2705 1.1914 Constraint 80 599 9.2290 11.5362 17.3043 1.1914 Constraint 80 442 9.6345 12.0432 18.0647 1.1914 Constraint 355 644 9.2784 11.5981 17.3971 1.1459 Constraint 350 651 9.9689 12.4611 18.6917 1.1459 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 161 720 10.3047 12.8809 19.3214 1.0715 Constraint 153 636 10.4342 13.0427 19.5641 1.0715 Constraint 153 629 10.0957 12.6196 18.9294 1.0715 Constraint 412 557 8.9379 11.1723 16.7585 1.0163 Constraint 355 585 11.4815 14.3519 21.5279 1.0163 Constraint 355 544 11.2518 14.0647 21.0971 1.0163 Constraint 355 442 10.3295 12.9119 19.3678 1.0163 Constraint 355 435 11.2011 14.0014 21.0021 1.0163 Constraint 350 544 9.6767 12.0958 18.1437 1.0163 Constraint 330 535 10.4667 13.0834 19.6251 1.0163 Constraint 272 382 11.9913 14.9891 22.4836 1.0163 Constraint 69 279 11.2553 14.0691 21.1037 1.0163 Constraint 69 267 11.9432 14.9290 22.3935 1.0163 Constraint 58 375 8.2818 10.3523 15.5285 1.0163 Constraint 58 368 11.0972 13.8715 20.8073 1.0163 Constraint 58 285 11.3060 14.1325 21.1987 1.0163 Constraint 58 259 11.9272 14.9090 22.3636 1.0163 Constraint 58 242 11.5997 14.4997 21.7495 1.0163 Constraint 51 375 10.0852 12.6065 18.9097 1.0163 Constraint 51 303 11.0510 13.8137 20.7206 1.0163 Constraint 51 292 11.3231 14.1539 21.2308 1.0163 Constraint 51 285 9.7781 12.2226 18.3339 1.0163 Constraint 51 259 9.1874 11.4842 17.2263 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 242 8.0307 10.0384 15.0575 1.0163 Constraint 51 237 11.5867 14.4834 21.7251 1.0163 Constraint 51 210 11.2287 14.0358 21.0537 1.0163 Constraint 41 259 11.8259 14.7823 22.1735 1.0163 Constraint 41 250 11.3244 14.1556 21.2333 1.0163 Constraint 41 242 10.4645 13.0807 19.6210 1.0163 Constraint 128 676 10.0834 12.6043 18.9064 1.0005 Constraint 128 668 8.3309 10.4136 15.6204 1.0005 Constraint 122 644 8.3602 10.4502 15.6753 1.0005 Constraint 96 676 11.1770 13.9712 20.9568 1.0005 Constraint 96 668 9.9528 12.4410 18.6615 1.0005 Constraint 96 644 8.6171 10.7714 16.1571 1.0005 Constraint 480 687 11.9479 14.9349 22.4024 1.0000 Constraint 480 676 10.6674 13.3343 20.0014 1.0000 Constraint 467 698 11.4986 14.3733 21.5599 1.0000 Constraint 467 668 9.2723 11.5904 17.3856 1.0000 Constraint 467 651 11.3644 14.2055 21.3083 1.0000 Constraint 467 644 9.9581 12.4477 18.6715 1.0000 Constraint 461 657 10.9175 13.6469 20.4704 1.0000 Constraint 435 657 9.9291 12.4113 18.6170 1.0000 Constraint 435 636 10.5739 13.2173 19.8260 1.0000 Constraint 429 698 11.7026 14.6283 21.9424 1.0000 Constraint 429 668 10.5215 13.1518 19.7277 1.0000 Constraint 429 644 11.0602 13.8253 20.7379 1.0000 Constraint 429 571 7.4999 9.3749 14.0623 1.0000 Constraint 412 657 9.6869 12.1086 18.1629 1.0000 Constraint 412 651 11.9763 14.9704 22.4556 1.0000 Constraint 412 636 11.0474 13.8093 20.7139 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 687 8.6870 10.8587 16.2881 1.0000 Constraint 404 676 10.9343 13.6678 20.5017 1.0000 Constraint 404 668 9.1501 11.4376 17.1563 1.0000 Constraint 404 557 10.8443 13.5553 20.3330 1.0000 Constraint 399 698 11.3454 14.1818 21.2726 1.0000 Constraint 399 687 10.0466 12.5582 18.8373 1.0000 Constraint 399 676 11.0780 13.8474 20.7712 1.0000 Constraint 399 668 9.8918 12.3648 18.5472 1.0000 Constraint 399 557 7.7088 9.6361 14.4541 1.0000 Constraint 391 687 11.8681 14.8351 22.2527 1.0000 Constraint 391 636 10.6388 13.2985 19.9477 1.0000 Constraint 382 698 10.8883 13.6103 20.4155 1.0000 Constraint 382 687 8.7387 10.9234 16.3851 1.0000 Constraint 382 676 11.7533 14.6916 22.0374 1.0000 Constraint 382 613 11.7664 14.7080 22.0620 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 687 5.9127 7.3909 11.0863 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 368 687 9.6089 12.0111 18.0167 1.0000 Constraint 368 676 11.3301 14.1626 21.2439 1.0000 Constraint 368 636 10.1229 12.6536 18.9804 1.0000 Constraint 360 644 10.4076 13.0095 19.5142 1.0000 Constraint 360 636 8.7946 10.9932 16.4898 1.0000 Constraint 355 629 7.8913 9.8641 14.7962 1.0000 Constraint 350 629 10.9962 13.7452 20.6179 1.0000 Constraint 80 613 11.8603 14.8253 22.2380 1.0000 Constraint 651 742 10.3891 12.9864 19.4796 0.9981 Constraint 644 742 6.3980 7.9974 11.9962 0.9981 Constraint 644 735 5.7327 7.1659 10.7489 0.9981 Constraint 644 729 9.7135 12.1418 18.2127 0.9981 Constraint 629 742 7.6822 9.6027 14.4041 0.9981 Constraint 629 735 5.9832 7.4790 11.2185 0.9981 Constraint 622 742 11.4098 14.2622 21.3933 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 622 729 8.4502 10.5627 15.8440 0.9981 Constraint 622 720 9.2851 11.6063 17.4095 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 613 713 9.0649 11.3311 16.9967 0.9981 Constraint 604 742 8.0595 10.0744 15.1116 0.9981 Constraint 604 735 8.8596 11.0744 16.6117 0.9981 Constraint 604 720 11.8037 14.7546 22.1319 0.9981 Constraint 599 742 11.4013 14.2516 21.3774 0.9981 Constraint 599 735 10.9187 13.6484 20.4725 0.9981 Constraint 599 729 8.7329 10.9162 16.3742 0.9981 Constraint 590 729 10.3165 12.8956 19.3434 0.9981 Constraint 590 720 11.2758 14.0948 21.1421 0.9981 Constraint 590 713 6.6136 8.2670 12.4005 0.9981 Constraint 590 698 11.7406 14.6757 22.0136 0.9981 Constraint 585 713 9.0195 11.2744 16.9116 0.9981 Constraint 585 706 11.9850 14.9812 22.4718 0.9981 Constraint 585 698 11.7576 14.6970 22.0455 0.9981 Constraint 585 687 10.5611 13.2014 19.8020 0.9981 Constraint 577 720 11.0270 13.7838 20.6757 0.9981 Constraint 577 713 6.5224 8.1530 12.2296 0.9981 Constraint 577 698 8.4435 10.5543 15.8315 0.9981 Constraint 577 676 11.9189 14.8986 22.3479 0.9981 Constraint 577 668 11.3641 14.2051 21.3077 0.9981 Constraint 571 698 10.5005 13.1256 19.6884 0.9981 Constraint 571 651 10.2944 12.8680 19.3020 0.9981 Constraint 557 713 9.4188 11.7735 17.6602 0.9981 Constraint 557 698 10.5564 13.1955 19.7932 0.9981 Constraint 557 687 9.4462 11.8077 17.7116 0.9981 Constraint 557 676 11.4879 14.3598 21.5397 0.9981 Constraint 557 668 10.3037 12.8796 19.3194 0.9981 Constraint 557 657 6.2669 7.8336 11.7504 0.9981 