# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 14.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 201 297 10.2862 12.8577 19.2866 84.0290 Constraint 259 322 9.2821 11.6026 17.4039 83.5350 Constraint 176 322 9.3381 11.6727 17.5090 82.9643 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 242 303 10.1032 12.6290 18.9435 82.0237 Constraint 242 322 9.7236 12.1545 18.2318 82.0187 Constraint 169 242 8.9184 11.1480 16.7220 80.7404 Constraint 169 272 9.6424 12.0530 18.0795 80.0156 Constraint 169 322 9.1779 11.4724 17.2086 80.0104 Constraint 292 421 6.4154 8.0192 12.0288 78.3386 Constraint 210 421 5.9486 7.4357 11.1536 78.3386 Constraint 242 421 4.9975 6.2469 9.3703 77.3930 Constraint 201 322 10.5577 13.1971 19.7956 77.3060 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 292 399 9.4380 11.7974 17.6962 76.7408 Constraint 314 421 6.0467 7.5584 11.3375 76.7248 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 285 421 8.0716 10.0895 15.1342 76.3384 Constraint 259 421 6.8013 8.5016 12.7524 76.3384 Constraint 292 412 8.6583 10.8229 16.2344 76.2453 Constraint 210 412 8.0514 10.0642 15.0963 76.2453 Constraint 128 292 7.3031 9.1288 13.6933 75.9352 Constraint 242 399 8.2128 10.2660 15.3990 75.9001 Constraint 128 297 9.1592 11.4490 17.1735 75.6352 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 182 421 9.0320 11.2899 16.9349 75.3467 Constraint 176 259 10.3388 12.9235 19.3852 75.1200 Constraint 259 399 9.2037 11.5046 17.2569 74.8455 Constraint 314 412 8.8232 11.0290 16.5434 74.6316 Constraint 210 429 9.0269 11.2836 16.9254 74.5512 Constraint 242 404 7.9861 9.9826 14.9740 74.4972 Constraint 169 421 8.9363 11.1703 16.7555 74.4421 Constraint 285 412 8.8971 11.1214 16.6820 74.2451 Constraint 259 412 6.5640 8.2050 12.3075 74.2451 Constraint 314 429 8.9231 11.1539 16.7309 74.1680 Constraint 237 421 7.3203 9.1504 13.7256 73.8931 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 104 182 7.8144 9.7680 14.6520 73.8419 Constraint 322 421 7.8878 9.8598 14.7897 73.6335 Constraint 221 421 7.7536 9.6921 14.5381 73.5514 Constraint 242 429 8.0137 10.0172 15.0258 73.5126 Constraint 242 412 4.1686 5.2107 7.8160 73.5126 Constraint 285 399 9.4900 11.8625 17.7937 73.1870 Constraint 303 421 9.4177 11.7721 17.6582 73.1700 Constraint 128 221 8.5572 10.6964 16.0447 72.6352 Constraint 292 442 8.2565 10.3207 15.4810 72.5666 Constraint 210 399 10.1395 12.6744 19.0115 72.4428 Constraint 285 350 6.8799 8.5999 12.8999 72.4076 Constraint 128 272 9.9225 12.4031 18.6046 71.8728 Constraint 237 412 6.7497 8.4371 12.6557 71.7999 Constraint 250 412 6.0105 7.5132 11.2697 71.6214 Constraint 242 435 6.9985 8.7481 13.1221 71.5279 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 221 412 8.5636 10.7045 16.0568 71.4582 Constraint 104 297 8.5355 10.6694 16.0040 71.4551 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 122 201 9.5096 11.8870 17.8305 71.3017 Constraint 210 442 5.0969 6.3711 9.5567 71.1401 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 285 355 9.1805 11.4757 17.2135 70.9446 Constraint 96 303 9.1839 11.4798 17.2198 70.8477 Constraint 96 297 8.5703 10.7129 16.0693 70.8477 Constraint 104 314 7.7231 9.6538 14.4807 70.6287 Constraint 297 421 9.5179 11.8974 17.8461 70.4347 Constraint 242 442 4.6754 5.8442 8.7664 70.1945 Constraint 237 435 7.3795 9.2244 13.8366 69.8153 Constraint 169 297 10.3704 12.9630 19.4446 69.7487 Constraint 201 421 9.5731 11.9663 17.9495 68.8000 Constraint 279 341 8.2183 10.2729 15.4094 68.7412 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 96 169 8.0269 10.0337 15.0505 68.4859 Constraint 237 442 4.1481 5.1852 7.7777 68.4818 Constraint 201 442 7.2475 9.0593 13.5890 68.4818 Constraint 314 442 9.6223 12.0278 18.0417 68.4419 Constraint 113 210 9.6951 12.1188 18.1783 68.3113 Constraint 169 442 6.8572 8.5715 12.8573 68.2142 Constraint 259 442 7.8127 9.7659 14.6489 67.9024 Constraint 250 314 10.6375 13.2969 19.9454 67.8960 Constraint 96 221 9.4238 11.7798 17.6697 67.8477 Constraint 237 404 10.2827 12.8534 19.2801 67.7844 Constraint 104 421 9.2382 11.5478 17.3216 67.5965 Constraint 322 399 9.5799 11.9749 17.9623 67.5753 Constraint 210 435 8.8089 11.0112 16.5167 67.4734 Constraint 221 442 7.6298 9.5372 14.3058 67.4733 Constraint 285 391 6.6161 8.2701 12.4051 67.3876 Constraint 314 404 9.6570 12.0712 18.1068 67.3623 Constraint 250 421 8.2163 10.2704 15.4056 67.0503 Constraint 128 314 8.4966 10.6208 15.9312 67.0330 Constraint 96 176 9.9571 12.4464 18.6696 66.8314 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 104 176 9.1231 11.4038 17.1057 66.6563 Constraint 128 421 7.5439 9.4299 14.1448 66.5984 Constraint 122 322 8.5786 10.7232 16.0849 66.2966 Constraint 292 391 7.5353 9.4191 14.1287 66.1731 Constraint 242 391 5.9263 7.4078 11.1117 66.1420 Constraint 242 382 8.3216 10.4019 15.6029 66.1420 Constraint 226 297 10.7955 13.4943 20.2415 66.0636 Constraint 88 210 9.7586 12.1983 18.2974 65.8668 Constraint 226 412 9.2780 11.5975 17.3962 65.8000 Constraint 96 429 7.8436 9.8045 14.7067 65.5215 Constraint 314 391 6.3154 7.8942 11.8413 65.4738 Constraint 96 399 7.8101 9.7626 14.6439 65.4532 Constraint 210 449 6.1451 7.6814 11.5221 65.2755 Constraint 128 237 8.4146 10.5182 15.7773 65.1629 Constraint 259 391 5.9522 7.4403 11.1604 65.0874 Constraint 250 404 9.6314 12.0392 18.0588 65.0351 Constraint 226 442 7.4546 9.3183 13.9774 64.8151 Constraint 285 360 7.0526 8.8157 13.2236 64.5166 Constraint 96 421 5.6457 7.0571 10.5856 64.5052 Constraint 96 412 9.6227 12.0284 18.0427 64.5052 Constraint 182 442 9.3180 11.6475 17.4712 64.4816 Constraint 176 442 9.6651 12.0813 18.1220 64.4816 Constraint 237 429 9.2190 11.5238 17.2857 64.3920 Constraint 128 442 7.7017 9.6271 14.4407 64.3692 Constraint 250 382 8.8522 11.0653 16.5979 64.2508 Constraint 226 421 9.5487 11.9359 17.9039 64.2288 Constraint 122 421 7.4323 9.2904 13.9355 63.9402 Constraint 242 360 8.5295 10.6619 15.9929 63.5710 Constraint 201 285 10.7890 13.4863 20.2294 63.3847 Constraint 113 322 8.4174 10.5218 15.7826 63.3080 Constraint 292 360 7.7896 9.7370 14.6055 63.3022 Constraint 259 404 9.7466 12.1833 18.2750 63.2504 Constraint 210 391 8.9962 11.2452 16.8678 63.1732 Constraint 96 442 8.3633 10.4541 15.6811 63.1717 Constraint 360 429 8.5563 10.6954 16.0430 63.0519 Constraint 250 391 7.6274 9.5343 14.3014 63.0364 Constraint 136 322 8.4064 10.5080 15.7620 62.9645 Constraint 237 391 9.5130 11.8912 17.8369 62.8732 Constraint 221 391 8.8227 11.0284 16.5426 62.8731 Constraint 104 330 7.6496 9.5620 14.3430 62.8628 Constraint 88 421 8.3548 10.4436 15.6653 62.5032 Constraint 279 350 8.4097 10.5121 15.7681 62.4005 Constraint 96 242 8.3357 10.4196 15.6295 62.3539 Constraint 128 226 9.9798 12.4748 18.7122 62.2079 Constraint 314 449 9.0915 11.3644 17.0466 61.5799 Constraint 128 449 5.9601 7.4502 11.1752 61.3064 Constraint 259 360 7.9670 9.9588 14.9382 61.3020 Constraint 169 449 6.5262 8.1578 12.2367 61.2411 Constraint 96 201 10.1281 12.6601 18.9902 61.1814 Constraint 104 341 9.9979 12.4974 18.7460 61.0540 Constraint 88 429 8.4531 10.5664 15.8496 61.0118 Constraint 104 303 9.8719 12.3399 18.5098 60.8006 Constraint 104 449 8.6422 10.8028 16.2042 60.7107 Constraint 128 242 8.4296 10.5370 15.8056 60.5552 Constraint 176 279 10.7239 13.4049 20.1073 60.5284 Constraint 201 449 8.7607 10.9509 16.4264 60.5240 Constraint 88 314 8.1659 10.2073 15.3110 60.3818 Constraint 122 429 7.6590 9.5737 14.3606 60.3555 Constraint 182 341 10.6253 13.2816 19.9223 60.2056 Constraint 128 330 10.1969 12.7461 19.1192 60.1610 Constraint 303 368 9.5185 11.8981 17.8471 60.0484 Constraint 122 237 8.8877 11.1097 16.6645 59.9016 Constraint 292 449 8.6465 10.8081 16.2122 59.7927 Constraint 136 449 9.1917 11.4896 17.2344 59.7401 Constraint 314 375 9.6365 12.0456 18.0684 59.7075 Constraint 242 449 7.2829 9.1036 13.6554 59.6657 Constraint 355 421 10.2398 12.7998 19.1997 59.6538 Constraint 250 442 7.1437 8.9296 13.3944 59.4926 Constraint 250 435 8.6842 10.8552 16.2829 59.4926 Constraint 322 449 9.0565 11.3206 16.9809 59.4867 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 242 368 9.3170 11.6462 17.4693 59.3566 Constraint 350 421 9.4935 11.8669 17.8003 59.2715 Constraint 161 237 10.0091 12.5114 18.7671 59.2434 Constraint 314 382 9.8133 12.2666 18.3998 59.2200 Constraint 404 467 8.3273 10.4091 15.6137 59.2132 Constraint 96 461 7.7945 9.7431 14.6146 59.2132 Constraint 96 449 5.9865 7.4831 11.2247 59.2132 Constraint 96 435 10.3848 12.9810 19.4715 59.2132 Constraint 259 382 8.7517 10.9396 16.4094 59.0983 Constraint 122 442 7.9054 9.8817 14.8226 59.0220 Constraint 190 442 9.7428 12.1785 18.2677 58.8233 Constraint 128 461 8.6201 10.7751 16.1626 58.3946 Constraint 259 368 8.8165 11.0206 16.5309 58.3023 Constraint 136 292 10.1781 12.7226 19.0839 58.1815 Constraint 113 421 10.1840 12.7300 19.0950 58.0671 Constraint 96 341 9.6214 12.0268 18.0401 58.0597 Constraint 210 360 10.0298 12.5373 18.8059 57.9799 Constraint 221 449 9.5207 11.9008 17.8513 57.6113 Constraint 161 449 9.6908 12.1135 18.1702 57.4776 Constraint 122 449 4.7874 5.9843 8.9765 57.4567 Constraint 399 467 8.7376 10.9220 16.3829 57.4260 Constraint 399 461 8.4915 10.6144 15.9216 57.4260 Constraint 297 360 9.3346 11.6683 17.5025 57.3131 Constraint 285 368 8.3193 10.3992 15.5988 57.3131 Constraint 182 449 9.5758 11.9697 17.9545 57.2705 Constraint 176 449 10.1627 12.7033 19.0550 57.2705 Constraint 122 435 9.7154 12.1442 18.2164 57.1888 Constraint 267 391 8.9518 11.1898 16.7847 57.0912 Constraint 122 292 9.1739 11.4674 17.2010 56.9016 Constraint 122 242 9.0369 11.2961 16.9441 56.9016 Constraint 113 449 8.4382 10.5478 15.8217 56.8610 Constraint 153 421 9.2888 11.6110 17.4165 56.8479 Constraint 96 350 8.8495 11.0619 16.5928 56.8453 Constraint 88 292 9.9862 12.4827 18.7241 56.2426 Constraint 128 429 9.3869 11.7337 17.6005 56.2146 Constraint 88 399 8.7108 10.8885 16.3327 56.1594 Constraint 176 267 10.5892 13.2365 19.8547 56.0508 Constraint 285 382 9.7073 12.1341 18.2011 55.7240 Constraint 122 314 9.3461 11.6826 17.5239 55.6121 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 96 285 9.0907 11.3634 17.0451 55.4990 Constraint 122 461 5.6204 7.0255 10.5383 55.3635 Constraint 322 391 9.5682 11.9603 17.9404 55.2704 Constraint 104 461 10.2327 12.7909 19.1863 55.2279 Constraint 237 449 7.0903 8.8629 13.2943 55.1163 Constraint 88 449 7.5118 9.3897 14.0846 55.0217 Constraint 169 429 10.5239 13.1549 19.7323 54.8112 Constraint 96 237 9.7683 12.2104 18.3156 54.7879 Constraint 96 259 9.0722 11.3402 17.0103 54.7132 Constraint 259 350 8.7091 10.8864 16.3296 54.4599 Constraint 153 429 9.8049 12.2561 18.3841 54.2770 Constraint 297 391 10.1654 12.7067 19.0601 54.1841 Constraint 80 330 8.4981 10.6226 15.9338 54.1609 Constraint 96 404 10.2611 12.8264 19.2396 53.9581 Constraint 80 314 8.7036 10.8795 16.3193 53.8842 Constraint 360 442 10.4353 13.0441 19.5662 53.7421 Constraint 303 399 9.4536 11.8171 17.7256 53.7384 Constraint 128 259 9.7201 12.1502 18.2252 53.5543 Constraint 113 314 10.0924 12.6155 18.9232 53.5188 Constraint 237 314 10.4700 13.0875 19.6313 53.4499 Constraint 250 399 10.3871 12.9838 19.4758 53.1330 Constraint 272 341 10.6970 13.3712 20.0569 53.0964 Constraint 267 341 10.3376 12.9219 19.3829 53.0944 Constraint 122 467 8.7708 10.9635 16.4452 52.7925 Constraint 169 435 10.3081 12.8851 19.3277 52.6046 Constraint 259 435 9.6872 12.1090 18.1634 52.2653 Constraint 96 391 8.8294 11.0368 