Constraint 552 698 10.9559 13.6949 20.5423 0.9981 Constraint 552 687 10.8262 13.5327 20.2990 0.9981 Constraint 552 657 8.1605 10.2006 15.3009 0.9981 Constraint 552 651 11.1501 13.9377 20.9065 0.9981 Constraint 544 698 11.5817 14.4771 21.7156 0.9981 Constraint 544 668 11.6643 14.5804 21.8706 0.9981 Constraint 544 657 8.6579 10.8224 16.2335 0.9981 Constraint 535 742 11.6473 14.5592 21.8388 0.9981 Constraint 535 735 8.9201 11.1501 16.7251 0.9981 Constraint 535 713 9.7139 12.1424 18.2135 0.9981 Constraint 535 698 8.6861 10.8576 16.2864 0.9981 Constraint 535 687 9.2070 11.5087 17.2631 0.9981 Constraint 535 676 10.4339 13.0423 19.5635 0.9981 Constraint 535 668 7.7306 9.6632 14.4948 0.9981 Constraint 535 657 4.9366 6.1708 9.2562 0.9981 Constraint 535 651 7.8508 9.8135 14.7203 0.9981 Constraint 535 644 8.3096 10.3870 15.5805 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 527 706 10.1745 12.7181 19.0772 0.9981 Constraint 527 698 6.3442 7.9303 11.8954 0.9981 Constraint 527 687 6.7382 8.4227 12.6341 0.9981 Constraint 527 676 9.5579 11.9474 17.9211 0.9981 Constraint 519 735 11.1465 13.9331 20.8997 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 519 698 8.4419 10.5524 15.8287 0.9981 Constraint 519 687 10.3324 12.9155 19.3733 0.9981 Constraint 511 742 11.6193 14.5241 21.7861 0.9981 Constraint 511 735 8.6213 10.7766 16.1649 0.9981 Constraint 511 729 11.9658 14.9573 22.4360 0.9981 Constraint 511 713 9.0139 11.2673 16.9010 0.9981 Constraint 511 698 8.7420 10.9275 16.3912 0.9981 Constraint 511 687 11.0652 13.8315 20.7473 0.9981 Constraint 511 668 8.5904 10.7380 16.1070 0.9981 Constraint 511 651 11.1142 13.8928 20.8391 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 497 706 8.3556 10.4446 15.6668 0.9981 Constraint 497 698 4.7218 5.9023 8.8534 0.9981 Constraint 497 687 7.2198 9.0248 13.5372 0.9981 Constraint 497 676 8.1861 10.2326 15.3489 0.9981 Constraint 497 668 4.6526 5.8158 8.7236 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 720 11.4156 14.2695 21.4043 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 489 706 8.2414 10.3018 15.4527 0.9981 Constraint 489 698 5.0606 6.3257 9.4886 0.9981 Constraint 489 687 8.4643 10.5803 15.8705 0.9981 Constraint 489 676 10.6549 13.3186 19.9779 0.9981 Constraint 489 651 11.2510 14.0638 21.0957 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 480 706 11.7858 14.7323 22.0984 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 473 706 9.9078 12.3847 18.5771 0.9981 Constraint 330 557 7.3426 9.1782 13.7673 0.9981 Constraint 330 480 7.3610 9.2013 13.8019 0.9981 Constraint 322 480 8.2735 10.3419 15.5128 0.9981 Constraint 314 713 10.2837 12.8546 19.2819 0.9981 Constraint 314 706 10.4701 13.0877 19.6315 0.9981 Constraint 314 698 9.6487 12.0609 18.0914 0.9981 Constraint 303 713 10.9256 13.6570 20.4854 0.9981 Constraint 303 698 11.1062 13.8828 20.8242 0.9981 Constraint 297 557 11.8605 14.8256 22.2385 0.9981 Constraint 285 706 11.5531 14.4414 21.6621 0.9981 Constraint 285 698 10.3873 12.9841 19.4762 0.9981 Constraint 144 404 11.5531 14.4414 21.6621 0.9981 Constraint 136 404 8.4503 10.5629 15.8444 0.9981 Constraint 136 382 9.9465 12.4331 18.6497 0.9981 Constraint 113 435 11.0266 13.7832 20.6748 0.9981 Constraint 113 404 7.4760 9.3449 14.0174 0.9981 Constraint 113 382 10.8415 13.5519 20.3278 0.9981 Constraint 104 713 11.7284 14.6605 21.9907 0.9981 Constraint 104 698 11.8313 14.7891 22.1837 0.9981 Constraint 88 698 10.4801 13.1001 19.6501 0.9981 Constraint 322 698 10.8167 13.5209 20.2813 0.9923 Constraint 314 668 11.6513 14.5641 21.8461 0.9923 Constraint 303 668 11.5844 14.4805 21.7207 0.9923 Constraint 279 698 10.3953 12.9942 19.4913 0.9923 Constraint 350 636 11.6266 14.5332 21.7999 0.9878 Constraint 330 629 7.7779 9.7224 14.5836 0.9878 Constraint 330 622 11.2743 14.0928 21.1393 0.9878 Constraint 330 613 10.2799 12.8499 19.2748 0.9878 Constraint 303 651 11.4665 14.3331 21.4997 0.9878 Constraint 303 636 10.5455 13.1819 19.7728 0.9878 Constraint 303 629 10.0460 12.5575 18.8363 0.9878 Constraint 297 622 10.2732 12.8415 19.2623 0.9878 Constraint 297 613 10.8206 13.5258 20.2887 0.9878 Constraint 297 590 11.5955 14.4943 21.7415 0.9878 Constraint 285 629 11.9688 14.9610 22.4415 0.9878 Constraint 279 651 10.4253 13.0316 19.5474 0.9878 Constraint 279 636 11.6521 14.5652 21.8478 0.9878 Constraint 279 629 9.2555 11.5694 17.3541 0.9878 Constraint 272 651 11.4260 14.2825 21.4238 0.9878 Constraint 267 629 11.6752 14.5941 21.8911 0.9878 Constraint 176 590 10.9603 13.7004 20.5505 0.9878 Constraint 552 644 11.6436 14.5545 21.8318 0.9846 Constraint 314 644 9.2033 11.5041 17.2562 0.9846 Constraint 303 657 10.1917 12.7396 19.1094 0.9846 Constraint 303 644 11.6630 14.5787 21.8680 0.9846 Constraint 292 651 10.3893 12.9866 19.4799 0.9846 Constraint 292 557 9.9967 12.4958 18.7438 0.9846 Constraint 285 657 11.5080 14.3850 21.5775 0.9846 Constraint 285 644 11.1386 13.9233 20.8849 0.9846 Constraint 285 557 9.8546 12.3182 18.4774 0.9846 Constraint 285 552 7.2041 9.0051 13.5076 0.9846 Constraint 272 552 11.8897 14.8621 22.2932 0.9846 Constraint 267 552 10.6722 13.3403 20.0104 0.9846 Constraint 259 644 10.2038 12.7547 19.1321 0.9846 Constraint 259 557 9.0472 11.3089 16.9634 0.9846 Constraint 250 557 9.4593 11.8241 17.7361 0.9846 Constraint 242 644 8.4118 10.5148 15.7722 0.9846 Constraint 226 644 9.5891 11.9864 17.9796 0.9846 Constraint 519 644 11.1471 13.9339 20.9008 0.9778 Constraint 519 636 9.9181 12.3977 18.5965 0.9778 Constraint 519 613 6.3803 7.9754 11.9631 0.9778 Constraint 511 613 6.8994 8.6243 12.9364 0.9778 Constraint 113 285 10.7919 13.4899 20.2348 0.8957 Constraint 113 272 10.5528 13.1910 19.7865 0.8957 Constraint 250 544 11.6904 14.6130 21.9195 0.8096 Constraint 226 552 10.2932 12.8665 19.2997 0.8096 Constraint 210 544 10.4224 13.0281 19.5421 0.8096 Constraint 201 552 9.7649 12.2062 18.3092 0.8096 Constraint 190 552 11.9564 14.9455 22.4183 0.8096 Constraint 182 557 11.9691 14.9614 22.4421 0.8096 Constraint 182 552 10.5515 13.1894 19.7840 