16.5552 52.1638 Constraint 88 461 7.0532 8.8165 13.2247 52.1099 Constraint 153 461 7.8545 9.8182 14.7273 51.8559 Constraint 153 449 5.6971 7.1214 10.6821 51.8559 Constraint 144 461 8.6075 10.7594 16.1391 51.8559 Constraint 144 449 7.8179 9.7724 14.6586 51.8559 Constraint 88 467 8.9040 11.1300 16.6950 51.8550 Constraint 210 461 9.7395 12.1744 18.2616 51.5142 Constraint 169 461 9.6788 12.0985 18.1478 51.5142 Constraint 169 314 10.7059 13.3824 20.0736 51.3512 Constraint 96 272 10.4988 13.1235 19.6853 51.3445 Constraint 404 473 5.3588 6.6985 10.0477 51.3014 Constraint 153 435 9.8791 12.3489 18.5233 51.2770 Constraint 259 341 10.5887 13.2359 19.8538 50.9866 Constraint 267 350 9.2178 11.5223 17.2834 50.4711 Constraint 161 442 10.0634 12.5792 18.8688 50.2747 Constraint 153 237 7.9245 9.9056 14.8584 50.0702 Constraint 399 480 8.2521 10.3151 15.4727 49.9190 Constraint 292 429 9.5875 11.9843 17.9765 49.6187 Constraint 404 480 9.1584 11.4480 17.1721 49.5142 Constraint 399 473 4.9051 6.1314 9.1970 49.5142 Constraint 122 399 9.6721 12.0901 18.1351 49.4944 Constraint 96 360 7.3623 9.2028 13.8042 49.2928 Constraint 113 461 8.5515 10.6894 16.0340 49.2850 Constraint 279 391 10.2222 12.7778 19.1667 49.2639 Constraint 226 449 10.1423 12.6779 19.0169 48.9627 Constraint 210 404 10.5000 13.1249 19.6874 48.5908 Constraint 250 368 10.0421 12.5527 18.8290 48.4888 Constraint 169 259 9.9006 12.3758 18.5637 48.3342 Constraint 292 368 10.0674 12.5842 18.8763 48.3132 Constraint 128 285 10.5126 13.1408 19.7111 48.1486 Constraint 201 412 10.4361 13.0452 19.5678 48.0493 Constraint 242 375 10.5043 13.1304 19.6956 47.3907 Constraint 267 330 10.9333 13.6666 20.4999 47.3709 Constraint 360 449 10.0152 12.5190 18.7785 47.0571 Constraint 322 442 10.0062 12.5078 18.7617 46.8989 Constraint 104 221 10.4246 13.0308 19.5462 46.8808 Constraint 190 314 10.8569 13.5711 20.3567 46.3981 Constraint 267 412 9.8751 12.3438 18.5158 46.3641 Constraint 88 330 10.4145 13.0181 19.5272 46.3411 Constraint 210 330 10.4749 13.0937 19.6405 46.0863 Constraint 104 201 10.3429 12.9287 19.3930 46.0223 Constraint 128 435 10.5580 13.1975 19.7963 45.7774 Constraint 113 292 10.7234 13.4043 20.1065 45.5938 Constraint 182 350 10.7130 13.3912 20.0869 45.5029 Constraint 267 421 9.6101 12.0126 18.0189 45.4676 Constraint 221 360 9.8729 12.3411 18.5117 45.3203 Constraint 80 341 10.4749 13.0936 19.6405 45.1675 Constraint 421 480 10.1427 12.6783 19.0175 45.0488 Constraint 272 421 9.6798 12.0997 18.1496 45.0386 Constraint 242 350 10.2716 12.8395 19.2593 44.5606 Constraint 96 473 9.4585 11.8231 17.7346 44.5369 Constraint 292 355 10.3250 12.9062 19.3593 44.4728 Constraint 226 435 10.4317 13.0396 19.5594 44.2730 Constraint 113 182 10.3920 12.9900 19.4850 44.0607 Constraint 144 322 10.7619 13.4524 20.1786 44.0202 Constraint 88 169 10.1817 12.7271 19.0907 43.9460 Constraint 88 480 8.9859 11.2324 16.8486 43.9433 Constraint 88 473 9.1749 11.4687 17.2030 43.9433 Constraint 412 473 7.9783 9.9729 14.9593 43.9412 Constraint 285 442 9.7119 12.1399 18.2098 43.7026 Constraint 259 449 9.2980 11.6225 17.4337 43.2994 Constraint 272 350 10.4188 13.0236 19.5353 42.9000 Constraint 153 242 9.7188 12.1485 18.2228 42.8655 Constraint 259 429 9.6373 12.0467 18.0700 42.6874 Constraint 267 360 9.6660 12.0826 18.1238 42.6263 Constraint 221 350 10.3796 12.9745 19.4618 42.5062 Constraint 96 355 9.4054 11.7567 17.6351 42.2837 Constraint 128 412 10.5089 13.1362 19.7043 41.8007 Constraint 144 442 10.0609 12.5762 18.8642 41.6165 Constraint 221 435 10.5330 13.1663 19.7494 40.9322 Constraint 88 360 9.0314 11.2892 16.9339 40.7198 Constraint 113 429 10.5497 13.1871 19.7807 40.7117 Constraint 250 429 10.2121 12.7652 19.1477 40.5942 Constraint 169 412 10.5074 13.1343 19.7014 39.9629 Constraint 176 421 10.4954 13.1192 19.6788 39.9072 Constraint 153 292 10.2900 12.8624 19.2937 39.8656 Constraint 96 467 9.9860 12.4825 18.7237 39.8647 Constraint 375 473 7.0909 8.8636 13.2955 39.7696 Constraint 153 226 10.3500 12.9375 19.4063 39.4385 Constraint 272 391 10.4196 13.0245 19.5367 39.2724 Constraint 88 442 10.4343 13.0428 19.5642 39.2223 Constraint 136 461 10.4900 13.1125 19.6688 38.5713 Constraint 122 473 9.4600 11.8250 17.7375 37.9815 Constraint 201 435 10.6004 13.2505 19.8757 37.9323 Constraint 279 360 9.6753 12.0942 18.1413 37.7812 Constraint 153 322 10.5726 13.2158 19.8237 37.5458 Constraint 104 350 10.0864 12.6080 18.9120 37.2723 Constraint 314 473 10.5258 13.1572 19.7358 37.0073 Constraint 190 421 10.2387 12.7984 19.1976 36.9169 Constraint 104 242 10.3028 12.8785 19.3178 36.6748 Constraint 272 442 10.2194 12.7743 19.1614 35.7316 Constraint 429 489 6.2458 7.8072 11.7108 35.6412 Constraint 421 489 8.8455 11.0568 16.5852 35.6412 Constraint 128 399 10.4425 13.0531 19.5797 35.6074 Constraint 104 272 10.6674 13.3343 20.0014 35.5821 Constraint 122 412 10.5031 13.1288 19.6932 35.3251 Constraint 104 442 10.4099 13.0124 19.5185 35.1751 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 421 497 6.3341 7.9177 11.8765 35.0892 Constraint 360 435 10.5731 13.2164 19.8246 34.9337 Constraint 237 461 10.1366 12.6707 19.0061 34.7967 Constraint 250 360 10.2003 12.7504 19.1256 34.7785 Constraint 128 303 10.7872 13.4840 20.2259 34.6805 Constraint 375 480 9.8646 12.3307 18.4961 34.6014 Constraint 221 399 10.6138 13.2673 19.9010 34.5597 Constraint 250 449 10.0313 12.5391 18.8086 34.3103 Constraint 80 292 10.7949 13.4937 20.2405 34.3000 Constraint 391 473 8.3811 10.4764 15.7147 34.1966 Constraint 382 473 8.5685 10.7106 16.0659 34.1966 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 80 449 10.1202 12.6502 18.9753 33.2476 Constraint 435 497 8.5752 10.7191 16.0786 32.9959 Constraint 399 489 8.4371 10.5463 15.8195 32.9364 Constraint 122 480 10.1862 12.7327 19.0991 32.7217 Constraint 404 489 9.7088 12.1360 18.2040 32.5316 Constraint 88 489 6.4511 8.0639 12.0958 32.5316 Constraint 221 330 10.5311 13.1639 19.7459 31.9206 Constraint 190 303 10.9290 13.6612 20.4918 31.7861 Constraint 104 360 9.7708 12.2135 18.3202 31.7404 Constraint 399 497 5.3938 6.7423 10.1134 31.6818 Constraint 368 473 9.3898 11.7373 17.6059 31.6256 Constraint 360 473 8.3688 10.4610 15.6914 31.6256 Constraint 272 412 10.8382 13.5477 20.3216 31.2872 Constraint 412 497 9.0047 11.2559 16.8838 31.2770 Constraint 404 497 7.5289 9.4111 14.1167 31.2770 Constraint 292 435 10.2005 12.7507 19.1260 31.1908 Constraint 322 497 9.4809 11.8511 17.7766 31.1751 Constraint 314 497 8.5167 10.6459 15.9688 31.1751 Constraint 210 497 10.2996 12.8745 19.3118 31.1751 Constraint 96 497 6.2224 7.7780 11.6670 31.1751 Constraint 88 497 5.6890 7.1113 10.6669 31.1751 Constraint 182 391 10.5547 13.1934 19.7901 31.1464 Constraint 322 429 8.7108 10.8884 16.3327 30.9969 Constraint 80 421 10.4236 13.0295 19.5443 30.0104 Constraint 122 489 7.3254 9.1567 13.7351 29.8734 Constraint 267 442 10.3987 12.9983 19.4975 29.8169 Constraint 104 285 10.8256 13.5321 20.2981 29.5515 Constraint 122 497 7.3140 9.1424 13.7137 29.3957 Constraint 144 429 10.6688 13.3360 20.0040 28.9789 Constraint 259 330 10.9141 13.6426 20.4639 28.9426 Constraint 322 412 10.1405 12.6756 19.0134 28.9392 Constraint 292 404 10.0036 12.5045 18.7568 28.8702 Constraint 96 368 10.3016 12.8770 19.3155 28.7404 Constraint 128 360 10.4343 13.0428 19.5642 28.7404 Constraint 96 480 10.5366 13.1708 19.7562 28.6873 Constraint 136 442 10.5523 13.1903 19.7855 28.5865 Constraint 242 461 9.5574 11.9467 17.9201 28.5540 Constraint 104 497 8.9656 11.2070 16.8104 27.6953 Constraint 176 285 10.9257 13.6571 20.4857 27.6855 Constraint 136 297 10.6289 13.2862 19.9293 27.6111 Constraint 96 190 10.5041 13.1302 19.6952 27.4231 Constraint 113 489 9.2293 11.5367 17.3050 27.3025 Constraint 285 375 10.2055 12.7568 19.1352 27.2275 Constraint 136 421 10.4232 13.0290 19.5435 26.8910 Constraint 330 421 9.7685 12.2107 18.3160 26.6388 Constraint 237 399 10.5821 13.2276 19.8414 26.4197 Constraint 355 497 9.3580 11.6976 17.5463 26.3547 Constraint 242 497 9.8453 12.3066 18.4600 26.3416 Constraint 80 461 10.0053 12.5066 18.7600 26.2194 Constraint 80 360 9.8530 12.3163 18.4744 25.8285 Constraint 122 360 10.0941 12.6176 18.9265 25.7404 Constraint 429 511 7.4598 9.3247 13.9871 25.7176 Constraint 421 511 9.1103 11.3879 17.0818 25.7176 Constraint 96 511 9.5073 11.8841 17.8262 25.6157 Constraint 88 511 8.2671 10.3339 15.5008 25.6157 Constraint 80 355 10.4926 13.1158 19.6737 25.4740 Constraint 144 421 10.3536 12.9420 19.4130 25.3886 Constraint 221 429 10.4671 13.0838 19.6258 25.3460 Constraint 297 399 10.1207 12.6509 18.9763 25.2021 Constraint 399 511 6.4575 8.0719 12.1078 25.1061 Constraint 285 404 9.9107 12.3884 18.5826 25.0142 Constraint 267 368 10.1191 12.6489 18.9733 24.7381 Constraint 404 511 8.7727 10.9659 16.4488 24.7013 Constraint 322 404 10.1139 12.6424 18.9636 24.6669 Constraint 104 190 10.3433 12.9291 19.3937 24.5318 Constraint 128 497 8.6941 10.8676 16.3014 24.4841 Constraint 341 421 9.6570 12.0713 18.1069 24.4237 Constraint 242 473 10.1374 12.6717 19.0076 24.3637 Constraint 128 489 10.3962 12.9952 19.4928 24.1351 Constraint 136 314 10.4685 13.0856 19.6284 23.9730 Constraint 80 350 9.6840 12.1050 18.1575 23.8236 Constraint 113 497 8.3937 10.4921 15.7382 23.8226 Constraint 259 375 10.4892 13.1115 19.6673 23.5701 Constraint 375 467 10.4241 13.0301 19.5452 23.5502 Constraint 88 182 10.2474 12.8092 19.2138 23.4928 Constraint 113 330 10.7956 13.4945 20.2418 23.4097 Constraint 292 497 10.3673 12.9591 19.4386 23.3416 Constraint 80 497 8.4564 10.5705 15.8558 22.8944 Constraint 259 355 10.0328 12.5409 18.8114 22.6955 Constraint 292 382 10.2911 12.8638 19.2957 22.6580 Constraint 128 391 10.4794 13.0992 19.6489 22.6114 Constraint 80 489 9.7532 12.1915 18.2873 22.2259 Constraint 350 412 10.4102 13.0128 19.5192 22.1162 Constraint 391 497 8.8155 11.0193 16.5290 21.9372 Constraint 153 497 10.3129 12.8911 19.3367 21.8259 Constraint 144 497 9.9762 12.4702 18.7054 21.8259 Constraint 226 391 10.2009 12.7511 19.1267 21.6441 Constraint 176 314 10.9211 13.6514 20.4771 21.6247 Constraint 80 297 10.5915 13.2393 19.8590 21.5924 Constraint 88 355 9.4027 11.7533 17.6300 21.4581 Constraint 375 497 8.6709 10.8386 16.2580 20.6209 Constraint 360 497 7.4553 9.3191 13.9787 20.6209 Constraint 104 399 10.0510 12.5638 18.8457 20.6095 Constraint 368 435 11.0142 13.7677 20.6516 20.4772 Constraint 104 429 10.2787 12.8484 19.2726 20.4073 Constraint 113 442 10.9721 13.7151 20.5727 20.3128 Constraint 122 221 9.1137 11.3921 17.0881 20.0165 Constraint 314 461 10.5558 13.1947 19.7920 20.0077 Constraint 210 350 10.7338 13.4173 20.1259 19.9584 Constraint 360 511 8.8341 11.0427 16.5640 19.9576 Constraint 88 350 9.5623 11.9528 17.9293 19.7968 Constraint 144 489 9.9455 12.4319 18.6479 19.7326 Constraint 153 467 11.0426 13.8032 20.7048 19.7238 Constraint 96 375 10.3350 12.9187 19.3781 19.4757 Constraint 303 412 9.4297 11.7872 17.6808 19.4335 Constraint 182 360 10.5306 13.1632 19.7448 19.4254 Constraint 279 421 9.6681 12.0851 18.1277 19.2365 Constraint 122 259 9.7758 12.2197 18.3296 18.8902 Constraint 303 429 8.7989 10.9987 16.4980 18.6558 Constraint 375 511 8.0681 10.0851 15.1277 18.6241 Constraint 104 489 10.5014 13.1267 19.6901 18.4338 Constraint 285 449 10.2750 12.8438 19.2657 18.4038 Constraint 355 511 8.5303 10.6628 15.9942 18.2474 Constraint 297 442 10.2479 12.8099 19.2149 17.7218 Constraint 80 303 10.6783 13.3479 20.0219 17.6719 Constraint 360 461 10.2048 12.7560 19.1340 17.5633 Constraint 391 461 10.7180 13.3974 20.0962 17.5632 Constraint 237 382 9.6355 12.0443 18.0665 17.3120 Constraint 330 399 8.8063 11.0079 16.5119 17.3067 Constraint 285 429 9.4716 11.8395 17.7592 17.1314 Constraint 182 412 10.2734 12.8418 19.2627 17.1149 Constraint 303 375 8.9666 11.2082 16.8124 16.9932 Constraint 237 322 10.8112 13.5140 20.2711 16.9731 Constraint 96 519 9.7254 12.1568 18.2352 16.9576 Constraint 88 519 8.0895 10.1118 15.1677 16.9576 Constraint 88 242 7.3144 9.1430 13.7146 16.7970 Constraint 272 360 10.2619 12.8274 19.2412 16.7895 Constraint 314 435 8.3278 10.4097 15.6146 16.5069 Constraint 113 467 10.4216 13.0270 19.5405 16.3720 Constraint 297 429 9.3417 11.6771 17.5157 16.3335 Constraint 144 237 9.2154 11.5192 17.2788 16.2013 Constraint 122 511 9.5380 11.9225 17.8837 16.1700 Constraint 399 519 8.9120 11.1401 16.7101 16.1480 Constraint 322 435 10.5394 13.1742 19.7613 16.1097 Constraint 88 412 10.7069 13.3836 20.0754 16.0695 Constraint 429 519 8.6228 10.7785 16.1678 16.0432 Constraint 113 237 9.1214 11.4017 17.1026 15.8103 Constraint 421 527 8.1705 10.2131 15.3196 15.7785 Constraint 382 497 9.9254 12.4068 18.6101 15.6241 Constraint 368 511 10.2454 12.8067 19.2101 15.6241 Constraint 303 404 8.8591 11.0739 16.6108 15.5248 Constraint 303 382 9.4803 11.8504 17.7756 15.4564 Constraint 314 511 9.9386 12.4233 18.6349 15.4455 Constraint 297 449 9.5372 11.9215 17.8822 15.3206 Constraint 122 226 8.9168 11.1460 16.7191 15.2146 Constraint 88 391 10.0326 12.5408 18.8111 15.0385 Constraint 104 237 9.9293 12.4117 18.6175 14.7940 Constraint 368 497 9.7859 12.2324 18.3485 14.7841 Constraint 169 250 10.9100 13.6375 20.4563 14.6499 Constraint 80 511 10.2047 12.7559 19.1339 14.4948 Constraint 136 237 10.1798 12.7247 19.0871 14.4277 Constraint 355 473 10.2420 12.8025 19.2037 14.3658 Constraint 399 527 7.4660 9.3325 13.9988 14.1644 Constraint 449 527 7.9650 9.9562 14.9343 14.1450 Constraint 429 527 7.3396 9.1745 13.7617 14.0596 Constraint 122 527 8.1216 10.1520 15.2280 13.9577 Constraint 391 511 9.9148 12.3935 18.5903 13.9576 Constraint 221 382 10.6797 13.3496 20.0244 13.8926 Constraint 153 489 10.3069 12.8836 19.3255 13.7347 Constraint 122 190 9.7587 12.1983 18.2975 13.7171 Constraint 88 237 8.0795 10.0994 15.1491 13.7171 Constraint 104 259 10.6647 13.3309 19.9964 13.7016 Constraint 190 449 10.3266 12.9082 19.3623 13.4911 Constraint 182 429 10.3767 12.9709 19.4564 13.3763 Constraint 221 368 10.2109 12.7636 19.1454 13.3218 Constraint 221 341 10.8305 13.5381 20.3071 13.1438 Constraint 113 242 9.0325 11.2907 16.9360 12.8985 Constraint 350 497 9.7986 12.2482 18.3723 12.7850 Constraint 88 201 10.1584 12.6980 19.0470 12.7007 Constraint 201 314 11.0365 13.7956 20.6934 12.6438 Constraint 128 527 10.1410 12.6762 19.0144 12.6242 Constraint 104 527 9.8768 12.3460 18.5189 12.6242 Constraint 96 527 7.0122 8.7652 13.1479 12.6242 Constraint 88 527 6.5198 8.1497 12.2245 12.6242 Constraint 355 429 10.7319 13.4149 20.1224 12.5894 Constraint 122 404 10.4129 13.0161 19.5242 12.5857 Constraint 292 461 10.9028 13.6285 20.4427 12.5643 Constraint 80 399 9.8789 12.3486 18.5229 12.5476 Constraint 429 604 6.9560 8.6950 13.0426 12.4221 Constraint 429 622 9.3040 11.6300 17.4450 12.3936 Constraint 429 613 8.3094 10.3867 15.5801 12.3936 Constraint 421 535 9.0427 11.3033 16.9550 12.3688 Constraint 80 182 10.9230 13.6537 20.4805 12.3414 Constraint 421 629 9.2913 11.6141 17.4212 12.3284 Constraint 322 461 9.2723 11.5903 17.3855 12.2583 Constraint 96 382 10.5689 13.2112 19.8167 12.2201 Constraint 104 391 10.3690 12.9613 19.4419 12.2019 Constraint 314 599 8.8911 11.1139 16.6708 12.1323 Constraint 421 604 7.9162 9.8952 14.8428 11.9951 Constraint 404 622 9.7024 12.1279 18.1919 11.9243 Constraint 399 613 9.8897 12.3621 18.5431 11.9243 Constraint 210 341 10.7279 13.4099 20.1148 11.9232 Constraint 80 527 9.4109 11.7636 17.6454 11.8146 Constraint 360 489 9.3839 11.7299 17.5948 11.7842 Constraint 429 629 8.8955 11.1194 16.6791 11.7554 Constraint 330 429 9.6044 12.0056 18.0083 11.7367 Constraint 461 535 9.3301 11.6627 17.4940 11.6662 Constraint 303 442 10.2129 12.7662 19.1493 11.6136 Constraint 237 360 9.9660 12.4575 18.6863 11.4849 Constraint 341 429 9.7266 12.1583 18.2374 11.4502 Constraint 404 599 7.7848 9.7310 14.5966 11.4298 Constraint 473 604 7.2151 9.0188 13.5282 11.3648 Constraint 350 429 10.4393 13.0491 19.5737 11.3529 Constraint 330 449 10.2610 12.8263 19.2394 11.3293 Constraint 279 412 10.7934 13.4918 20.2377 11.3148 Constraint 350 473 9.6058 12.0072 18.0108 11.2677 Constraint 429 535 8.4224 10.5281 15.7921 11.2228 Constraint 279 355 8.4011 10.5013 15.7520 11.2165 Constraint 122 391 9.5362 11.9202 17.8804 11.2037 Constraint 144 242 10.4527 13.0659 19.5989 11.1934 Constraint 382 511 10.5969 13.2461 19.8691 10.9577 Constraint 404 604 8.1908 10.2384 15.3577 10.9528 Constraint 399 604 8.1658 10.2072 15.3108 10.9528 Constraint 391 604 10.2272 12.7840 19.1760 10.9374 Constraint 404 613 9.3871 11.7339 17.6008 10.9243 Constraint 88 404 9.7598 12.1997 18.2996 10.9021 Constraint 250 375 10.6086 13.2608 19.8912 10.8954 Constraint 144 467 11.0496 13.8120 20.7179 10.8871 Constraint 292 375 10.7094 13.3867 20.0800 10.8792 Constraint 279 368 10.5146 13.1433 19.7149 10.8524 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 88 285 8.7101 10.8876 16.3314 10.8052 Constraint 88 259 7.3254 9.1567 13.7351 10.8052 Constraint 88 250 8.5176 10.6469 15.9704 10.8052 Constraint 88 221 8.4755 10.5943 15.8915 10.8052 Constraint 113 201 9.4069 11.7587 17.6380 10.7228 Constraint 190 412 10.9055 13.6319 20.4479 10.4663 Constraint 429 599 7.0253 8.7816 13.1724 10.4452 Constraint 421 599 7.0454 8.8068 13.2102 10.4452 Constraint 412 599 8.3951 10.4939 15.7409 10.4452 Constraint 404 590 8.7980 10.9975 16.4963 10.4135 Constraint 467 604 7.5563 9.4454 14.1680 10.3667 Constraint 210 382 10.7729 13.4662 20.1993 10.3197 Constraint 122 272 10.7786 13.4732 20.2098 10.2095 Constraint 360 480 10.1384 12.6730 19.0096 10.2048 Constraint 480 629 8.4563 10.5704 15.8556 10.0047 Constraint 399 535 6.0528 7.5660 11.3490 9.9942 Constraint 412 629 9.9433 12.4291 18.6436 9.9682 Constraint 391 599 8.1825 10.2281 15.3421 9.9605 Constraint 435 527 9.2264 11.5330 17.2994 9.9417 Constraint 122 250 9.7063 12.1329 18.1994 9.9095 Constraint 599 668 10.5084 13.1355 19.7032 9.8804 Constraint 69 497 5.1329 6.4161 9.6242 9.8353 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 449 9.2700 11.5876 17.3813 9.8353 Constraint 69 421 7.6231 9.5288 14.2932 9.8353 Constraint 69 350 7.8101 9.7626 14.6439 9.8353 Constraint 169 497 10.4950 13.1187 19.6781 9.8280 Constraint 285 435 9.8111 12.2638 18.3958 9.8264 Constraint 467 599 8.5578 10.6973 16.0460 9.7938 Constraint 473 629 7.0993 8.8741 13.3112 9.7919 Constraint 360 535 6.8362 8.5453 12.8180 9.7875 Constraint 322 535 10.2675 12.8344 19.2515 9.7875 Constraint 314 535 8.6973 10.8716 16.3074 9.7875 Constraint 350 511 10.2227 12.7783 19.1675 9.6744 Constraint 412 604 9.1757 11.4696 17.2044 9.6350 Constraint 360 527 6.7205 8.4006 12.6010 9.6242 Constraint 88 435 9.9058 12.3822 18.5733 9.5860 Constraint 176 604 9.4772 11.8465 17.7697 9.5154 Constraint 429 590 8.1800 10.2249 15.3374 9.4289 Constraint 480 599 8.2758 10.3448 15.5172 9.4095 Constraint 226 314 11.0357 13.7946 20.6919 9.3621 Constraint 375 489 10.6479 13.3098 19.9647 9.3584 Constraint 322 604 6.6189 8.2736 12.4104 9.1105 Constraint 259 497 10.6577 13.3222 19.9833 9.1104 Constraint 122 297 10.7947 13.4934 20.2401 9.0863 Constraint 399 590 8.0835 10.1044 15.1565 9.0311 Constraint 80 429 10.3642 12.9552 19.4328 8.9903 Constraint 113 399 9.8721 12.3401 18.5102 8.9900 Constraint 128 350 9.6586 12.0732 18.1098 8.9776 Constraint 399 599 6.5748 8.2185 12.3278 8.9759 Constraint 210 604 6.2067 7.7584 11.6376 8.9324 Constraint 279 399 10.7030 13.3788 20.0682 8.9259 Constraint 314 604 7.5078 9.3848 14.0772 8.9147 Constraint 96 250 9.8512 12.3140 18.4711 8.8989 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 80 210 10.1693 12.7116 19.0675 8.8357 Constraint 136 330 10.7490 13.4362 20.1543 8.8309 Constraint 96 226 9.8684 12.3354 18.5032 8.8108 Constraint 461 599 8.9766 11.2208 16.8312 8.7938 Constraint 461 604 8.7822 10.9778 16.4667 8.7938 Constraint 473 599 6.3405 7.9256 11.8884 8.7919 Constraint 467 585 8.1870 10.2337 15.3505 8.7775 Constraint 473 622 8.5070 10.6337 15.9506 8.7756 Constraint 322 629 9.8702 12.3378 18.5066 8.7057 Constraint 182 604 8.5209 10.6511 15.9766 8.7057 Constraint 314 489 9.1527 11.4409 17.1613 8.6855 Constraint 435 629 9.3794 11.7242 17.5864 8.6503 Constraint 442 527 8.5808 10.7261 16.0891 8.6083 Constraint 136 242 10.9046 13.6307 20.4460 8.5845 Constraint 412 489 10.7343 13.4179 20.1268 8.5730 Constraint 242 355 10.5700 13.2125 19.8188 8.5730 Constraint 355 519 8.3103 10.3878 15.5817 8.5730 Constraint 80 519 10.3731 12.9664 19.4496 8.5730 Constraint 480 604 5.6679 7.0849 10.6274 8.5613 Constraint 577 657 9.9823 12.4779 18.7169 8.5538 Constraint 330 391 8.9086 11.1358 16.7037 8.5513 Constraint 201 604 8.6062 10.7578 16.1366 8.5275 Constraint 122 285 10.6267 13.2833 19.9250 8.4906 Constraint 237 368 10.5714 13.2142 19.8213 8.4849 Constraint 201 391 10.9468 13.6835 20.5253 8.4849 Constraint 604 687 10.1169 12.6461 18.9692 8.4775 Constraint 435 599 9.5751 11.9689 17.9533 8.4606 Constraint 122 519 9.0480 11.3100 16.9651 8.3846 Constraint 473 613 8.0398 10.0497 15.0746 8.3505 Constraint 297 412 9.6568 12.0711 18.1066 8.3379 Constraint 449 519 9.3448 11.6810 17.5216 8.3083 Constraint 267 355 9.5464 11.9330 17.8995 8.2627 Constraint 421 519 8.9287 11.1608 16.7413 8.2228 Constraint 412 527 8.6094 10.7617 16.1425 8.2228 Constraint 88 604 10.1545 12.6931 19.0397 8.1785 Constraint 144 527 9.1182 11.3978 17.0967 8.1702 Constraint 221 404 11.0965 13.8706 20.8060 8.1440 Constraint 604 676 10.7711 13.4639 20.1959 8.1422 Constraint 237 622 5.5461 6.9326 10.3989 8.1330 Constraint 210 622 7.2815 9.1019 13.6529 8.1330 Constraint 391 519 10.6288 13.2860 19.9290 8.1209 Constraint 360 519 8.8336 11.0420 16.5630 8.1209 Constraint 242 535 10.3394 12.9242 19.3863 8.1209 Constraint 88 226 9.6210 12.0263 18.0394 8.0700 Constraint 467 629 8.3871 10.4838 15.7258 8.0066 Constraint 480 585 6.0513 7.5641 11.3462 7.9884 Constraint 590 657 10.4414 13.0518 19.5776 7.9740 Constraint 292 599 8.1619 10.2024 15.3036 7.9432 Constraint 182 599 8.6422 10.8027 16.2041 7.9432 Constraint 412 535 9.5794 11.9742 17.9613 7.9228 Constraint 322 613 9.8908 12.3634 18.5452 7.9064 Constraint 113 360 9.9662 12.4578 18.6866 7.9038 Constraint 461 585 9.4841 11.8551 17.7827 7.8707 Constraint 303 449 9.6487 12.0609 18.0913 7.8495 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 391 535 8.0297 10.0371 15.0556 7.8038 Constraint 391 527 7.5999 9.4999 14.2499 7.8038 Constraint 350 527 8.2521 10.3151 15.4726 7.8038 Constraint 467 613 9.6446 12.0558 18.0836 7.7939 Constraint 461 629 9.6422 12.0528 18.0791 7.7939 Constraint 421 622 8.9936 11.2420 16.8631 7.7529 Constraint 250 622 10.3527 12.9409 19.4114 7.7282 Constraint 242 622 8.0543 10.0678 15.1017 7.7282 Constraint 237 613 8.0272 10.0340 15.0510 7.7282 Constraint 226 622 9.0967 11.3709 17.0564 7.7282 Constraint 221 622 10.3385 12.9231 19.3847 7.7282 Constraint 210 613 7.8764 9.8455 14.7682 7.7282 Constraint 201 622 7.5784 9.4730 14.2095 7.7282 Constraint 201 613 9.8964 12.3705 18.5558 