0.8096 Constraint 169 557 10.4493 13.0616 19.5924 0.8096 Constraint 169 552 9.4112 11.7641 17.6461 0.8096 Constraint 161 651 11.5749 14.4686 21.7029 0.8096 Constraint 122 571 9.1961 11.4952 17.2427 0.8096 Constraint 122 557 5.4965 6.8707 10.3060 0.8096 Constraint 96 571 9.2539 11.5674 17.3511 0.8096 Constraint 96 557 5.1863 6.4829 9.7244 0.8096 Constraint 442 644 11.9921 14.9902 22.4853 0.6667 Constraint 442 636 10.1742 12.7177 19.0766 0.6667 Constraint 201 742 10.2861 12.8577 19.2865 0.6667 Constraint 201 735 11.8321 14.7901 22.1852 0.6667 Constraint 176 742 11.2722 14.0903 21.1354 0.6667 Constraint 176 735 11.9949 14.9936 22.4904 0.6667 Constraint 169 742 11.2226 14.0283 21.0425 0.6667 Constraint 169 735 11.7239 14.6549 21.9823 0.6667 Constraint 161 742 9.4543 11.8178 17.7267 0.6667 Constraint 161 735 8.4692 10.5866 15.8798 0.6667 Constraint 153 735 11.9781 14.9726 22.4588 0.6667 Constraint 153 729 11.3776 14.2220 21.3331 0.6667 Constraint 153 720 11.9122 14.8902 22.3353 0.6667 Constraint 136 687 11.5428 14.4285 21.6427 0.5957 Constraint 113 687 10.7676 13.4595 20.1892 0.5957 Constraint 104 687 10.0969 12.6211 18.9317 0.5957 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 527 636 7.1172 8.8965 13.3447 0.5730 Constraint 511 636 8.4084 10.5105 15.7658 0.5730 Constraint 442 657 11.6365 14.5456 21.8184 0.5730 Constraint 391 668 9.4962 11.8703 17.8054 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 668 8.1626 10.2032 15.3049 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 360 687 11.8706 14.8383 22.2574 0.5730 Constraint 360 668 8.9643 11.2054 16.8081 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 355 698 11.0780 13.8475 20.7712 0.5730 Constraint 355 687 10.6953 13.3691 20.0536 0.5730 Constraint 355 668 5.3895 6.7369 10.1053 0.5730 Constraint 355 657 3.5466 4.4332 6.6498 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 350 668 9.1543 11.4429 17.1644 0.5730 Constraint 350 657 6.2417 7.8022 11.7033 0.5730 Constraint 511 590 5.0807 6.3508 9.5263 0.4048 Constraint 259 668 11.1550 13.9437 20.9155 0.4048 Constraint 250 698 10.7945 13.4932 20.2397 0.4048 Constraint 250 668 11.3309 14.1636 21.2454 0.4048 Constraint 242 668 9.1556 11.4446 17.1668 0.4048 Constraint 237 698 4.3036 5.3795 8.0693 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 237 676 8.4658 10.5822 15.8733 0.4048 Constraint 237 668 5.1247 6.4058 9.6087 0.4048 Constraint 237 657 6.2235 7.7794 11.6692 0.4048 Constraint 226 698 6.4367 8.0458 12.0687 0.4048 Constraint 226 687 10.6659 13.3324 19.9986 0.4048 Constraint 226 676 10.9952 13.7440 20.6159 0.4048 Constraint 226 668 8.1171 10.1463 15.2195 0.4048 Constraint 226 657 10.1158 12.6448 18.9672 0.4048 Constraint 221 698 9.2067 11.5083 17.2625 0.4048 Constraint 210 698 7.2955 9.1193 13.6790 0.4048 Constraint 210 687 10.0080 12.5100 18.7650 0.4048 Constraint 201 729 9.2546 11.5682 17.3523 0.4048 Constraint 201 720 11.4116 14.2645 21.3968 0.4048 Constraint 201 698 4.5555 5.6944 8.5416 0.4048 Constraint 201 687 8.3711 10.4639 15.6959 0.4048 Constraint 201 676 7.1609 8.9511 13.4266 0.4048 Constraint 190 729 11.2529 14.0661 21.0991 0.4048 Constraint 176 729 9.7777 12.2222 18.3333 0.4048 Constraint 169 729 11.2483 14.0604 21.0906 0.4048 Constraint 169 698 8.1966 10.2457 15.3685 0.4048 Constraint 169 687 9.7608 12.2011 18.3016 0.4048 Constraint 161 698 11.5867 14.4834 21.7251 0.4048 Constraint 161 676 8.0481 10.0601 15.0902 0.4048 Constraint 161 668 9.4978 11.8723 17.8084 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 153 668 6.2813 7.8517 11.7775 0.4048 Constraint 153 657 9.6250 12.0313 18.0470 0.4048 Constraint 153 651 7.9267 9.9084 14.8626 0.4048 Constraint 153 644 4.1787 5.2234 7.8351 0.4048 Constraint 144 676 9.6590 12.0738 18.1107 0.4048 Constraint 144 668 9.6905 12.1131 18.1696 0.4048 Constraint 144 644 6.8687 8.5859 12.8789 0.4048 Constraint 128 698 10.4838 13.1047 19.6570 0.4048 Constraint 122 698 11.9680 14.9599 22.4399 0.4048 Constraint 122 676 9.3863 11.7329 17.5994 0.4048 Constraint 122 668 7.3367 9.1709 13.7564 0.4048 Constraint 88 644 10.0851 12.6064 18.9096 0.4048 Constraint 80 557 8.6085 10.7606 16.1409 0.4048 Constraint 33 375 11.0191 13.7738 20.6608 0.3388 Constraint 33 314 10.9521 13.6901 20.5351 0.3388 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 144 391 11.9980 14.9975 22.4963 0.3000 Constraint 136 391 10.4496 13.0619 19.5929 0.3000 Constraint 122 279 11.4886 14.3607 21.5411 0.3000 Constraint 113 303 11.9505 14.9382 22.4073 0.3000 Constraint 80 382 9.9136 12.3919 18.5879 0.1000 Constraint 80 226 11.3162 14.1453 21.2180 0.1000 Constraint 80 201 10.4561 13.0702 19.6052 0.1000 Constraint 80 176 11.9880 14.9850 22.4775 0.1000 Constraint 80 161 11.7053 14.6316 21.9474 0.1000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 742 0.8000 1.0000 1.5000 0.0000 Constraint 636 735 0.8000 1.0000 1.5000 0.0000 Constraint 636 729 0.8000 1.0000 1.5000 0.0000 Constraint 636 720 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 729 0.8000 1.0000 1.5000 0.0000 Constraint 613 720 0.8000 1.0000 1.5000 0.0000 Constraint 613 698 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 729 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 742 0.8000 1.0000 1.5000 0.0000 Constraint 590 735 0.8000 1.0000 1.5000 0.0000 Constraint 590 676 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 742 0.8000 1.0000 1.5000 0.0000 Constraint 585 735 0.8000 1.0000 1.5000 0.0000 Constraint 585 729 0.8000 1.0000 1.5000 0.0000 Constraint 585 720 0.8000 1.0000 1.5000 0.0000 Constraint 585 676 0.8000 1.0000 1.5000 0.0000 Constraint 585 668 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 735 0.8000 1.0000 1.5000 0.0000 Constraint 577 729 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 742 0.8000 1.0000 1.5000 0.0000 Constraint 571 735 0.8000 1.0000 1.5000 0.0000 Constraint 571 676 0.8000 1.0000 1.5000 0.0000 Constraint 571 668 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 742 0.8000 1.0000 1.5000 0.0000 Constraint 557 735 0.8000 1.0000 1.5000 0.0000 Constraint 557 729 0.8000 1.0000 1.5000 0.0000 Constraint 557 720 0.8000 1.0000 1.5000 0.0000 Constraint 557 706 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 735 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 720 0.8000 1.0000 1.5000 0.0000 Constraint 552 713 0.8000 1.0000 1.5000 0.0000 Constraint 552 706 0.8000 1.0000 1.5000 0.0000 Constraint 552 676 0.8000 1.0000 1.5000 0.0000 Constraint 552 668 0.8000 1.0000 1.5000 0.0000 Constraint 552 636 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 742 0.8000 1.0000 1.5000 0.0000 Constraint 544 735 0.8000 1.0000 1.5000 0.0000 Constraint 544 729 0.8000 1.0000 1.5000 0.0000 Constraint 544 720 0.8000 1.0000 1.5000 0.0000 Constraint 544 713 0.8000 1.0000 1.5000 0.0000 Constraint 544 687 0.8000 1.0000 1.5000 0.0000 Constraint 544 676 0.8000 1.0000 1.5000 0.0000 Constraint 544 644 0.8000 1.0000 1.5000 0.0000 Constraint 544 636 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 729 0.8000 1.0000 1.5000 0.0000 Constraint 535 720 0.8000 1.0000 1.5000 0.0000 Constraint 535 706 0.8000 1.0000 1.5000 0.0000 Constraint 535 636 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 742 0.8000 1.0000 1.5000 0.0000 Constraint 527 729 0.8000 1.0000 1.5000 0.0000 Constraint 527 720 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 742 0.8000 1.0000 1.5000 0.0000 Constraint 519 729 0.8000 1.0000 1.5000 0.0000 Constraint 519 720 0.8000 1.0000 1.5000 0.0000 Constraint 519 706 0.8000 1.0000 1.5000 0.0000 Constraint 519 676 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 720 0.8000 1.0000 1.5000 0.0000 Constraint 511 706 0.8000 1.0000 1.5000 0.0000 Constraint 511 676 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 742 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 742 0.8000 1.0000 1.5000 0.0000 Constraint 480 720 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 706 0.8000 1.0000 1.5000 0.0000 Constraint 467 687 0.8000 1.0000 1.5000 0.0000 Constraint 467 676 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 698 0.8000 1.0000 1.5000 0.0000 Constraint 461 687 0.8000 1.0000 1.5000 0.0000 Constraint 461 676 0.8000 1.0000 1.5000 0.0000 Constraint 461 668 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 687 0.8000 1.0000 1.5000 0.0000 Constraint 449 676 0.8000 1.0000 1.5000 0.0000 Constraint 449 668 0.8000 1.0000 1.5000 0.0000 Constraint 449 657 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 687 0.8000 1.0000 1.5000 0.0000 Constraint 442 676 0.8000 1.0000 1.5000 0.0000 Constraint 442 668 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 698 0.8000 1.0000 1.5000 0.0000 Constraint 435 687 0.8000 1.0000 1.5000 0.0000 Constraint 435 676 0.8000 1.0000 1.5000 0.0000 Constraint 435 668 0.8000 1.0000 1.5000 0.0000 Constraint 435 651 0.8000 1.0000 1.5000 0.0000 Constraint 435 644 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 706 0.8000 1.0000 1.5000 0.0000 Constraint 429 687 0.8000 1.0000 1.5000 0.0000 Constraint 429 676 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 742 0.8000 1.0000 1.5000 0.0000 Constraint 421 735 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 706 0.8000 1.0000 1.5000 0.0000 Constraint 421 698 0.8000 1.0000 1.5000 0.0000 Constraint 421 687 0.8000 1.0000 1.5000 0.0000 Constraint 421 676 0.8000 1.0000 1.5000 0.0000 Constraint 421 668 0.8000 1.0000 1.5000 0.0000 Constraint 421 644 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 698 0.8000 1.0000 1.5000 0.0000 Constraint 412 687 0.8000 1.0000 1.5000 0.0000 Constraint 412 676 0.8000 1.0000 1.5000 0.0000 Constraint 412 668 0.8000 1.0000 1.5000 0.0000 Constraint 412 644 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 706 0.8000 1.0000 1.5000 0.0000 Constraint 404 544 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 742 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 706 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 742 0.8000 1.0000 1.5000 0.0000 Constraint 391 735 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 698 0.8000 1.0000 1.5000 0.0000 Constraint 391 676 0.8000 1.0000 1.5000 0.0000 Constraint 391 644 0.8000 1.0000 1.5000 0.0000 Constraint 391 544 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 742 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 706 0.8000 1.0000 1.5000 0.0000 Constraint 382 544 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 742 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 544 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 735 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 706 0.8000 1.0000 1.5000 0.0000 Constraint 368 698 0.8000 1.0000 1.5000 0.0000 Constraint 368 544 0.8000 1.0000 1.5000 0.0000 Constraint 368 467 0.8000 1.0000 1.5000 0.0000 Constraint 368 461 0.8000 1.0000 1.5000 0.0000 Constraint 368 449 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 735 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 706 0.8000 1.0000 1.5000 0.0000 Constraint 360 698 0.8000 1.0000 1.5000 0.0000 Constraint 360 676 0.8000 1.0000 1.5000 0.0000 Constraint 360 544 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 720 0.8000 1.0000 1.5000 0.0000 Constraint 355 713 0.8000 1.0000 1.5000 0.0000 Constraint 355 706 0.8000 1.0000 1.5000 0.0000 Constraint 355 676 0.8000 1.0000 1.5000 0.0000 Constraint 355 636 0.8000 1.0000 1.5000 0.0000 Constraint 355 613 0.8000 1.0000 1.5000 0.0000 Constraint 355 467 0.8000 1.0000 1.5000 0.0000 Constraint 355 461 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 735 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 720 0.8000 1.0000 1.5000 0.0000 Constraint 350 713 0.8000 1.0000 1.5000 0.0000 Constraint 350 706 0.8000 1.0000 1.5000 0.0000 Constraint 350 698 0.8000 1.0000 1.5000 0.0000 Constraint 350 687 0.8000 1.0000 1.5000 0.0000 Constraint 350 676 0.8000 1.0000 1.5000 0.0000 Constraint 350 644 0.8000 1.0000 1.5000 0.0000 Constraint 350 622 0.8000 1.0000 1.5000 0.0000 Constraint 350 613 0.8000 1.0000 1.5000 0.0000 Constraint 350 604 