7.7282 Constraint 176 622 10.7279 13.4099 20.1149 7.7282 Constraint 210 629 6.1498 7.6872 11.5308 7.7179 Constraint 96 279 10.7465 13.4332 20.1497 7.7075 Constraint 435 604 8.5093 10.6367 15.9550 7.6503 Constraint 360 585 9.5800 11.9750 17.9625 7.6263 Constraint 480 622 9.2985 11.6232 17.4348 7.5777 Constraint 303 552 10.3788 12.9735 19.4602 7.5740 Constraint 480 613 7.3759 9.2199 13.8298 7.5614 Constraint 585 657 10.3817 12.9771 19.4657 7.5557 Constraint 279 577 10.4570 13.0713 19.6069 7.5423 Constraint 176 599 9.2430 11.5538 17.3307 7.5384 Constraint 429 585 9.1573 11.4467 17.1700 7.4443 Constraint 144 552 10.5044 13.1304 19.6957 7.4267 Constraint 144 535 9.3839 11.7299 17.5948 7.4267 Constraint 421 613 8.7351 10.9189 16.3783 7.4033 Constraint 449 604 9.9643 12.4554 18.6831 7.3668 Constraint 113 511 10.7003 13.3754 20.0632 7.3334 Constraint 267 399 10.4798 13.0998 19.6497 7.2685 Constraint 449 535 9.8832 12.3540 18.5310 7.2555 Constraint 404 519 9.9719 12.4649 18.6974 7.2065 Constraint 153 527 10.3530 12.9412 19.4119 7.1702 Constraint 113 519 10.1083 12.6354 18.9530 7.1702 Constraint 322 599 7.9105 9.8881 14.8321 7.1336 Constraint 88 341 9.2537 11.5672 17.3507 7.1205 Constraint 461 552 9.4034 11.7542 17.6313 7.0932 Constraint 113 527 6.8302 8.5378 12.8067 7.0512 Constraint 80 242 9.0879 11.3598 17.0397 7.0153 Constraint 88 375 9.8802 12.3503 18.5254 7.0081 Constraint 442 622 7.2932 9.1165 13.6748 7.0079 Constraint 242 604 7.3116 9.1396 13.7093 7.0023 Constraint 69 467 10.8019 13.5023 20.2535 6.9986 Constraint 480 636 7.5827 9.4784 14.2175 6.9903 Constraint 113 480 11.0242 13.7802 20.6703 6.9871 Constraint 429 636 9.9775 12.4719 18.7079 6.9750 Constraint 382 599 8.4288 10.5360 15.8040 6.9596 Constraint 375 590 7.9684 9.9606 14.9408 6.9596 Constraint 375 585 9.3838 11.7298 17.5947 6.9596 Constraint 368 590 9.4979 11.8724 17.8086 6.9596 Constraint 360 599 7.1290 8.9113 13.3669 6.9596 Constraint 360 590 8.6329 10.7911 16.1866 6.9596 Constraint 210 599 5.4664 6.8330 10.2495 6.9554 Constraint 360 604 9.4720 11.8400 17.7601 6.9442 Constraint 330 604 9.2492 11.5615 17.3423 6.9186 Constraint 314 613 9.5004 11.8754 17.8132 6.9186 Constraint 303 604 9.9661 12.4577 18.6865 6.9186 Constraint 297 604 8.7965 10.9956 16.4934 6.9186 Constraint 292 629 9.0597 11.3246 16.9869 6.9186 Constraint 292 622 10.6757 13.3446 20.0170 6.9186 Constraint 292 613 10.1483 12.6854 19.0281 6.9186 Constraint 292 604 6.8923 8.6153 12.9230 6.9186 Constraint 272 604 10.2624 12.8280 19.2419 6.9186 Constraint 242 613 8.5151 10.6439 15.9658 6.9186 Constraint 190 629 8.8907 11.1133 16.6700 6.9186 Constraint 182 629 8.5058 10.6323 15.9485 6.9186 Constraint 176 629 7.6662 9.5828 14.3741 6.9186 Constraint 404 535 7.9296 9.9120 14.8680 6.9065 Constraint 404 527 7.5626 9.4533 14.1800 6.9065 Constraint 467 577 8.4751 10.5939 15.8908 6.8967 Constraint 461 577 8.6836 10.8545 16.2817 6.8967 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 467 590 9.3467 11.6833 17.5250 6.7939 Constraint 449 599 8.9915 11.2393 16.8590 6.7939 Constraint 96 535 8.7040 10.8800 16.3199 6.7876 Constraint 391 489 10.1673 12.7091 19.0637 6.7875 Constraint 375 519 9.8925 12.3657 18.5485 6.7875 Constraint 341 527 8.9465 11.1831 16.7747 6.7875 Constraint 341 519 10.6890 13.3612 20.0418 6.7875 Constraint 330 489 10.9966 13.7458 20.6187 6.7875 Constraint 322 527 6.3291 7.9114 11.8671 6.7875 Constraint 322 519 9.2756 11.5945 17.3917 6.7875 Constraint 322 489 8.4705 10.5881 15.8821 6.7875 Constraint 314 527 5.3157 6.6447 9.9670 6.7875 Constraint 314 519 8.5039 10.6299 15.9448 6.7875 Constraint 297 527 9.9482 12.4353 18.6530 6.7875 Constraint 292 527 7.8984 9.8730 14.8095 6.7875 Constraint 285 527 10.0309 12.5387 18.8080 6.7875 Constraint 259 527 9.4405 11.8006 17.7010 6.7875 Constraint 242 527 8.6086 10.7608 16.1412 6.7875 Constraint 221 527 9.9513 12.4391 18.6587 6.7875 Constraint 210 527 8.8065 11.0081 16.5121 6.7875 Constraint 210 489 10.5575 13.1969 19.7954 6.7875 Constraint 473 590 6.7083 8.3854 12.5781 6.7775 Constraint 473 585 6.1437 7.6796 11.5194 6.7775 Constraint 237 604 7.3130 9.1413 13.7119 6.7404 Constraint 226 604 10.1803 12.7254 19.0881 6.7404 Constraint 190 604 10.4455 13.0569 19.5853 6.7404 Constraint 322 585 8.7301 10.9127 16.3690 6.7403 Constraint 322 590 10.1772 12.7215 19.0822 6.7288 Constraint 297 599 9.8936 12.3670 18.5505 6.7288 Constraint 404 585 9.6875 12.1094 18.1641 6.6580 Constraint 88 585 10.1463 12.6829 19.0243 6.6532 Constraint 169 604 7.6029 9.5036 14.2554 6.6453 Constraint 399 585 8.2600 10.3250 15.4874 6.6417 Constraint 88 303 9.0858 11.3572 17.0358 6.6252 Constraint 355 535 5.1682 6.4603 9.6905 6.5894 Constraint 355 527 6.3868 7.9835 11.9752 6.5894 Constraint 350 535 8.2245 10.2806 15.4209 6.5894 Constraint 489 629 9.1735 11.4668 17.2003 6.5841 Constraint 604 698 10.3621 12.9526 19.4290 6.5711 Constraint 292 473 9.8835 12.3544 18.5316 6.5622 Constraint 210 473 9.7247 12.1559 18.2339 6.5622 Constraint 341 552 10.3358 12.9197 19.3796 6.5576 Constraint 330 552 9.5099 11.8874 17.8310 6.5576 Constraint 341 404 8.6173 10.7716 16.1574 6.5324 Constraint 128 473 8.2010 10.2513 15.3769 6.4513 Constraint 480 590 7.4438 9.3048 13.9572 6.3932 Constraint 104 535 10.0305 12.5381 18.8072 6.3076 Constraint 128 467 8.9726 11.2158 16.8237 6.1965 Constraint 355 599 8.8097 11.0121 16.5182 6.1526 Constraint 467 544 9.6385 12.0481 18.0721 6.1096 Constraint 80 169 10.5906 13.2382 19.8573 6.0904 Constraint 442 629 7.5537 9.4421 14.1631 6.0201 Constraint 267 382 10.1413 12.6767 19.0150 6.0164 Constraint 69 297 10.8129 13.5161 20.2742 6.0150 Constraint 69 285 10.1709 12.7136 19.0705 6.0150 Constraint 404 629 6.1186 7.6483 11.4724 5.9904 Constraint 399 622 7.9379 9.9223 14.8835 5.9904 Constraint 382 629 8.0709 10.0886 15.1329 5.9904 Constraint 375 636 8.4615 10.5769 15.8654 5.9904 Constraint 375 629 5.0053 6.2566 9.3849 5.9904 Constraint 375 622 5.3508 6.6885 10.0328 5.9904 Constraint 375 613 8.4017 10.5021 15.7531 5.9904 Constraint 368 622 8.1084 10.1355 15.2032 5.9904 Constraint 350 449 10.4472 13.0590 19.5885 5.9890 Constraint 122 350 10.3168 12.8960 19.3440 5.9890 Constraint 113 350 10.9295 13.6618 20.4928 5.9890 Constraint 153 259 10.8902 13.6127 20.4190 5.9886 Constraint 480 657 9.9417 12.4271 18.6407 5.9884 Constraint 473 657 8.6288 10.7860 16.1791 5.9884 Constraint 473 651 9.7258 12.1573 18.2359 5.9884 Constraint 473 644 9.7751 12.2189 18.3283 5.9884 Constraint 128 341 8.0342 10.0428 15.0642 5.9828 Constraint 169 599 8.4389 10.5487 15.8230 5.9740 Constraint 391 590 9.0144 11.2680 16.9021 5.9702 Constraint 412 622 9.4656 11.8320 17.7479 5.9657 Constraint 412 613 8.8327 11.0409 16.5614 5.9657 Constraint 314 590 9.2488 11.5610 17.3415 5.9500 Constraint 182 636 10.2565 12.8206 19.2309 5.9340 Constraint 285 604 9.5678 11.9598 17.9397 5.9308 Constraint 259 629 10.1702 12.7128 19.0692 5.9308 Constraint 259 604 8.7441 10.9302 16.3952 5.9308 Constraint 250 629 10.5993 13.2492 19.8738 5.9308 Constraint 250 604 10.6904 13.3630 20.0445 5.9308 Constraint 242 629 7.7726 9.7158 14.5737 5.9308 Constraint 237 629 4.8393 6.0491 9.0736 5.9308 Constraint 226 629 7.5958 9.4948 14.2422 5.9308 Constraint 221 629 8.4754 10.5943 15.8914 5.9308 Constraint 221 604 8.4420 10.5525 15.8288 5.9308 Constraint 201 629 4.5201 5.6501 8.4752 5.9308 Constraint 104 355 10.8092 13.5115 20.2673 5.9118 Constraint 128 250 10.8811 13.6013 20.4020 5.9118 Constraint 122 330 10.8099 13.5123 20.2685 5.8730 Constraint 161 461 10.8543 13.5679 20.3518 5.8367 Constraint 136 527 10.6707 13.3383 20.0075 5.8367 Constraint 69 412 10.6477 13.3096 19.9644 5.8367 Constraint 69 210 10.6040 13.2550 19.8825 5.8367 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 355 8.9645 11.2056 16.8084 5.8367 Constraint 58 350 10.2080 12.7601 19.1401 5.8367 Constraint 58 322 7.7881 9.7351 14.6026 5.8367 Constraint 242 599 5.0650 6.3313 9.4970 5.8350 Constraint 237 599 4.6977 5.8722 8.8083 5.8350 Constraint 182 399 10.1094 12.6367 18.9551 5.8344 Constraint 80 259 10.9914 13.7392 20.6089 5.8238 Constraint 201 429 10.5882 13.2353 19.8529 5.8002 Constraint 322 577 6.4211 8.0264 12.0396 5.7525 Constraint 314 577 6.2239 7.7798 11.6697 5.7525 Constraint 297 577 8.9637 11.2046 16.8069 5.7525 Constraint 292 577 7.8052 9.7565 14.6348 5.7525 Constraint 190 599 8.9078 11.1348 16.7021 5.7513 Constraint 382 535 8.0655 10.0818 15.1227 5.5730 Constraint 382 527 9.1682 11.4602 17.1904 5.5730 Constraint 375 535 4.6153 5.7691 8.6537 5.5730 Constraint 375 527 7.3826 9.2282 13.8423 5.5730 Constraint 375 461 10.9173 13.6467 20.4700 5.5730 Constraint 368 535 5.8421 7.3026 10.9539 5.5730 Constraint 368 527 7.6702 9.5877 14.3816 5.5730 Constraint 368 519 11.1153 13.8941 20.8412 5.5730 Constraint 355 489 10.8133 13.5166 20.2749 5.5730 Constraint 350 519 10.0360 12.5450 18.8174 5.5730 Constraint 330 544 11.0412 13.8015 20.7023 5.5730 Constraint 330 527 8.6522 10.8152 16.2229 5.5730 Constraint 330 519 10.3375 12.9218 19.3827 5.5730 Constraint 303 527 9.1097 11.3871 17.0807 5.5730 Constraint 292 535 10.3627 12.9534 19.4300 5.5730 Constraint 259 535 10.6369 13.2961 19.9442 5.5730 Constraint 226 382 10.9655 13.7069 20.5604 5.5730 Constraint 226 322 10.8067 13.5084 20.2625 5.5730 Constraint 122 535 8.6109 10.7636 16.1454 5.5479 Constraint 182 435 10.8778 13.5972 20.3959 5.5344 Constraint 421 590 7.7482 9.6852 14.5278 5.4549 Constraint 435 622 7.6562 9.5702 14.3553 5.4186 Constraint 489 599 9.2864 11.6080 17.4120 5.4178 Constraint 449 544 10.7465 13.4331 20.1496 5.2536 Constraint 259 599 7.1941 8.9927 13.4890 5.1683 Constraint 242 590 6.5665 8.2082 12.3123 5.1683 Constraint 237 590 6.8283 8.5354 12.8031 5.1683 Constraint 226 599 7.1801 8.9751 13.4627 5.1683 Constraint 221 599 6.7460 8.4325 12.6488 5.1683 Constraint 210 590 7.9284 9.9106 14.8658 5.1683 Constraint 201 599 6.5461 8.1827 12.2740 5.1683 Constraint 122 552 9.2933 11.6166 17.4249 5.1431 Constraint 122 544 9.8603 12.3254 18.4880 5.1431 Constraint 136 221 10.6182 13.2727 19.9091 5.1079 Constraint 128 535 9.7688 12.2110 18.3164 5.0932 Constraint 480 577 7.3762 9.2202 13.8303 5.0913 Constraint 489 585 9.4898 11.8623 17.7934 5.0899 Constraint 104 412 10.3785 12.9731 19.4597 5.0605 Constraint 382 604 10.4056 13.0070 19.5105 5.0067 Constraint 210 467 9.8590 12.3237 18.4855 5.0051 Constraint 104 467 9.9312 12.4140 18.6210 5.0051 Constraint 104 599 8.5214 10.6518 15.9777 4.9977 Constraint 169 391 10.7065 13.3831 20.0747 4.9920 Constraint 153 412 9.8672 12.3341 18.5011 4.9920 Constraint 489 604 8.3249 10.4062 15.6093 4.9908 Constraint 480 644 9.9362 12.4203 18.6304 4.9904 Constraint 473 636 6.8493 8.5616 12.8425 4.9904 Constraint 467 636 8.4920 10.6150 15.9226 4.9904 Constraint 404 657 8.2415 10.3018 15.4527 4.9904 Constraint 404 651 8.5264 10.6580 15.9870 4.9904 Constraint 404 644 10.8862 13.6078 20.4116 4.9904 Constraint 404 636 8.8537 11.0672 16.6007 4.9904 Constraint 399 651 9.4730 11.8412 17.7618 4.9904 Constraint 399 636 9.2793 11.5992 17.3988 4.9904 Constraint 399 629 5.7727 7.2159 10.8238 4.9904 Constraint 391 629 8.9083 11.1354 16.7031 4.9904 Constraint 382 657 10.1528 12.6910 19.0365 4.9904 Constraint 382 651 8.6567 10.8208 16.2312 4.9904 Constraint 382 622 8.7552 10.9440 16.4160 4.9904 Constraint 375 657 7.6568 9.5711 14.3566 4.9904 Constraint 375 651 5.6128 7.0160 10.5241 4.9904 Constraint 375 644 8.0069 10.0087 15.0130 4.9904 