0.8000 1.0000 1.5000 0.0000 Constraint 350 590 0.8000 1.0000 1.5000 0.0000 Constraint 350 585 0.8000 1.0000 1.5000 0.0000 Constraint 350 557 0.8000 1.0000 1.5000 0.0000 Constraint 350 467 0.8000 1.0000 1.5000 0.0000 Constraint 350 461 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 742 0.8000 1.0000 1.5000 0.0000 Constraint 341 735 0.8000 1.0000 1.5000 0.0000 Constraint 341 729 0.8000 1.0000 1.5000 0.0000 Constraint 341 687 0.8000 1.0000 1.5000 0.0000 Constraint 341 651 0.8000 1.0000 1.5000 0.0000 Constraint 341 644 0.8000 1.0000 1.5000 0.0000 Constraint 341 636 0.8000 1.0000 1.5000 0.0000 Constraint 341 629 0.8000 1.0000 1.5000 0.0000 Constraint 341 544 0.8000 1.0000 1.5000 0.0000 Constraint 341 467 0.8000 1.0000 1.5000 0.0000 Constraint 341 461 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 735 0.8000 1.0000 1.5000 0.0000 Constraint 330 729 0.8000 1.0000 1.5000 0.0000 Constraint 330 511 0.8000 1.0000 1.5000 0.0000 Constraint 330 467 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 720 0.8000 1.0000 1.5000 0.0000 Constraint 322 544 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 729 0.8000 1.0000 1.5000 0.0000 Constraint 314 720 0.8000 1.0000 1.5000 0.0000 Constraint 314 687 0.8000 1.0000 1.5000 0.0000 Constraint 314 651 0.8000 1.0000 1.5000 0.0000 Constraint 314 636 0.8000 1.0000 1.5000 0.0000 Constraint 314 544 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 720 0.8000 1.0000 1.5000 0.0000 Constraint 303 687 0.8000 1.0000 1.5000 0.0000 Constraint 303 622 0.8000 1.0000 1.5000 0.0000 Constraint 303 613 0.8000 1.0000 1.5000 0.0000 Constraint 303 544 0.8000 1.0000 1.5000 0.0000 Constraint 303 511 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 729 0.8000 1.0000 1.5000 0.0000 Constraint 297 535 0.8000 1.0000 1.5000 0.0000 Constraint 297 519 0.8000 1.0000 1.5000 0.0000 Constraint 297 511 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 720 0.8000 1.0000 1.5000 0.0000 Constraint 292 713 0.8000 1.0000 1.5000 0.0000 Constraint 292 687 0.8000 1.0000 1.5000 0.0000 Constraint 292 544 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 720 0.8000 1.0000 1.5000 0.0000 Constraint 285 713 0.8000 1.0000 1.5000 0.0000 Constraint 285 687 0.8000 1.0000 1.5000 0.0000 Constraint 285 676 0.8000 1.0000 1.5000 0.0000 Constraint 285 668 0.8000 1.0000 1.5000 0.0000 Constraint 285 651 0.8000 1.0000 1.5000 0.0000 Constraint 285 636 0.8000 1.0000 1.5000 0.0000 Constraint 285 622 0.8000 1.0000 1.5000 0.0000 Constraint 285 613 0.8000 1.0000 1.5000 0.0000 Constraint 285 544 0.8000 1.0000 1.5000 0.0000 Constraint 285 511 0.8000 1.0000 1.5000 0.0000 Constraint 285 461 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 729 0.8000 1.0000 1.5000 0.0000 Constraint 279 720 0.8000 1.0000 1.5000 0.0000 Constraint 279 713 0.8000 1.0000 1.5000 0.0000 Constraint 279 687 0.8000 1.0000 1.5000 0.0000 Constraint 279 644 0.8000 1.0000 1.5000 0.0000 Constraint 279 622 0.8000 1.0000 1.5000 0.0000 Constraint 279 613 0.8000 1.0000 1.5000 0.0000 Constraint 279 590 0.8000 1.0000 1.5000 0.0000 Constraint 279 585 0.8000 1.0000 1.5000 0.0000 Constraint 279 557 0.8000 1.0000 1.5000 0.0000 Constraint 279 544 0.8000 1.0000 1.5000 0.0000 Constraint 279 535 0.8000 1.0000 1.5000 0.0000 Constraint 279 527 0.8000 1.0000 1.5000 0.0000 Constraint 279 519 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 497 0.8000 1.0000 1.5000 0.0000 Constraint 279 480 0.8000 1.0000 1.5000 0.0000 Constraint 279 473 0.8000 1.0000 1.5000 0.0000 Constraint 279 461 0.8000 1.0000 1.5000 0.0000 Constraint 279 449 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 729 0.8000 1.0000 1.5000 0.0000 Constraint 272 720 0.8000 1.0000 1.5000 0.0000 Constraint 272 713 0.8000 1.0000 1.5000 0.0000 Constraint 272 687 0.8000 1.0000 1.5000 0.0000 Constraint 272 613 0.8000 1.0000 1.5000 0.0000 Constraint 272 590 0.8000 1.0000 1.5000 0.0000 Constraint 272 585 0.8000 1.0000 1.5000 0.0000 Constraint 272 557 0.8000 1.0000 1.5000 0.0000 Constraint 272 544 0.8000 1.0000 1.5000 0.0000 Constraint 272 535 0.8000 1.0000 1.5000 0.0000 Constraint 272 527 0.8000 1.0000 1.5000 0.0000 Constraint 272 519 0.8000 1.0000 1.5000 0.0000 Constraint 272 511 0.8000 1.0000 1.5000 0.0000 Constraint 272 497 0.8000 1.0000 1.5000 0.0000 Constraint 272 461 0.8000 1.0000 1.5000 0.0000 Constraint 272 375 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 720 0.8000 1.0000 1.5000 0.0000 Constraint 267 713 0.8000 1.0000 1.5000 0.0000 Constraint 267 706 0.8000 1.0000 1.5000 0.0000 Constraint 267 698 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 676 0.8000 1.0000 1.5000 0.0000 Constraint 267 668 0.8000 1.0000 1.5000 0.0000 Constraint 267 657 0.8000 1.0000 1.5000 0.0000 Constraint 267 651 0.8000 1.0000 1.5000 0.0000 Constraint 267 644 0.8000 1.0000 1.5000 0.0000 Constraint 267 636 0.8000 1.0000 1.5000 0.0000 Constraint 267 622 0.8000 1.0000 1.5000 0.0000 Constraint 267 613 0.8000 1.0000 1.5000 0.0000 Constraint 267 590 0.8000 1.0000 1.5000 0.0000 Constraint 267 585 0.8000 1.0000 1.5000 0.0000 Constraint 267 557 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 535 0.8000 1.0000 1.5000 0.0000 Constraint 267 527 0.8000 1.0000 1.5000 0.0000 Constraint 267 519 0.8000 1.0000 1.5000 0.0000 Constraint 267 511 0.8000 1.0000 1.5000 0.0000 Constraint 267 497 0.8000 1.0000 1.5000 0.0000 Constraint 267 473 0.8000 1.0000 1.5000 0.0000 Constraint 267 467 0.8000 1.0000 1.5000 0.0000 Constraint 267 461 0.8000 1.0000 1.5000 0.0000 Constraint 267 435 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 713 0.8000 1.0000 1.5000 0.0000 Constraint 259 706 0.8000 1.0000 1.5000 0.0000 Constraint 259 687 0.8000 1.0000 1.5000 0.0000 Constraint 259 676 0.8000 1.0000 1.5000 0.0000 Constraint 259 657 0.8000 1.0000 1.5000 0.0000 Constraint 259 651 0.8000 1.0000 1.5000 0.0000 Constraint 259 636 0.8000 1.0000 1.5000 0.0000 Constraint 259 544 0.8000 1.0000 1.5000 0.0000 Constraint 259 467 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 687 0.8000 1.0000 1.5000 0.0000 Constraint 250 676 0.8000 1.0000 1.5000 0.0000 Constraint 250 657 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 644 0.8000 1.0000 1.5000 0.0000 Constraint 250 636 0.8000 1.0000 1.5000 0.0000 Constraint 250 535 0.8000 1.0000 1.5000 0.0000 Constraint 250 467 0.8000 1.0000 1.5000 0.0000 Constraint 250 341 0.8000 1.0000 1.5000 0.0000 Constraint 250 330 0.8000 1.0000 1.5000 0.0000 Constraint 250 322 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 742 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 713 0.8000 1.0000 1.5000 0.0000 Constraint 242 706 0.8000 1.0000 1.5000 0.0000 Constraint 242 687 0.8000 1.0000 1.5000 0.0000 Constraint 242 676 0.8000 1.0000 1.5000 0.0000 Constraint 242 651 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 742 0.8000 1.0000 1.5000 0.0000 Constraint 237 735 0.8000 1.0000 1.5000 0.0000 Constraint 237 729 0.8000 1.0000 1.5000 0.0000 Constraint 237 720 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 355 0.8000 1.0000 1.5000 0.0000 Constraint 237 350 0.8000 1.0000 1.5000 0.0000 Constraint 237 341 0.8000 1.0000 1.5000 0.0000 Constraint 237 330 0.8000 1.0000 1.5000 0.0000 Constraint 237 303 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 742 0.8000 1.0000 1.5000 0.0000 Constraint 226 735 0.8000 1.0000 1.5000 0.0000 Constraint 226 729 0.8000 1.0000 1.5000 0.0000 Constraint 226 720 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 706 0.8000 1.0000 1.5000 0.0000 Constraint 226 651 0.8000 1.0000 1.5000 0.0000 Constraint 226 585 0.8000 1.0000 1.5000 0.0000 Constraint 226 557 0.8000 1.0000 1.5000 0.0000 Constraint 226 544 0.8000 1.0000 1.5000 0.0000 Constraint 226 535 0.8000 1.0000 1.5000 0.0000 Constraint 226 497 0.8000 1.0000 1.5000 0.0000 Constraint 226 473 0.8000 1.0000 1.5000 0.0000 Constraint 226 467 0.8000 1.0000 1.5000 0.0000 Constraint 226 461 0.8000 1.0000 1.5000 0.0000 Constraint 226 375 0.8000 1.0000 1.5000 0.0000 Constraint 226 368 0.8000 1.0000 1.5000 0.0000 Constraint 226 355 0.8000 1.0000 1.5000 0.0000 Constraint 226 350 0.8000 1.0000 1.5000 0.0000 Constraint 226 341 0.8000 1.0000 1.5000 0.0000 Constraint 226 330 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 742 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 729 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 713 0.8000 1.0000 1.5000 0.0000 Constraint 221 706 0.8000 1.0000 1.5000 0.0000 Constraint 221 687 0.8000 1.0000 1.5000 0.0000 Constraint 221 676 0.8000 1.0000 1.5000 0.0000 Constraint 221 651 0.8000 1.0000 1.5000 0.0000 Constraint 221 544 0.8000 1.0000 1.5000 0.0000 Constraint 221 535 0.8000 1.0000 1.5000 0.0000 Constraint 221 375 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 742 0.8000 1.0000 1.5000 0.0000 Constraint 210 735 0.8000 1.0000 1.5000 0.0000 Constraint 210 729 0.8000 1.0000 1.5000 0.0000 Constraint 210 720 0.8000 1.0000 1.5000 0.0000 Constraint 210 713 0.8000 1.0000 1.5000 0.0000 Constraint 210 706 0.8000 1.0000 1.5000 0.0000 Constraint 210 375 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 706 0.8000 1.0000 1.5000 0.0000 Constraint 201 557 0.8000 1.0000 1.5000 0.0000 Constraint 201 544 0.8000 1.0000 1.5000 0.0000 Constraint 201 535 0.8000 1.0000 1.5000 0.0000 Constraint 201 497 0.8000 1.0000 1.5000 0.0000 Constraint 201 480 0.8000 1.0000 1.5000 0.0000 Constraint 201 404 0.8000 1.0000 1.5000 0.0000 Constraint 201 399 0.8000 1.0000 1.5000 0.0000 Constraint 201 382 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 368 0.8000 1.0000 1.5000 0.0000 Constraint 201 355 0.8000 1.0000 1.5000 0.0000 Constraint 201 350 0.8000 1.0000 1.5000 0.0000 Constraint 201 341 0.8000 1.0000 1.5000 0.0000 Constraint 201 330 0.8000 1.0000 1.5000 0.0000 Constraint 201 303 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 742 0.8000 1.0000 1.5000 0.0000 Constraint 190 735 0.8000 1.0000 1.5000 0.0000 Constraint 190 720 0.8000 1.0000 1.5000 0.0000 Constraint 190 713 0.8000 1.0000 1.5000 0.0000 Constraint 190 687 0.8000 1.0000 1.5000 0.0000 Constraint 190 613 0.8000 1.0000 1.5000 0.0000 Constraint 190 590 0.8000 1.0000 1.5000 0.0000 Constraint 190 585 0.8000 1.0000 1.5000 0.0000 Constraint 190 571 0.8000 1.0000 1.5000 0.0000 Constraint 190 557 0.8000 1.0000 1.5000 0.0000 Constraint 190 544 0.8000 1.0000 1.5000 0.0000 Constraint 190 535 0.8000 1.0000 1.5000 0.0000 Constraint 190 519 0.8000 1.0000 1.5000 0.0000 Constraint 190 511 0.8000 1.0000 1.5000 0.0000 Constraint 190 497 0.8000 1.0000 1.5000 0.0000 Constraint 190 480 0.8000 1.0000 1.5000 0.0000 Constraint 190 467 0.8000 1.0000 1.5000 0.0000 Constraint 190 461 0.8000 1.0000 1.5000 0.0000 Constraint 190 435 0.8000 1.0000 1.5000 0.0000 Constraint 190 429 0.8000 1.0000 1.5000 0.0000 Constraint 190 404 0.8000 1.0000 1.5000 0.0000 Constraint 190 399 0.8000 1.0000 1.5000 0.0000 Constraint 190 382 0.8000 1.0000 1.5000 0.0000 Constraint 190 375 0.8000 1.0000 1.5000 0.0000 Constraint 190 368 0.8000 1.0000 1.5000 0.0000 Constraint 190 360 0.8000 1.0000 1.5000 0.0000 Constraint 190 355 0.8000 1.0000 1.5000 0.0000 Constraint 190 350 0.8000 1.0000 1.5000 0.0000 Constraint 190 341 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 742 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 720 0.8000 1.0000 1.5000 0.0000 Constraint 182 511 0.8000 1.0000 1.5000 0.0000 Constraint 182 375 0.8000 1.0000 1.5000 0.0000 Constraint 182 355 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 720 0.8000 1.0000 1.5000 0.0000 Constraint 176 713 0.8000 1.0000 1.5000 0.0000 Constraint 176 571 0.8000 1.0000 1.5000 0.0000 Constraint 176 557 0.8000 1.0000 1.5000 0.0000 Constraint 176 552 0.8000 1.0000 1.5000 0.0000 Constraint 176 544 0.8000 1.0000 1.5000 0.0000 Constraint 176 535 0.8000 1.0000 1.5000 0.0000 Constraint 176 527 0.8000 1.0000 1.5000 0.0000 Constraint 176 519 0.8000 1.0000 1.5000 0.0000 Constraint 176 511 0.8000 1.0000 1.5000 0.0000 Constraint 176 497 0.8000 1.0000 1.5000 0.0000 Constraint 176 489 0.8000 1.0000 1.5000 0.0000 Constraint 176 461 0.8000 1.0000 1.5000 0.0000 