Constraint 375 604 7.3620 9.2025 13.8038 4.9904 Constraint 375 599 4.3347 5.4184 8.1276 4.9904 Constraint 368 651 9.1111 11.3888 17.0833 4.9904 Constraint 368 629 7.8009 9.7511 14.6266 4.9904 Constraint 368 599 6.4878 8.1097 12.1645 4.9904 Constraint 360 629 8.3166 10.3957 15.5936 4.9904 Constraint 360 622 8.3688 10.4611 15.6916 4.9904 Constraint 360 613 10.3323 12.9154 19.3731 4.9904 Constraint 355 622 9.8485 12.3107 18.4660 4.9904 Constraint 355 590 9.2739 11.5923 17.3885 4.9904 Constraint 497 613 9.5399 11.9249 17.8873 4.9890 Constraint 314 571 8.1418 10.1773 15.2659 4.9654 Constraint 382 590 9.0352 11.2940 16.9411 4.9538 Constraint 330 585 10.3497 12.9371 19.4057 4.9532 Constraint 330 644 10.0074 12.5092 18.7638 4.9494 Constraint 210 636 8.4068 10.5085 15.7627 4.9462 Constraint 201 636 8.4016 10.5020 15.7529 4.9462 Constraint 176 636 8.8820 11.1025 16.6537 4.9462 Constraint 272 599 9.0808 11.3510 17.0265 4.9416 Constraint 297 368 10.5855 13.2319 19.8478 4.9120 Constraint 210 368 9.5562 11.9452 17.9178 4.9120 Constraint 88 297 8.9593 11.1991 16.7986 4.9063 Constraint 88 267 9.9324 12.4155 18.6233 4.9063 Constraint 355 480 10.9388 13.6735 20.5103 4.8981 Constraint 303 435 7.1024 8.8780 13.3170 4.8967 Constraint 297 435 8.7877 10.9846 16.4769 4.8967 Constraint 322 382 9.9816 12.4770 18.7154 4.8853 Constraint 272 449 10.3999 12.9998 19.4998 4.8615 Constraint 113 604 8.3987 10.4983 15.7475 4.8549 Constraint 297 404 6.9130 8.6412 12.9618 4.8224 Constraint 497 590 9.8651 12.3314 18.4971 4.8111 Constraint 88 552 8.2304 10.2880 15.4319 4.8096 Constraint 435 577 10.0510 12.5638 18.8457 4.8035 Constraint 429 577 7.7205 9.6506 14.4760 4.8035 Constraint 404 577 7.5156 9.3945 14.0917 4.7881 Constraint 169 622 7.7994 9.7492 14.6238 4.7744 Constraint 169 613 9.0549 11.3186 16.9779 4.7744 Constraint 169 629 6.0695 7.5869 11.3803 4.7641 Constraint 226 590 10.2957 12.8696 19.3043 4.7635 Constraint 201 590 10.2034 12.7543 19.1314 4.7635 Constraint 128 404 10.5355 13.1694 19.7541 4.7605 Constraint 201 461 10.9740 13.7176 20.5763 4.7348 Constraint 96 267 10.0884 12.6105 18.9157 4.7075 Constraint 442 613 6.5871 8.2339 12.3508 4.6478 Constraint 435 613 6.5835 8.2294 12.3441 4.6478 Constraint 435 511 8.7862 10.9828 16.4741 4.6333 Constraint 136 577 9.2902 11.6127 17.4191 4.5929 Constraint 128 577 7.7914 9.7392 14.6088 4.5929 Constraint 122 577 8.5034 10.6292 15.9439 4.5929 Constraint 113 577 9.3849 11.7311 17.5966 4.5929 Constraint 104 577 7.7838 9.7297 14.5946 4.5929 Constraint 497 629 7.3720 9.2149 13.8224 4.5842 Constraint 497 622 8.9492 11.1865 16.7797 4.5842 Constraint 210 577 7.1799 8.9749 13.4624 4.5660 Constraint 201 577 9.6781 12.0976 18.1464 4.5660 Constraint 182 577 8.4141 10.5176 15.7764 4.5660 Constraint 176 577 9.5913 11.9891 17.9837 4.5660 Constraint 497 577 8.8717 11.0896 16.6344 4.5555 Constraint 279 404 9.3050 11.6313 17.4469 4.5224 Constraint 144 226 10.2839 12.8548 19.2823 4.4801 Constraint 136 585 8.9495 11.1868 16.7802 4.4501 Constraint 128 585 8.9510 11.1888 16.7832 4.4501 Constraint 497 585 8.7580 10.9475 16.4212 4.4063 Constraint 88 577 8.8147 11.0184 16.5275 4.4015 Constraint 449 629 8.9875 11.2344 16.8516 4.3765 Constraint 292 668 10.4137 13.0171 19.5257 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 182 644 8.2901 10.3627 15.5440 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 176 651 10.0183 12.5228 18.7842 4.3664 Constraint 176 644 7.9308 9.9135 14.8702 4.3664 Constraint 250 599 7.0488 8.8109 13.2164 4.3587 Constraint 237 636 9.0700 11.3375 17.0062 4.3587 Constraint 322 473 9.0236 11.2795 16.9192 4.3581 Constraint 182 404 9.9167 12.3958 18.5937 4.3581 Constraint 144 577 9.2716 11.5895 17.3842 4.3345 Constraint 113 544 10.4475 13.0594 19.5891 4.3335 Constraint 88 279 10.5290 13.1612 19.7418 4.3106 Constraint 104 435 10.4857 13.1072 19.6608 4.2827 Constraint 80 237 10.0697 12.5872 18.8808 4.2801 Constraint 442 604 5.0805 6.3507 9.5260 4.2330 Constraint 527 599 7.6683 9.5854 14.3780 4.2288 Constraint 88 535 4.6155 5.7693 8.6540 4.2144 Constraint 104 604 7.3774 9.2218 13.8326 4.1881 Constraint 88 599 9.8590 12.3237 18.4856 4.1881 Constraint 144 221 11.1000 13.8749 20.8124 4.1801 Constraint 242 341 9.6323 12.0403 18.0605 4.1778 Constraint 314 480 9.8323 12.2904 18.4357 4.1106 Constraint 489 577 8.2118 10.2647 15.3971 4.1095 Constraint 480 571 7.2944 9.1179 13.6769 4.0913 Constraint 122 585 9.2182 11.5227 17.2841 4.0682 Constraint 442 519 9.3326 11.6657 17.4986 4.0333 Constraint 69 242 10.7584 13.4480 20.1720 4.0163 Constraint 58 303 10.5015 13.1268 19.6903 4.0163 Constraint 527 622 7.6693 9.5866 14.3800 3.9921 Constraint 297 497 11.0862 13.8577 20.7866 3.9913 Constraint 136 497 9.0392 11.2990 16.9484 3.9913 Constraint 391 622 10.0759 12.5949 18.8923 3.9904 Constraint 375 668 10.3304 12.9130 19.3695 3.9904 Constraint 368 613 10.9348 13.6684 20.5027 3.9904 Constraint 368 604 10.0726 12.5908 18.8862 3.9904 Constraint 350 599 11.0150 13.7688 20.6532 3.9904 Constraint 497 604 7.7369 9.6711 14.5067 3.9890 Constraint 391 577 6.3172 7.8965 11.8447 3.9855 Constraint 391 571 6.0137 7.5172 11.2758 3.9855 Constraint 382 577 8.3938 10.4923 15.7385 3.9855 Constraint 382 571 7.2942 9.1178 13.6767 3.9855 Constraint 375 577 8.5375 10.6719 16.0079 3.9855 Constraint 368 585 10.3025 12.8781 19.3172 3.9855 Constraint 368 577 8.4518 10.5648 15.8472 3.9855 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 360 577 7.9152 9.8940 14.8411 3.9855 Constraint 341 577 7.6656 9.5820 14.3730 3.9654 Constraint 330 577 8.4878 10.6097 15.9146 3.9654 Constraint 322 571 9.7276 12.1595 18.2392 3.9654 Constraint 314 585 7.1483 8.9354 13.4031 3.9654 Constraint 303 577 7.5488 9.4360 14.1541 3.9654 Constraint 303 571 9.6071 12.0088 18.0132 3.9654 Constraint 285 577 7.7267 9.6584 14.4876 3.9654 Constraint 259 577 7.9750 9.9687 14.9531 3.9654 Constraint 322 636 9.7003 12.1253 18.1880 3.9647 Constraint 259 622 10.5985 13.2482 19.8723 3.9647 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 330 668 8.4725 10.5907 15.8860 3.9616 Constraint 322 668 8.9129 11.1411 16.7116 3.9616 Constraint 322 644 8.8373 11.0466 16.5699 3.9616 Constraint 297 668 8.5461 10.6826 16.0239 3.9616 Constraint 297 644 10.0195 12.5244 18.7866 3.9616 Constraint 272 668 10.1452 12.6815 19.0222 3.9616 Constraint 182 657 8.7153 10.8941 16.3412 3.9616 Constraint 182 651 10.1414 12.6767 19.0151 3.9616 Constraint 176 657 8.8945 11.1181 16.6771 3.9616 Constraint 341 435 10.5614 13.2018 19.8026 3.9615 Constraint 341 412 7.8646 9.8308 14.7462 3.9615 Constraint 297 651 10.5918 13.2398 19.8596 3.9570 Constraint 303 599 10.5983 13.2478 19.8718 3.9538 Constraint 292 590 9.1348 11.4185 17.1278 3.9538 Constraint 285 599 8.2706 10.3382 15.5073 3.9538 Constraint 285 590 10.2577 12.8222 19.2333 3.9538 Constraint 267 599 9.7545 12.1931 18.2896 3.9538 Constraint 259 590 8.4681 10.5851 15.8777 3.9538 Constraint 250 590 8.1373 10.1716 15.2574 3.9538 Constraint 221 590 9.8456 12.3070 18.4605 3.9538 Constraint 272 629 10.0412 12.5515 18.8272 3.9416 Constraint 136 557 10.5052 13.1315 19.6973 3.9009 Constraint 88 272 9.6318 12.0398 18.0597 3.8900 Constraint 88 190 10.7295 13.4119 20.1179 3.8900 Constraint 113 226 10.4470 13.0588 19.5882 3.8843 Constraint 113 221 10.2166 12.7708 19.1561 3.8843 Constraint 182 473 8.8622 11.0778 16.6167 3.8804 Constraint 161 473 8.9584 11.1980 16.7970 3.8804 Constraint 668 742 8.0642 10.0802 15.1203 3.8557 Constraint 69 382 10.1090 12.6362 18.9544 3.8531 Constraint 113 552 9.0786 11.3483 17.0224 3.8096 Constraint 88 544 7.9201 9.9002 14.8503 3.8096 Constraint 467 622 9.4581 11.8227 17.7340 3.8035 Constraint 461 613 8.9899 11.2374 16.8560 3.8035 Constraint 449 577 9.3954 11.7442 17.6164 3.8035 Constraint 421 577 7.6177 9.5221 14.2831 3.8035 Constraint 412 577 8.9918 11.2397 16.8596 3.8035 Constraint 341 535 10.7613 13.4516 20.1774 3.7876 Constraint 473 577 5.6692 7.0865 10.6298 3.7871 Constraint 382 480 8.9259 11.1574 16.7361 3.7854 Constraint 104 613 9.8111 12.2639 18.3958 3.7833 Constraint 190 577 10.6239 13.2799 19.9198 3.7564 Constraint 128 604 6.7616 8.4520 12.6780 3.6683 Constraint 122 604 7.2709 9.0887 13.6330 3.6683 Constraint 122 599 7.6473 9.5591 14.3386 3.6683 Constraint 144 599 9.8261 12.2827 18.4240 3.6678 Constraint 412 590 6.5704 8.2130 12.3195 3.6677 Constraint 391 585 8.2307 10.2884 15.4326 3.6523 Constraint 527 629 7.7048 9.6310 14.4465 3.5873 Constraint 519 629 9.5483 11.9354 17.9031 3.5873 Constraint 489 613 9.2044 11.5055 17.2583 3.5861 Constraint 161 599 9.4206 11.7758 17.6637 3.5846 Constraint 113 250 10.7466 13.4332 20.1498 3.5843 Constraint 442 599 6.6175 8.2719 12.4079 3.4702 Constraint 442 590 8.8959 11.1199 16.6799 3.4702 Constraint 421 585 9.1949 11.4936 17.2405 3.4702 Constraint 442 552 10.1430 12.6788 19.0182 3.4603 Constraint 161 544 9.7700 12.2125 18.3188 3.4267 Constraint 153 535 8.3365 10.4206 15.6309 3.4267 Constraint 144 571 9.6925 12.1156 18.1734 3.4267 Constraint 144 544 8.6042 10.7552 16.1328 3.4267 Constraint 497 599 7.5294 9.4118 14.1177 3.4160 Constraint 80 535 7.0981 8.8727 13.3090 3.4048 Constraint 169 668 9.4042 11.7552 17.6328 3.3818 Constraint 169 644 8.3176 10.3969 15.5954 3.3818 Constraint 341 473 10.3967 12.9958 19.4937 3.3806 Constraint 210 668 9.8280 12.2849 18.4274 3.3740 Constraint 210 644 8.2418 10.3022 15.4533 3.3740 Constraint 201 668 9.7874 12.2342 18.3513 3.3740 Constraint 201 644 8.6159 10.7698 16.1548 3.3740 Constraint 190 668 9.3314 11.6643 17.4964 3.3740 Constraint 176 676 9.9707 12.4634 18.6951 3.3740 Constraint 449 622 6.3654 7.9568 11.9352 3.3479 Constraint 449 613 7.8648 9.8310 14.7465 3.3479 Constraint 622 698 10.2254 12.7817 19.1726 3.3296 Constraint 613 687 9.8121 12.2652 18.3978 3.3296 Constraint 297 489 9.8361 12.2951 18.4427 3.3076 Constraint 292 480 10.5327 13.1659 19.7488 3.3076 Constraint 113 391 11.0140 13.7675 20.6512 3.2918 Constraint 136 473 9.3977 11.7471 17.6207 3.2847 Constraint 104 473 8.3938 10.4922 15.7383 3.2847 Constraint 169 585 10.3040 12.8800 19.3200 3.2635 Constraint 161 604 7.2200 9.0250 13.5375 3.2635 Constraint 449 552 9.2180 11.5225 17.2838 3.2392 Constraint 519 599 9.0743 11.3428 17.0143 3.2307 Constraint 330 497 10.9820 13.7275 20.5913 3.2112 Constraint 144 292 10.9963 13.7454 20.6181 3.2104 Constraint 113 613 10.8459 13.5574 20.3361 3.1876 Constraint 104 590 9.2638 11.5797 17.3696 3.1876 Constraint 104 585 7.2247 9.0309 13.5464 3.1876 Constraint 303 497 10.5116 13.1395 19.7092 3.1125 Constraint 285 497 10.7667 13.4583 20.1875 3.1125 Constraint 489 571 9.4086 11.7607 17.6411 3.1096 Constraint 279 435 9.8163 12.2704 18.4056 3.1096 Constraint 480 557 8.8157 11.0196 16.5294 3.0932 Constraint 473 571 9.0198 11.2747 16.9121 3.0932 Constraint 473 557 9.1963 11.4953 17.2430 3.0932 Constraint 473 552 7.8947 9.8684 14.8026 3.0932 Constraint 467 557 11.0494 13.8117 20.7175 3.0932 Constraint 467 552 8.1913 10.2391 15.3586 3.0932 Constraint 461 571 10.7347 13.4184 20.1276 3.0932 Constraint 128 480 9.5417 11.9272 17.8908 3.0913 Constraint 104 480 9.8431 12.3038 18.4557 3.0913 Constraint 80 250 10.5806 13.2257 19.8386 3.0886 Constraint 144 604 7.8189 9.7737 14.6605 3.0726 Constraint 169 467 10.2509 12.8136 19.2204 3.0638 Constraint 297 382 9.6813 12.1016 18.1523 3.0352 Constraint 330 412 9.4828 11.8535 17.7803 3.0170 Constraint 330 404 6.7153 8.3942 12.5913 3.0170 Constraint 535 629 8.6503 10.8128 16.2193 3.0144 Constraint 128 599 6.0804 7.6005 11.4008 3.0016 Constraint 96 599 6.8554 8.5692 12.8538 3.0016 Constraint 399 577 6.3107 7.8883 11.8325 3.0009 Constraint 399 571 6.9044 8.6306 12.9458 3.0009 Constraint 391 557 8.3220 10.4025 15.6038 3.0009 Constraint 375 552 7.9253 9.9066 14.8599 3.0009 Constraint 368 557 8.5536 10.6920 16.0380 3.0009 Constraint 360 552 7.7488 9.6860 14.5290 3.0009 Constraint 113 535 7.6856 9.6070 14.4105 3.0000 Constraint 80 552 9.5868 11.9835 17.9752 3.0000 Constraint 80 544 10.0944 12.6180 18.9270 3.0000 Constraint 69 442 11.1732 13.9665 20.9497 3.0000 Constraint 58 421 10.9085 13.6357 20.4535 3.0000 Constraint 58 128 10.9150 13.6438 20.4656 3.0000 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 355 10.7311 13.4139 20.1209 3.0000 Constraint 51 322 10.2102 12.7628 19.1442 3.0000 Constraint 51 122 8.9814 11.2268 16.8402 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 113 10.9570 13.6962 20.5443 3.0000 Constraint 259 461 10.9800 13.7250 20.5875 3.0000 Constraint 153 314 9.8848 12.3561 18.5341 3.0000 Constraint 80 404 11.1854 13.9818 20.9726 3.0000 Constraint 285 535 11.1572 13.9465 20.9197 2.9998 Constraint 153 341 11.1667 13.9584 20.9376 2.9942 Constraint 144 341 11.0042 13.7552 20.6328 2.9942 Constraint 136 341 7.0862 8.8577 13.2866 2.9942 Constraint 122 341 9.7213 12.1516 18.2274 2.9942 Constraint 113 341 8.2299 10.2874 15.4311 2.9942 Constraint 527 613 9.2869 11.6087 17.4130 2.9922 Constraint 519 622 8.7912 10.9890 16.4835 2.9922 Constraint 169 285 10.8003 13.5004 20.2505 2.9918 Constraint 153 399 11.0162 13.7703 20.6555 2.9918 Constraint 88 368 10.2683 12.8354 19.2531 2.9918 Constraint 201 279 11.1586 13.9482 20.9224 2.9893 Constraint 169 350 9.3723 11.7153 17.5730 2.9886 Constraint 169 330 10.9395 13.6744 20.5116 2.9886 Constraint 153 272 10.2427 12.8033 19.2050 2.9886 Constraint 382 585 8.8013 11.0017 16.5025 2.9855 Constraint 355 577 9.4462 11.8078 17.7117 2.9855 Constraint 350 577 10.2282 12.7853 19.1779 2.9855 Constraint 421 636 10.6345 13.2931 19.9396 2.9846 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 706 8.0066 10.0083 15.0124 2.9769 Constraint 322 706 10.4814 13.1017 19.6525 2.9769 Constraint 297 706 8.3589 10.4487 15.6730 2.9769 Constraint 259 613 11.0366 13.7958 20.6937 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 176 330 10.6869 13.3586 20.0380 2.9769 Constraint 169 636 5.8374 7.2968 10.9451 2.9769 Constraint 330 651 9.2403 11.5503 17.3255 2.9724 Constraint 322 676 8.3323 10.4153 15.6230 2.9692 Constraint 322 651 9.3177 11.6471 17.4707 2.9692 Constraint 297 676 8.6679 10.8349 16.2523 2.9692 Constraint 292 644 9.6688 12.0859 18.1289 2.9692 Constraint 272 644 10.5411 13.1764 19.7646 2.9692 Constraint 190 644 9.3636 11.7045 17.5568 2.9692 Constraint 182 676 8.7952 10.9940 16.4910 2.9692 Constraint 375 571 6.6112 8.2640 12.3960 2.9692 Constraint 360 571 6.9815 8.7269 13.0903 2.9692 Constraint 341 449 9.4944 11.8680 17.8020 2.9634 Constraint 341 442 10.5785 13.2231 19.8347 2.9634 Constraint 297 585 10.8127 13.5159 20.2738 2.9570 Constraint 182 585 10.9013 13.6266 20.4399 2.9570 Constraint 360 467 10.5015 13.1269 19.6904 2.9118 Constraint 237 467 8.9897 11.2372 16.8557 2.9118 Constraint 201 467 10.6024 13.2530 19.8795 2.9118 Constraint 201 360 11.1123 13.8903 20.8355 2.9118 Constraint 104 226 10.5899 13.2373 19.8560 2.9118 Constraint 144 557 8.6757 10.8446 16.2670 2.9028 Constraint 104 552 10.6484 13.3105 19.9658 2.9028 Constraint 136 604 7.0684 8.8354 13.2532 2.8587 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 88 571 10.4090 13.0112 19.5168 2.8077 Constraint 552 622 9.9191 12.3989 18.5984 2.8077 Constraint 461 622 7.2822 9.1028 13.6541 2.8035 Constraint 272 404 10.4058 13.0072 19.5108 2.8035 Constraint 169 590 10.6511 13.3139 19.9709 2.7942 Constraint 322 557 9.7496 12.1870 18.2806 2.7923 Constraint 461 636 10.0711 12.5889 18.8833 2.7872 Constraint 449 636 11.0017 13.7522 20.6283 2.7872 Constraint 113 657 8.6297 10.7871 16.1806 2.7852 Constraint 104 657 8.1524 10.1905 15.2858 2.7852 Constraint 237 585 9.1171 11.3963 17.0945 2.7788 Constraint 237 577 7.7052 9.6315 14.4472 2.7788 Constraint 210 585 8.4358 10.5448 15.8171 2.7788 Constraint 161 590 11.0577 13.8221 20.7331 2.7750 Constraint 161 585 8.9443 11.1804 16.7706 2.7750 Constraint 599 698 8.9064 11.1330 16.6995 2.7363 Constraint 599 687 7.0680 8.8350 13.2525 2.7363 Constraint 297 375 8.3638 10.4548 15.6822 2.7352 Constraint 279 375 9.3027 11.6283 17.4425 2.7352 Constraint 267 375 10.7887 13.4859 20.2288 2.7352 Constraint 144 585 9.6050 12.0063 18.0095 2.6678 Constraint 113 585 7.6468 9.5585 14.3377 2.6629 Constraint 435 552 9.5251 11.9063 17.8595 2.6498 Constraint 421 552 9.3675 11.7094 17.5641 2.6498 Constraint 421 544 9.1767 11.4709 17.2063 2.6498 Constraint 242 585 7.7008 9.6260 14.4390 2.6359 Constraint 429 557 10.4007 13.0009 19.5014 2.6335 Constraint 429 552 8.9636 11.2045 16.8068 2.6335 Constraint 435 544 9.2267 11.5334 17.3000 2.6315 Constraint 113 259 10.3132 12.8915 19.3373 2.6146 Constraint 169 577 7.4066 9.2583 13.8874 2.5968 Constraint 161 577 7.7613 9.7016 14.5524 2.5968 Constraint 136 599 8.5090 10.6362 15.9543 2.5968 Constraint 128 622 8.3024 10.3780 15.5670 2.5968 Constraint 96 577 8.6593 10.8241 16.2362 2.5968 Constraint 489 622 8.4680 10.5850 15.8774 2.5893 Constraint 511 629 8.5935 10.7419 16.1128 2.5874 Constraint 497 657 8.0800 10.1001 15.1501 2.5710 Constraint 382 467 10.5658 13.2072 19.8109 2.5709 Constraint 190 391 11.0918 13.8648 20.7972 2.5709 Constraint 176 412 10.0071 12.5089 18.7633 2.5709 Constraint 169 399 10.7936 13.4920 20.2380 2.5709 Constraint 161 435 11.1912 13.9890 20.9835 2.5709 Constraint 161 421 10.4982 13.1227 19.6841 2.5709 Constraint 242 519 7.4781 9.3476 14.0214 2.5479 Constraint 242 511 7.2780 9.0975 13.6463 2.5479 Constraint 136 226 9.5431 11.9289 17.8933 2.5369 Constraint 122 590 9.6373 12.0467 18.0700 2.4769 Constraint 442 535 8.8792 11.0990 16.6486 2.4623 Constraint 421 557 10.5830 13.2287 19.8431 2.4623 Constraint 435 590 8.1920 10.2401 15.3601 2.4539 Constraint 535 604 8.6099 10.7623 16.1435 2.4192 Constraint 511 599 8.9321 11.1651 16.7476 2.4192 Constraint 489 590 9.8725 12.3407 18.5110 2.4179 Constraint 169 676 10.0284 12.5355 18.8033 2.3894 Constraint 169 651 10.4787 13.0984 19.6476 2.3894 Constraint 210 657 9.2011 11.5014 17.2521 2.3817 Constraint 201 657 9.9595 12.4494 18.6741 2.3817 Constraint 435 571 10.4769 13.0961 19.6441 2.3335 Constraint 629 706 8.2403 10.3004 15.4506 2.3315 Constraint 622 706 9.0959 11.3699 17.0548 2.3315 Constraint 604 706 9.7835 12.2294 18.3440 2.3315 Constraint 599 706 6.5315 8.1644 12.2466 2.3315 Constraint 590 706 10.2211 12.7763 19.1645 2.3315 Constraint 590 687 10.2376 12.7970 19.1955 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 577 687 9.8766 12.3457 18.5186 2.3315 Constraint 571 706 8.9503 11.1879 16.7818 2.3315 Constraint 399 552 9.0877 11.3597 17.0395 2.3163 Constraint 442 577 8.3925 10.4907 15.7360 2.3144 Constraint 442 511 8.3613 10.4517 15.6775 2.3144 Constraint 657 735 9.0583 11.3229 16.9844 2.2378 Constraint 341 480 7.6242 9.5303 14.2955 2.2125 Constraint 128 644 9.0555 11.3194 16.9791 2.1920 Constraint 122 657 10.0431 12.5538 18.8307 2.1920 Constraint 122 651 10.2654 12.8318 19.2477 2.1920 Constraint 122 636 9.5847 11.9809 17.9714 2.1920 Constraint 122 629 7.0419 8.8024 13.2036 2.1920 Constraint 122 622 9.6509 12.0637 18.0955 2.1920 Constraint 113 599 8.8636 11.0795 16.6193 2.1920 Constraint 104 668 10.8116 13.5145 20.2717 2.1920 Constraint 104 644 9.4783 11.8479 17.7718 2.1920 Constraint 96 622 8.6153 10.7691 16.1537 2.1920 Constraint 96 604 7.4063 9.2578 13.8867 2.1920 Constraint 96 590 10.1118 12.6397 18.9596 2.1920 Constraint 104 404 8.5131 10.6414 15.9621 2.1895 Constraint 88 657 10.4072 13.0091 19.5136 2.1895 Constraint 355 651 8.4145 10.5181 15.7771 2.1459 Constraint 242 544 10.3918 12.9898 19.4847 2.1431 Constraint 153 577 8.1633 10.2041 15.3061 2.1431 Constraint 153 552 10.1294 12.6617 18.9926 2.1431 Constraint 577 644 9.5840 11.9800 17.9699 2.1305 Constraint 461 557 9.7020 12.1276 18.1913 2.0932 Constraint 461 544 7.4535 9.3169 13.9754 2.0932 Constraint 314 467 9.6929 12.1161 18.1742 2.0932 Constraint 303 473 10.8114 13.5143 20.2714 2.0932 Constraint 303 467 9.1620 11.4525 17.1787 2.0932 Constraint 303 461 10.6501 13.3126 19.9690 2.0932 Constraint 297 480 8.8569 11.0712 16.6068 2.0932 Constraint 297 473 7.4525 9.3156 13.9734 2.0932 Constraint 297 467 6.0963 7.6204 11.4305 2.0932 Constraint 297 461 9.0964 11.3705 17.0558 2.0932 Constraint 292 467 8.5327 10.6659 15.9989 2.0932 Constraint 279 467 10.8279 13.5349 20.3024 2.0932 Constraint 279 429 8.3726 10.4658 15.6986 2.0932 Constraint 272 480 10.7926 13.4908 20.2362 2.0932 Constraint 272 473 9.3970 11.7463 17.6194 2.0932 Constraint 272 467 9.3005 11.6257 17.4385 2.0932 Constraint 272 429 9.3583 11.6979 17.5469 2.0932 Constraint 221 473 10.3193 12.8991 19.3486 2.0932 Constraint 210 480 10.7090 13.3863 20.0794 2.0932 Constraint 201 473 9.7332 12.1665 18.2497 2.0932 Constraint 190 473 10.7726 13.4658 20.1987 2.0932 Constraint 182 480 8.3941 10.4926 15.7389 2.0932 Constraint 182 467 8.3746 10.4682 15.7024 2.0932 Constraint 176 480 10.9418 13.6773 20.5159 2.0932 Constraint 176 473 9.1772 11.4715 17.2073 2.0932 Constraint 169 535 8.8325 11.0406 16.5610 2.0932 Constraint 169 480 8.8303 11.0378 16.5568 2.0932 Constraint 169 473 6.4455 8.0569 12.0853 2.0932 Constraint 161 535 7.2072 9.0090 13.5135 2.0932 Constraint 161 497 9.8602 12.3253 18.4880 2.0932 Constraint 161 489 11.0008 13.7510 20.6265 2.0932 Constraint 161 480 7.1619 8.9524 13.4285 2.0932 Constraint 161 467 9.9677 12.4596 18.6894 2.0932 Constraint 153 480 10.4698 13.0872 19.6308 2.0932 Constraint 153 473 9.6864 12.1081 18.1621 2.0932 Constraint 144 480 10.1906 12.7382 19.1073 2.0932 Constraint 144 473 9.3012 11.6265 17.4398 2.0932 Constraint 136 535 9.2858 11.6072 17.4109 2.0932 Constraint 113 473 9.8646 12.3308 18.4962 2.0932 Constraint 161 322 10.7260 13.4075 20.1112 2.0872 Constraint 330 435 8.4002 10.5003 15.7504 2.0189 Constraint 421 571 8.2589 10.3236 15.4854 2.0163 Constraint 412 571 8.9100 11.1374 16.7062 2.0163 Constraint 355 571 8.3311 10.4139 15.6208 2.0163 Constraint 355 557 9.8334 12.2918 18.4377 2.0163 Constraint 350 571 10.4634 13.0792 19.6189 2.0163 Constraint 391 552 4.4313 5.5392 8.3088 2.0009 Constraint 382 557 7.3366 9.1708 13.7562 2.0009 Constraint 382 552 5.6671 7.0839 10.6258 2.0009 Constraint 368 552 5.4283 6.7854 10.1781 2.0009 Constraint 355 552 7.9621 9.9526 14.9289 2.0009 Constraint 161 242 10.7150 13.3937 20.0906 2.0002 Constraint 153 391 11.0097 13.7621 20.6432 2.0002 Constraint 144 435 11.1983 13.9978 20.9967 2.0002 Constraint 399 644 10.0291 12.5363 18.8045 2.0000 Constraint 497 651 9.5058 11.8822 17.8234 1.9981 Constraint 497 644 9.0724 11.3405 17.0108 1.9981 Constraint 489 657 8.7607 10.9509 16.4264 1.9981 Constraint 480 698 9.8229 12.2786 18.4179 1.9981 Constraint 480 668 8.7005 10.8757 16.3135 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 687 10.3057 12.8821 19.3231 1.9981 Constraint 473 676 10.3858 12.9822 19.4733 1.9981 Constraint 473 668 6.9545 8.6931 13.0397 1.9981 Constraint 557 629 8.2887 10.3609 15.5413 1.9980 Constraint 552 629 10.5665 13.2081 19.8122 1.9980 Constraint 544 629 9.4176 11.7720 17.6580 1.9980 Constraint 544 622 9.3960 11.7451 17.6176 1.9980 Constraint 629 729 10.2036 12.7545 19.1318 1.9962 Constraint 629 720 9.9871 12.4838 18.7257 1.9962 Constraint 629 713 7.2997 9.1246 13.6870 1.9962 Constraint 622 713 8.5429 10.6786 16.0179 1.9962 Constraint 571 657 9.7346 12.1683 18.2525 1.9962 Constraint 341 613 10.5304 13.1630 19.7445 1.9962 Constraint 341 604 8.8639 11.0798 16.6197 1.9962 Constraint 341 599 8.8635 11.0793 16.6190 1.9962 Constraint 341 590 7.7418 9.6772 14.5158 1.9962 Constraint 341 585 5.2670 6.5837 9.8755 1.9962 Constraint 341 571 6.0004 7.5005 11.2508 1.9962 Constraint 330 590 11.0894 13.8618 20.7927 1.9962 Constraint 330 571 7.3487 9.1859 13.7788 1.9962 Constraint 104 571 8.7676 10.9595 16.4392 1.9962 Constraint 527 604 6.4163 8.0204 12.0306 1.9941 Constraint 341 720 10.9728 13.7160 20.5740 1.9846 Constraint 341 676 10.7094 13.3867 20.0800 1.9846 Constraint 330 720 9.5377 11.9221 17.8831 1.9846 Constraint 330 713 7.5067 9.3834 14.0750 1.9846 Constraint 330 687 9.7457 12.1821 18.2731 1.9846 Constraint 322 713 10.5099 13.1374 19.7061 1.9846 Constraint 297 720 10.5132 13.1415 19.7122 1.9846 Constraint 297 713 9.0889 11.3611 17.0417 1.9846 Constraint 292 676 10.3952 12.9940 19.4911 1.9846 Constraint 279 706 10.3991 12.9989 19.4983 1.9846 Constraint 279 599 11.1627 13.9534 20.9301 1.9846 Constraint 272 706 9.7943 12.2429 18.3643 1.9846 Constraint 272 676 10.8300 13.5375 20.3062 1.9846 Constraint 242 636 10.9868 13.7335 20.6002 1.9846 Constraint 190 706 11.0090 13.7612 20.6418 1.9846 Constraint 182 713 10.7340 13.4174 20.1262 1.9846 Constraint 176 706 10.2032 12.7540 19.1310 1.9846 Constraint 404 571 5.4508 6.8135 10.2203 1.9846 Constraint 375 557 6.5926 8.2407 12.3610 1.9846 Constraint 360 557 7.7178 9.6473 14.4709 1.9846 Constraint 585 651 10.7623 13.4529 20.1793 1.9827 Constraint 314 557 8.1862 10.2328 15.3492 1.9827 Constraint 303 557 10.7445 13.4307 20.1460 1.9827 Constraint 330 636 8.2794 10.3492 15.5239 1.9801 Constraint 297 636 8.9892 11.2365 16.8548 1.9801 Constraint 330 657 7.8760 9.8450 14.7674 1.9769 Constraint 322 657 7.2372 9.0465 13.5697 1.9769 Constraint 297 657 7.8177 9.7722 14.6583 1.9769 Constraint 292 657 9.0668 11.3335 17.0002 1.9769 Constraint 272 657 9.5760 11.9699 17.9549 1.9769 Constraint 190 657 9.6770 12.0963 18.1444 1.9769 Constraint 527 644 9.9338 12.4172 18.6259 1.9759 Constraint 511 622 9.0621 11.3277 16.9915 1.9759 Constraint 511 604 8.4834 10.6043 15.9064 1.9759 Constraint 303 585 9.8953 12.3692 18.5538 1.9692 Constraint 292 585 7.8920 9.8650 14.7975 1.9692 Constraint 292 571 7.9270 9.9088 14.8632 1.9692 Constraint 285 585 9.5667 11.9584 17.9376 1.9692 Constraint 285 571 7.7020 9.6275 14.4412 1.9692 Constraint 272 577 8.3504 10.4380 15.6569 1.9692 Constraint 272 571 10.9814 13.7267 20.5900 1.9692 Constraint 267 577 8.2086 10.2607 15.3911 1.9692 Constraint 267 571 9.7471 12.1839 18.2759 1.9692 Constraint 259 585 8.9977 11.2472 16.8708 1.9692 Constraint 259 571 5.6666 7.0833 10.6250 1.9692 Constraint 250 585 10.4917 13.1147 19.6720 1.9692 Constraint 250 577 7.4155 9.2694 13.9041 1.9692 Constraint 250 571 5.3243 6.6553 9.9830 1.9692 Constraint 242 577 3.8055 4.7569 7.1353 1.9692 Constraint 242 571 3.7085 4.6356 6.9534 1.9692 Constraint 237 571 6.7731 8.4663 12.6995 1.9692 Constraint 226 577 9.1179 11.3974 17.0961 1.9692 Constraint 226 571 9.2552 11.5690 17.3535 1.9692 Constraint 221 585 10.3325 12.9156 19.3734 1.9692 Constraint 221 577 6.6368 8.2960 12.4440 1.9692 Constraint 221 571 8.3847 10.4809 15.7213 1.9692 Constraint 210 571 7.8219 9.7774 14.6661 1.9692 Constraint 201 571 11.0086 13.7608 20.6411 1.9692 Constraint 136 467 10.7044 13.3805 20.0708 1.9412 Constraint 136 272 10.3355 12.9194 19.3790 1.9412 Constraint 182 497 10.3738 12.9672 19.4508 1.8981 Constraint 153 604 6.8323 8.5404 12.8106 1.8812 Constraint 153 599 7.8215 9.7769 14.6653 1.8812 Constraint 144 636 8.6981 10.8727 16.3090 1.8582 Constraint 144 629 8.4161 10.5201 15.7802 1.8582 Constraint 144 613 9.9675 12.4594 18.6891 1.8582 Constraint 128 557 10.0925 12.6156 18.9235 1.8077 Constraint 113 557 9.6084 12.0104 18.0157 1.8077 Constraint 104 557 8.3254 10.4068 15.6102 1.8077 Constraint 182 622 10.8574 13.5718 20.3577 1.7974 Constraint 322 552 9.1956 11.4945 17.2418 1.7942 Constraint 314 552 6.9196 8.6495 12.9742 1.7942 Constraint 292 552 8.9778 11.2222 16.8333 1.7942 Constraint 259 552 9.0173 11.2716 16.9074 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 242 557 8.7726 10.9657 16.4486 1.7942 Constraint 242 552 7.5013 9.3766 14.0649 1.7942 Constraint 221 552 9.9863 12.4829 18.7243 1.7942 Constraint 210 557 9.6891 12.1114 18.1671 1.7942 Constraint 210 552 8.3974 10.4968 15.7451 1.7942 Constraint 201 651 9.5952 11.9940 17.9910 1.7942 Constraint 461 651 10.4994 13.1243 19.6864 1.7872 Constraint 461 644 10.2116 12.7645 19.1468 1.7872 Constraint 461 590 3.3842 4.2303 6.3454 1.7872 Constraint 449 651 8.8351 11.0439 16.5658 1.7872 Constraint 449 644 9.9363 12.4204 18.6306 1.7872 Constraint 449 590 6.2744 7.8430 11.7645 1.7872 Constraint 449 585 9.9539 12.4424 18.6635 1.7872 Constraint 421 651 10.4945 13.1181 19.6771 1.7872 Constraint 322 622 10.3515 12.9394 19.4090 1.7872 Constraint 322 467 9.4528 11.8160 17.7241 1.7872 Constraint 176 585 10.7471 13.4339 20.1508 1.7872 Constraint 161 636 9.0330 11.2913 16.9369 1.7872 Constraint 161 629 8.9436 11.1795 16.7692 1.7872 Constraint 161 613 9.6248 12.0310 18.0466 1.7872 Constraint 136 657 7.1117 8.8896 13.3344 1.7872 Constraint 136 636 5.7969 7.2462 10.8693 1.7872 Constraint 136 629 4.6170 5.7712 8.6569 1.7872 Constraint 136 613 7.9862 9.9827 14.9741 1.7872 Constraint 128 657 8.4148 10.5186 15.7778 1.7872 Constraint 128 651 8.5836 10.7295 16.0943 1.7872 Constraint 128 636 6.6865 8.3581 12.5372 1.7872 Constraint 128 629 4.3395 5.4244 8.1365 1.7872 Constraint 128 613 7.3990 9.2487 13.8731 1.7872 Constraint 128 590 8.3184 10.3980 15.5969 1.7872 Constraint 113 651 8.6349 10.7936 16.1904 1.7872 Constraint 113 636 8.6219 10.7774 16.1661 1.7872 Constraint 113 629 5.6900 7.1126 10.6688 1.7872 Constraint 113 622 9.7067 12.1334 18.2001 1.7872 Constraint 104 651 6.5019 8.1274 12.1911 1.7872 Constraint 104 636 7.6828 9.6035 14.4053 1.7872 Constraint 104 629 3.8781 4.8477 7.2715 1.7872 Constraint 104 622 6.9782 8.7228 13.0841 1.7872 Constraint 96 651 8.8209 11.0261 16.5391 1.7872 Constraint 96 629 5.9742 7.4678 11.2016 1.7872 Constraint 88 651 10.3560 12.9450 19.4175 1.7872 Constraint 88 629 8.0104 10.0130 15.0195 1.7872 Constraint 330 442 11.1162 13.8953 20.8429 1.7189 Constraint 442 585 6.5729 8.2162 12.3243 1.6831 Constraint 435 585 8.1151 10.1439 15.2158 1.6831 Constraint 412 585 6.9833 8.7291 13.0936 1.6831 Constraint 122 613 9.1287 11.4108 17.1162 1.6673 Constraint 599 720 9.1563 11.4453 17.1680 1.6648 Constraint 599 713 6.1760 7.7200 11.5799 1.6648 Constraint 571 713 7.6358 9.5447 14.3171 1.6648 Constraint 435 557 8.9772 11.2215 16.8322 1.6335 Constraint 435 535 5.9426 7.4282 11.1424 1.6335 Constraint 435 519 5.7412 7.1765 10.7647 1.6335 Constraint 429 544 8.7291 10.9113 16.3670 1.6335 Constraint 412 519 8.1407 10.1759 15.2638 1.6335 Constraint 412 511 5.9768 7.4709 11.2064 1.6335 Constraint 136 668 9.5754 11.9692 17.9539 1.5963 Constraint 136 644 8.3078 10.3848 15.5772 1.5963 Constraint 113 644 10.0681 12.5851 18.8777 1.5963 Constraint 497 636 7.9848 9.9810 14.9715 1.5730 Constraint 391 657 9.7675 12.2094 18.3140 1.5730 Constraint 368 657 8.6963 10.8704 16.3056 1.5730 Constraint 360 657 8.7110 10.8887 16.3331 1.5730 Constraint 527 657 5.6954 7.1193 10.6790 1.5710 Constraint 527 651 8.4736 10.5920 15.8880 1.5710 Constraint 341 668 10.8043 13.5053 20.2580 1.5653 Constraint 341 657 9.5625 11.9531 17.9296 1.5576 Constraint 153 613 9.9345 12.4181 18.6271 1.4763 Constraint 153 590 9.9619 12.4524 18.6786 1.4763 Constraint 153 585 7.7574 9.6968 14.5452 1.4763 Constraint 442 557 9.1116 11.3895 17.0842 1.4459 Constraint 88 613 10.2633 12.8291 19.2436 1.4048 Constraint 599 676 10.0672 12.5839 18.8759 1.4029 Constraint 535 622 5.9173 7.3966 11.0949 1.4029 Constraint 535 613 7.7738 9.7173 14.5760 1.4029 Constraint 527 668 8.2804 10.3505 15.5258 1.4029 Constraint 519 668 10.0923 12.6154 18.9231 1.4029 Constraint 519 657 8.4097 10.5122 15.7682 1.4029 Constraint 190 698 10.2704 12.8379 19.2569 1.3971 Constraint 182 698 9.2078 11.5097 17.2646 1.3971 Constraint 176 698 9.8345 12.2931 18.4397 1.3971 Constraint 169 657 9.5997 11.9996 17.9994 1.3971 Constraint 237 644 7.9563 9.9454 14.9180 1.3894 Constraint 210 651 9.0713 11.3392 17.0087 1.3894 Constraint 412 544 10.2970 12.8712 19.3068 1.3335 Constraint 237 535 10.7519 13.4398 20.1598 1.3335 Constraint 237 511 7.9993 9.9992 14.9988 1.3335 Constraint 210 511 8.6557 10.8196 16.2294 1.3335 Constraint 201 511 10.1508 12.6885 19.0328 1.3335 Constraint 169 544 10.1009 12.6262 18.9392 1.3335 Constraint 169 519 10.5864 13.2330 19.8495 1.3335 Constraint 169 511 8.0333 10.0416 15.0624 1.3335 Constraint 161 511 9.9317 12.4146 18.6219 1.3335 Constraint 153 571 9.7223 12.1529 18.2294 1.3335 Constraint 153 544 6.2938 7.8672 11.8008 1.3335 Constraint 153 519 7.4040 9.2550 13.8824 1.3335 Constraint 153 511 5.5102 6.8878 10.3317 1.3335 Constraint 144 519 6.5377 8.1721 12.2581 1.3335 Constraint 144 511 7.2353 9.0441 13.5662 1.3335 Constraint 136 544 10.4278 13.0347 19.5521 1.3335 Constraint 136 519 10.4001 13.0001 19.5002 1.3335 Constraint 136 511 10.4618 13.0772 19.6158 1.3335 Constraint 128 544 10.5721 13.2151 19.8227 1.3335 Constraint 128 519 9.7200 12.1500 18.2250 1.3335 Constraint 128 511 8.5913 10.7391 16.1086 1.3335 Constraint 442 571 9.5507 11.9384 17.9075 1.3163 Constraint 279 382 8.3566 10.4458 15.6686 1.3163 Constraint 442 544 7.7749 9.7187 14.5780 1.2981 Constraint 80 412 10.7060 13.3825 20.0737 1.2914 Constraint 96 585 9.7146 12.1432 18.2149 1.2625 Constraint 519 590 8.3988 10.4985 15.7478 1.2144 Constraint 391 480 5.6569 7.0711 10.6066 1.2144 Constraint 382 519 9.7185 12.1481 18.2221 1.2144 Constraint 382 489 7.2620 9.0775 13.6162 1.2144 Constraint 368 489 9.4669 11.8337 17.7505 1.2144 Constraint 368 480 7.0504 8.8130 13.2195 1.2144 Constraint 350 489 8.9427 11.1784 16.7676 1.2144 Constraint 350 480 10.1186 12.6482 18.9723 1.2144 Constraint 341 511 10.3718 12.9648 19.4471 1.2144 Constraint 341 497 5.9419 7.4274 11.1411 1.2144 Constraint 341 489 7.8308 9.7886 14.6828 1.2144 Constraint 303 489 8.7292 10.9115 16.3673 1.2144 Constraint 292 519 9.0591 11.3239 16.9859 1.2144 Constraint 292 489 6.3263 7.9079 11.8618 1.2144 Constraint 285 519 10.8303 13.5379 20.3069 1.2144 Constraint 285 489 7.0351 8.7938 13.1908 1.2144 Constraint 285 480 9.6392 12.0489 18.0734 1.2144 Constraint 279 489 10.8972 13.6215 20.4322 1.2144 Constraint 272 489 10.6134 13.2667 19.9001 1.2144 Constraint 267 489 9.3743 11.7178 17.5767 1.2144 Constraint 259 519 8.0159 10.0198 15.0297 1.2144 Constraint 259 511 10.8396 13.5495 20.3243 1.2144 Constraint 259 489 5.1701 6.4627 9.6940 1.2144 Constraint 259 480 8.0609 10.0761 15.1141 1.2144 Constraint 250 527 9.9982 12.4978 18.7467 1.2144 Constraint 250 519 7.1876 8.9845 13.4767 1.2144 Constraint 250 511 10.3391 12.9239 19.3858 1.2144 Constraint 250 497 10.5856 13.2320 19.8479 1.2144 Constraint 250 489 6.4126 8.0157 12.0236 1.2144 Constraint 250 480 7.1196 8.8995 13.3492 1.2144 Constraint 242 489 3.5212 4.4015 6.6023 1.2144 Constraint 242 480 6.5917 8.2397 12.3595 1.2144 Constraint 237 527 9.7272 12.1589 18.2384 1.2144 Constraint 237 519 8.1344 10.1680 15.2520 1.2144 Constraint 237 489 9.6479 12.0599 18.0898 1.2144 Constraint 226 527 10.9584 13.6980 20.5470 1.2144 Constraint 226 519 9.6801 12.1001 18.1502 1.2144 Constraint 226 489 9.3572 11.6965 17.5447 1.2144 Constraint 221 519 8.2803 10.3504 15.5256 1.2144 Constraint 221 497 9.9331 12.4164 18.6246 1.2144 Constraint 221 489 6.5848 8.2310 12.3466 1.2144 Constraint 221 480 10.1069 12.6336 18.9504 1.2144 Constraint 210 535 10.7663 13.4578 20.1868 1.2144 Constraint 210 519 7.9078 9.8848 14.8272 1.2144 Constraint 201 527 10.9891 13.7363 20.6045 1.2144 Constraint 201 519 11.1715 13.9644 20.9466 1.2144 Constraint 190 489 10.9236 13.6545 20.4817 1.2144 Constraint 190 330 11.1202 13.9003 20.8504 1.2144 Constraint 182 527 9.3854 11.7318 17.5977 1.2144 Constraint 182 489 9.8530 12.3162 18.4743 1.2144 Constraint 169 527 10.3805 12.9757 19.4635 1.2144 Constraint 144 657 9.2335 11.5419 17.3128 1.1914 Constraint 136 676 10.8694 13.5867 20.3801 1.1914 Constraint 136 651 7.2313 9.0392 13.5587 1.1914 Constraint 136 622 7.0927 8.8659 13.2988 1.1914 Constraint 136 590 9.1766 11.4707 17.2060 1.1914 Constraint 136 429 11.0297 13.7871 20.6807 1.1914 Constraint 113 668 10.4757 13.0946 19.6420 1.1914 Constraint 104 676 10.6605 13.3257 19.9885 1.1914 Constraint 80 657 8.6727 10.8409 16.2613 1.1914 Constraint 80 651 7.3178 9.1473 13.7209 1.1914 Constraint 80 636 10.8092 13.5115 20.2672 1.1914 Constraint 80 629 7.0227 8.7783 13.1675 1.1914 Constraint 80 622 9.2976 11.6219 17.4329 1.1914 Constraint 80 604 10.8109 13.5137 20.2705 1.1914 Constraint 80 599 9.2290 11.5362 17.3043 1.1914 Constraint 80 442 9.6345 12.0432 18.0647 1.1914 Constraint 449 557 9.8838 12.3548 18.5321 1.1459 Constraint 355 644 9.2784 11.5981 17.3971 1.1459 Constraint 355 604 11.1533 13.9417 20.9125 1.1459 Constraint 350 651 9.9689 12.4611 18.6917 1.1459 Constraint 80 285 10.9536 13.6920 20.5381 1.1163 Constraint 153 636 10.4342 13.0427 19.5641 1.0715 Constraint 153 629 10.0957 12.6196 18.9294 1.0715 Constraint 412 557 8.9379 11.1723 16.7585 1.0163 Constraint 412 552 5.8940 7.3675 11.0512 1.0163 Constraint 404 552 8.6501 10.8127 16.2190 1.0163 Constraint 355 449 9.9468 12.4335 18.6503 1.0163 Constraint 355 442 10.3295 12.9119 19.3678 1.0163 Constraint 350 544 9.6767 12.0958 18.1437 1.0163 Constraint 330 535 10.4667 13.0834 19.6251 1.0163 Constraint 267 404 10.6932 13.3665 20.0497 1.0163 Constraint 80 375 10.0830 12.6038 18.9057 1.0163 Constraint 69 259 9.9626 12.4532 18.6798 1.0163 Constraint 58 375 8.2818 10.3523 15.5285 1.0163 Constraint 58 368 11.0972 13.8715 20.8073 1.0163 Constraint 51 375 10.0852 12.6065 18.9097 1.0163 Constraint 51 314 8.1908 10.2385 15.3577 1.0163 Constraint 51 303 11.0510 13.8137 20.7206 1.0163 Constraint 51 285 9.7781 12.2226 18.3339 1.0163 Constraint 51 259 9.1874 11.4842 17.2263 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 242 8.0307 10.0384 15.0575 1.0163 Constraint 41 242 10.4645 13.0807 19.6210 1.0163 Constraint 128 676 10.0834 12.6043 18.9064 1.0005 Constraint 128 668 8.3309 10.4136 15.6204 1.0005 Constraint 122 644 8.3602 10.4502 15.6753 1.0005 Constraint 96 668 9.9528 12.4410 18.6615 1.0005 Constraint 96 644 8.6171 10.7714 16.1571 1.0005 Constraint 96 613 8.8156 11.0195 16.5293 1.0005 Constraint 88 622 10.0416 12.5520 18.8280 1.0005 Constraint 88 590 10.6398 13.2997 19.9496 1.0005 Constraint 489 644 10.5921 13.2402 19.8602 1.0000 Constraint 489 636 6.8434 8.5543 12.8314 1.0000 Constraint 480 676 10.6674 13.3343 20.0014 1.0000 Constraint 480 651 8.9817 11.2271 16.8407 1.0000 Constraint 467 668 9.2723 11.5904 17.3856 1.0000 Constraint 467 657 8.4741 10.5927 15.8890 1.0000 Constraint 467 644 9.9581 12.4477 18.6715 1.0000 Constraint 467 571 8.8124 11.0155 16.5232 1.0000 Constraint 461 657 10.9175 13.6469 20.4704 1.0000 Constraint 449 571 10.8866 13.6083 20.4124 1.0000 Constraint 435 657 9.9291 12.4113 18.6170 1.0000 Constraint 435 636 10.5739 13.2173 19.8260 1.0000 Constraint 429 668 10.5215 13.1518 19.7277 1.0000 Constraint 429 657 7.7969 9.7461 14.6191 1.0000 Constraint 429 651 10.6451 13.3064 19.9596 1.0000 Constraint 429 644 11.0602 13.8253 20.7379 1.0000 Constraint 429 571 7.4999 9.3749 14.0623 1.0000 Constraint 421 657 10.1195 12.6493 18.9740 1.0000 Constraint 412 657 9.6869 12.1086 18.1629 1.0000 Constraint 412 636 11.0474 13.8093 20.7139 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 687 8.6870 10.8587 16.2881 1.0000 Constraint 404 676 10.9343 13.6678 20.5017 1.0000 Constraint 404 668 9.1501 11.4376 17.1563 1.0000 Constraint 404 557 10.8443 13.5553 20.3330 1.0000 Constraint 399 687 10.0466 12.5582 18.8373 1.0000 Constraint 399 676 11.0780 13.8474 20.7712 1.0000 Constraint 399 668 9.8918 12.3648 18.5472 1.0000 Constraint 399 657 6.3181 7.8977 11.8465 1.0000 Constraint 399 557 7.7088 9.6361 14.4541 1.0000 Constraint 391 651 10.0309 12.5387 18.8080 1.0000 Constraint 391 636 10.6388 13.2985 19.9477 1.0000 Constraint 382 698 10.8883 13.6103 20.4155 1.0000 Constraint 382 687 8.7387 10.9234 16.3851 1.0000 Constraint 382 636 10.4931 13.1164 19.6745 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 687 5.9127 7.3909 11.0863 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 368 687 9.6089 12.0111 18.0167 1.0000 Constraint 368 644 10.8948 13.6185 20.4277 1.0000 Constraint 368 636 10.1229 12.6536 18.9804 1.0000 Constraint 360 651 8.4208 10.5259 15.7889 1.0000 Constraint 360 644 10.4076 13.0095 19.5142 1.0000 Constraint 360 636 8.7946 10.9932 16.4898 1.0000 Constraint 355 629 7.8913 9.8641 14.7962 1.0000 Constraint 350 629 10.9962 13.7452 20.6179 1.0000 Constraint 314 629 9.5009 11.8761 17.8141 1.0000 Constraint 88 636 11.0830 13.8537 20.7806 1.0000 Constraint 657 742 10.3777 12.9721 19.4581 0.9981 Constraint 651 742 10.3891 12.9864 19.4796 0.9981 Constraint 651 735 8.2078 10.2598 15.3896 0.9981 Constraint 644 742 6.3980 7.9974 11.9962 0.9981 Constraint 644 735 5.7327 7.1659 10.7489 0.9981 Constraint 644 729 9.7135 12.1418 18.2127 0.9981 Constraint 644 720 9.1384 11.4230 17.1345 0.9981 Constraint 636 713 11.0753 13.8441 20.7662 0.9981 Constraint 629 742 7.6822 9.6027 14.4041 0.9981 Constraint 629 735 5.9832 7.4790 11.2185 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 622 729 8.4502 10.5627 15.8440 0.9981 Constraint 622 720 9.2851 11.6063 17.4095 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 613 713 9.0649 11.3311 16.9967 0.9981 Constraint 604 742 8.0595 10.0744 15.1116 0.9981 Constraint 604 735 8.8596 11.0744 16.6117 0.9981 Constraint 604 713 7.8759 9.8448 14.7672 0.9981 Constraint 599 735 10.9187 13.6484 20.4725 0.9981 Constraint 599 729 8.7329 10.9162 16.3742 0.9981 Constraint 590 729 10.3165 12.8956 19.3434 0.9981 Constraint 590 713 6.6136 8.2670 12.4005 0.9981 Constraint 585 713 9.0195 11.2744 16.9116 0.9981 Constraint 585 687 10.5611 13.2014 19.8020 0.9981 Constraint 577 720 11.0270 13.7838 20.6757 0.9981 Constraint 577 713 6.5224 8.1530 12.2296 0.9981 Constraint 577 698 8.4435 10.5543 15.8315 0.9981 Constraint 571 729 9.8530 12.3163 18.4744 0.9981 Constraint 571 720 10.0309 12.5386 18.8079 0.9981 Constraint 571 698 10.5005 13.1256 19.6884 0.9981 Constraint 571 687 10.3707 12.9633 19.4450 0.9981 Constraint 571 651 10.2944 12.8680 19.3020 0.9981 Constraint 557 713 9.4188 11.7735 17.6602 0.9981 Constraint 557 698 10.5564 13.1955 19.7932 0.9981 Constraint 557 687 9.4462 11.8077 17.7116 0.9981 Constraint 557 668 10.3037 12.8796 19.3194 0.9981 Constraint 557 657 6.2669 7.8336 11.7504 0.9981 Constraint 557 651 7.9421 9.9276 14.8914 0.9981 Constraint 557 644 10.1670 12.7088 19.0632 0.9981 Constraint 552 698 10.9559 13.6949 20.5423 0.9981 Constraint 552 687 10.8262 13.5327 20.2990 0.9981 Constraint 552 657 8.1605 10.2006 15.3009 0.9981 Constraint 552 651 11.1501 13.9377 20.9065 0.9981 Constraint 544 657 8.6579 10.8224 16.2335 0.9981 Constraint 535 735 8.9201 11.1501 16.7251 0.9981 Constraint 535 713 9.7139 12.1424 18.2135 0.9981 Constraint 535 698 8.6861 10.8576 16.2864 0.9981 Constraint 535 687 9.2070 11.5087 17.2631 0.9981 Constraint 535 676 10.4339 13.0423 19.5635 0.9981 Constraint 535 668 7.7306 9.6632 14.4948 0.9981 Constraint 535 657 4.9366 6.1708 9.2562 0.9981 Constraint 535 651 7.8508 9.8135 14.7203 0.9981 Constraint 535 644 8.3096 10.3870 15.5805 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 527 706 10.1745 12.7181 19.0772 0.9981 Constraint 527 698 6.3442 7.9303 11.8954 0.9981 Constraint 527 687 6.7382 8.4227 12.6341 0.9981 Constraint 527 676 9.5579 11.9474 17.9211 0.9981 Constraint 519 735 11.1465 13.9331 20.8997 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 519 698 8.4419 10.5524 15.8287 0.9981 Constraint 519 687 10.3324 12.9155 19.3733 0.9981 Constraint 511 735 8.6213 10.7766 16.1649 0.9981 Constraint 511 713 9.0139 11.2673 16.9010 0.9981 Constraint 511 698 8.7420 10.9275 16.3912 0.9981 Constraint 511 687 11.0652 13.8315 20.7473 0.9981 Constraint 511 668 8.5904 10.7380 16.1070 0.9981 Constraint 511 657 7.3691 9.2114 13.8172 0.9981 Constraint 511 651 11.1142 13.8928 20.8391 0.9981 Constraint 511 644 10.6316 13.2895 19.9343 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 497 706 8.3556 10.4446 15.6668 0.9981 Constraint 497 698 4.7218 5.9023 8.8534 0.9981 Constraint 497 687 7.2198 9.0248 13.5372 0.9981 Constraint 497 676 8.1861 10.2326 15.3489 0.9981 Constraint 497 668 4.6526 5.8158 8.7236 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 489 706 8.2414 10.3018 15.4527 0.9981 Constraint 489 698 5.0606 6.3257 9.4886 0.9981 Constraint 489 687 8.4643 10.5803 15.8705 0.9981 Constraint 489 676 10.6549 13.3186 19.9779 0.9981 Constraint 489 668 7.9303 9.9129 14.8694 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 473 706 9.9078 12.3847 18.5771 0.9981 Constraint 341 557 4.0760 5.0950 7.6424 0.9981 Constraint 330 557 7.3426 9.1782 13.7673 0.9981 Constraint 330 480 7.3610 9.2013 13.8019 0.9981 Constraint 322 480 8.2735 10.3419 15.5128 0.9981 Constraint 314 713 10.2837 12.8546 19.2819 0.9981 Constraint 314 706 10.4701 13.0877 19.6315 0.9981 Constraint 314 698 9.6487 12.0609 18.0914 0.9981 Constraint 303 713 10.9256 13.6570 20.4854 0.9981 Constraint 303 706 10.7129 13.3911 20.0867 0.9981 Constraint 303 698 11.1062 13.8828 20.8242 0.9981 Constraint 303 480 10.5523 13.1904 19.7856 0.9981 Constraint 285 698 10.3873 12.9841 19.4762 0.9981 Constraint 259 698 10.9195 13.6494 20.4741 0.9981 Constraint 136 480 9.9638 12.4548 18.6821 0.9981 Constraint 136 404 8.4503 10.5629 15.8444 0.9981 Constraint 136 399 9.9197 12.3997 18.5995 0.9981 Constraint 136 382 9.9465 12.4331 18.6497 0.9981 Constraint 128 382 10.9809 13.7262 20.5893 0.9981 Constraint 113 435 11.0266 13.7832 20.6748 0.9981 Constraint 113 404 7.4760 9.3449 14.0174 0.9981 Constraint 113 382 10.8415 13.5519 20.3278 0.9981 Constraint 104 382 7.7674 9.7093 14.5640 0.9981 Constraint 88 698 10.4801 13.1001 19.6501 0.9981 Constraint 341 706 10.1238 12.6547 18.9820 0.9923 Constraint 330 698 8.6480 10.8099 16.2149 0.9923 Constraint 322 698 10.8167 13.5209 20.2813 0.9923 Constraint 297 698 8.3888 10.4860 15.7290 0.9923 Constraint 292 636 10.8944 13.6179 20.4269 0.9923 Constraint 279 698 10.3953 12.9942 19.4913 0.9923 Constraint 279 442 11.0732 13.8415 20.7623 0.9923 Constraint 272 698 9.8110 12.2637 18.3956 0.9923 Constraint 272 636 10.9185 13.6482 