Constraint 176 399 0.8000 1.0000 1.5000 0.0000 Constraint 176 382 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 368 0.8000 1.0000 1.5000 0.0000 Constraint 176 360 0.8000 1.0000 1.5000 0.0000 Constraint 176 355 0.8000 1.0000 1.5000 0.0000 Constraint 176 350 0.8000 1.0000 1.5000 0.0000 Constraint 176 341 0.8000 1.0000 1.5000 0.0000 Constraint 176 250 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 720 0.8000 1.0000 1.5000 0.0000 Constraint 169 713 0.8000 1.0000 1.5000 0.0000 Constraint 169 706 0.8000 1.0000 1.5000 0.0000 Constraint 169 571 0.8000 1.0000 1.5000 0.0000 Constraint 169 382 0.8000 1.0000 1.5000 0.0000 Constraint 169 375 0.8000 1.0000 1.5000 0.0000 Constraint 169 368 0.8000 1.0000 1.5000 0.0000 Constraint 169 355 0.8000 1.0000 1.5000 0.0000 Constraint 169 303 0.8000 1.0000 1.5000 0.0000 Constraint 169 279 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 713 0.8000 1.0000 1.5000 0.0000 Constraint 161 706 0.8000 1.0000 1.5000 0.0000 Constraint 161 687 0.8000 1.0000 1.5000 0.0000 Constraint 161 557 0.8000 1.0000 1.5000 0.0000 Constraint 161 552 0.8000 1.0000 1.5000 0.0000 Constraint 161 527 0.8000 1.0000 1.5000 0.0000 Constraint 161 429 0.8000 1.0000 1.5000 0.0000 Constraint 161 404 0.8000 1.0000 1.5000 0.0000 Constraint 161 399 0.8000 1.0000 1.5000 0.0000 Constraint 161 391 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 360 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 350 0.8000 1.0000 1.5000 0.0000 Constraint 161 341 0.8000 1.0000 1.5000 0.0000 Constraint 161 330 0.8000 1.0000 1.5000 0.0000 Constraint 161 314 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 297 0.8000 1.0000 1.5000 0.0000 Constraint 161 285 0.8000 1.0000 1.5000 0.0000 Constraint 161 279 0.8000 1.0000 1.5000 0.0000 Constraint 161 267 0.8000 1.0000 1.5000 0.0000 Constraint 161 259 0.8000 1.0000 1.5000 0.0000 Constraint 161 250 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 742 0.8000 1.0000 1.5000 0.0000 Constraint 153 713 0.8000 1.0000 1.5000 0.0000 Constraint 153 706 0.8000 1.0000 1.5000 0.0000 Constraint 153 404 0.8000 1.0000 1.5000 0.0000 Constraint 153 382 0.8000 1.0000 1.5000 0.0000 Constraint 153 375 0.8000 1.0000 1.5000 0.0000 Constraint 153 368 0.8000 1.0000 1.5000 0.0000 Constraint 153 360 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 350 0.8000 1.0000 1.5000 0.0000 Constraint 153 330 0.8000 1.0000 1.5000 0.0000 Constraint 153 303 0.8000 1.0000 1.5000 0.0000 Constraint 153 285 0.8000 1.0000 1.5000 0.0000 Constraint 153 279 0.8000 1.0000 1.5000 0.0000 Constraint 153 267 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 742 0.8000 1.0000 1.5000 0.0000 Constraint 144 735 0.8000 1.0000 1.5000 0.0000 Constraint 144 729 0.8000 1.0000 1.5000 0.0000 Constraint 144 720 0.8000 1.0000 1.5000 0.0000 Constraint 144 713 0.8000 1.0000 1.5000 0.0000 Constraint 144 706 0.8000 1.0000 1.5000 0.0000 Constraint 144 698 0.8000 1.0000 1.5000 0.0000 Constraint 144 687 0.8000 1.0000 1.5000 0.0000 Constraint 144 382 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 368 0.8000 1.0000 1.5000 0.0000 Constraint 144 360 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 350 0.8000 1.0000 1.5000 0.0000 Constraint 144 330 0.8000 1.0000 1.5000 0.0000 Constraint 144 303 0.8000 1.0000 1.5000 0.0000 Constraint 144 297 0.8000 1.0000 1.5000 0.0000 Constraint 144 285 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 272 0.8000 1.0000 1.5000 0.0000 Constraint 144 267 0.8000 1.0000 1.5000 0.0000 Constraint 144 259 0.8000 1.0000 1.5000 0.0000 Constraint 144 250 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 742 0.8000 1.0000 1.5000 0.0000 Constraint 136 735 0.8000 1.0000 1.5000 0.0000 Constraint 136 729 0.8000 1.0000 1.5000 0.0000 Constraint 136 720 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 698 0.8000 1.0000 1.5000 0.0000 Constraint 136 571 0.8000 1.0000 1.5000 0.0000 Constraint 136 435 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 360 0.8000 1.0000 1.5000 0.0000 Constraint 136 355 0.8000 1.0000 1.5000 0.0000 Constraint 136 285 0.8000 1.0000 1.5000 0.0000 Constraint 136 279 0.8000 1.0000 1.5000 0.0000 Constraint 136 267 0.8000 1.0000 1.5000 0.0000 Constraint 136 259 0.8000 1.0000 1.5000 0.0000 Constraint 136 250 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 742 0.8000 1.0000 1.5000 0.0000 Constraint 128 735 0.8000 1.0000 1.5000 0.0000 Constraint 128 729 0.8000 1.0000 1.5000 0.0000 Constraint 128 720 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 687 0.8000 1.0000 1.5000 0.0000 Constraint 128 571 0.8000 1.0000 1.5000 0.0000 Constraint 128 375 0.8000 1.0000 1.5000 0.0000 Constraint 128 368 0.8000 1.0000 1.5000 0.0000 Constraint 128 355 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 687 0.8000 1.0000 1.5000 0.0000 Constraint 122 355 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 713 0.8000 1.0000 1.5000 0.0000 Constraint 113 706 0.8000 1.0000 1.5000 0.0000 Constraint 113 698 0.8000 1.0000 1.5000 0.0000 Constraint 113 571 0.8000 1.0000 1.5000 0.0000 Constraint 113 375 0.8000 1.0000 1.5000 0.0000 Constraint 113 368 0.8000 1.0000 1.5000 0.0000 Constraint 113 279 0.8000 1.0000 1.5000 0.0000 Constraint 113 267 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 706 0.8000 1.0000 1.5000 0.0000 Constraint 104 544 0.8000 1.0000 1.5000 0.0000 Constraint 104 375 0.8000 1.0000 1.5000 0.0000 Constraint 104 267 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 698 0.8000 1.0000 1.5000 0.0000 Constraint 96 687 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 713 0.8000 1.0000 1.5000 0.0000 Constraint 88 706 0.8000 1.0000 1.5000 0.0000 Constraint 88 687 0.8000 1.0000 1.5000 0.0000 Constraint 88 676 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 668 0.8000 1.0000 1.5000 0.0000 Constraint 80 590 0.8000 1.0000 1.5000 0.0000 Constraint 80 577 0.8000 1.0000 1.5000 0.0000 Constraint 80 571 0.8000 1.0000 1.5000 0.0000 Constraint 80 435 0.8000 1.0000 1.5000 0.0000 Constraint 80 368 0.8000 1.0000 1.5000 0.0000 Constraint 80 279 0.8000 1.0000 1.5000 0.0000 Constraint 80 272 0.8000 1.0000 1.5000 0.0000 Constraint 80 267 0.8000 1.0000 1.5000 0.0000 Constraint 80 190 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 577 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 552 0.8000 1.0000 1.5000 0.0000 Constraint 69 544 0.8000 1.0000 1.5000 0.0000 Constraint 69 535 0.8000 1.0000 1.5000 0.0000 Constraint 69 435 0.8000 1.0000 1.5000 0.0000 Constraint 69 272 0.8000 1.0000 1.5000 0.0000 Constraint 69 250 0.8000 1.0000 1.5000 0.0000 Constraint 69 237 0.8000 1.0000 1.5000 0.0000 Constraint 69 226 0.8000 1.0000 1.5000 0.0000 Constraint 69 201 0.8000 1.0000 1.5000 0.0000 Constraint 69 190 0.8000 1.0000 1.5000 0.0000 Constraint 69 182 0.8000 1.0000 1.5000 0.0000 Constraint 69 176 0.8000 1.0000 1.5000 0.0000 Constraint 69 169 0.8000 1.0000 1.5000 0.0000 Constraint 69 161 0.8000 1.0000 1.5000 0.0000 Constraint 69 153 0.8000 1.0000 1.5000 0.0000 Constraint 69 144 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 585 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 557 0.8000 1.0000 1.5000 0.0000 Constraint 58 552 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 535 0.8000 1.0000 1.5000 0.0000 Constraint 58 480 0.8000 1.0000 1.5000 0.0000 Constraint 58 473 0.8000 1.0000 1.5000 0.0000 Constraint 58 467 0.8000 1.0000 1.5000 0.0000 Constraint 58 461 0.8000 1.0000 1.5000 0.0000 Constraint 58 442 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 429 0.8000 1.0000 1.5000 0.0000 Constraint 58 412 0.8000 1.0000 1.5000 0.0000 Constraint 58 404 0.8000 1.0000 1.5000 0.0000 Constraint 58 391 0.8000 1.0000 1.5000 0.0000 Constraint 58 382 0.8000 1.0000 1.5000 0.0000 Constraint 58 279 0.8000 1.0000 1.5000 0.0000 Constraint 58 272 0.8000 1.0000 1.5000 0.0000 Constraint 58 267 0.8000 1.0000 1.5000 0.0000 Constraint 58 250 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 221 0.8000 1.0000 1.5000 0.0000 Constraint 58 210 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 182 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 169 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 153 0.8000 1.0000 1.5000 0.0000 Constraint 58 144 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 467 0.8000 1.0000 1.5000 0.0000 Constraint 51 442 0.8000 1.0000 1.5000 0.0000 Constraint 51 435 0.8000 1.0000 1.5000 0.0000 Constraint 51 412 0.8000 1.0000 1.5000 0.0000 Constraint 51 404 0.8000 1.0000 1.5000 0.0000 Constraint 51 391 0.8000 1.0000 1.5000 0.0000 Constraint 51 382 0.8000 1.0000 1.5000 0.0000 Constraint 51 368 0.8000 1.0000 1.5000 0.0000 Constraint 51 350 0.8000 1.0000 1.5000 0.0000 Constraint 51 341 0.8000 1.0000 1.5000 0.0000 Constraint 51 330 0.8000 1.0000 1.5000 0.0000 Constraint 51 297 0.8000 1.0000 1.5000 0.0000 Constraint 51 279 0.8000 1.0000 1.5000 0.0000 Constraint 51 272 0.8000 1.0000 1.5000 0.0000 Constraint 51 267 0.8000 1.0000 1.5000 0.0000 Constraint 51 226 0.8000 1.0000 1.5000 0.0000 Constraint 51 221 0.8000 1.0000 1.5000 0.0000 Constraint 51 201 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 182 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 169 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 153 0.8000 1.0000 1.5000 0.0000 Constraint 51 136 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 473 0.8000 1.0000 1.5000 0.0000 Constraint 41 467 0.8000 1.0000 1.5000 0.0000 Constraint 41 461 0.8000 1.0000 1.5000 0.0000 Constraint 41 449 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 429 0.8000 1.0000 1.5000 0.0000 Constraint 41 421 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 399 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 375 0.8000 1.0000 1.5000 0.0000 Constraint 41 368 0.8000 1.0000 1.5000 0.0000 Constraint 41 360 0.8000 1.0000 1.5000 0.0000 Constraint 41 350 0.8000 1.0000 1.5000 0.0000 Constraint 41 341 0.8000 1.0000 1.5000 0.0000 Constraint 41 330 0.8000 1.0000 1.5000 0.0000 Constraint 41 322 0.8000 1.0000 1.5000 0.0000 Constraint 41 314 0.8000 1.0000 1.5000 0.0000 Constraint 41 303 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 292 0.8000 1.0000 1.5000 0.0000 Constraint 41 285 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 267 0.8000 1.0000 1.5000 0.0000 Constraint 41 237 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 221 0.8000 1.0000 1.5000 0.0000 Constraint 41 210 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 144 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 122 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 489 0.8000 1.0000 1.5000 0.0000 Constraint 33 480 0.8000 1.0000 1.5000 0.0000 Constraint 33 473 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 461 0.8000 1.0000 1.5000 0.0000 Constraint 33 449 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 429 0.8000 1.0000 1.5000 0.0000 Constraint 33 421 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 404 0.8000 1.0000 1.5000 0.0000 Constraint 33 399 0.8000 1.0000 1.5000 0.0000 Constraint 33 391 0.8000 1.0000 1.5000 0.0000 Constraint 33 382 0.8000 1.0000 1.5000 0.0000 Constraint 33 368 0.8000 1.0000 1.5000 0.0000 Constraint 33 360 0.8000 1.0000 1.5000 0.0000 Constraint 33 350 0.8000 1.0000 1.5000 0.0000 Constraint 33 341 0.8000 1.0000 1.5000 0.0000 Constraint 33 330 0.8000 1.0000 1.5000 0.0000 Constraint 33 322 0.8000 1.0000 1.5000 0.0000 Constraint 33 303 0.8000 1.0000 1.5000 0.0000 Constraint 33 297 0.8000 1.0000 1.5000 0.0000 Constraint 33 292 0.8000 1.0000 1.5000 0.0000 Constraint 33 279 0.8000 1.0000 1.5000 0.0000 Constraint 33 272 0.8000 1.0000 1.5000 0.0000 Constraint 33 267 0.8000 1.0000 1.5000 0.0000 Constraint 33 237 0.8000 1.0000 1.5000 0.0000 Constraint 33 226 0.8000 1.0000 1.5000 0.0000 Constraint 33 221 0.8000 1.0000 1.5000 0.0000 Constraint 33 210 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 144 0.8000 1.0000 1.5000 0.0000 Constraint 33 136 0.8000 1.0000 1.5000 0.0000 Constraint 33 128 0.8000 1.0000 1.5000 0.0000 Constraint 33 122 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: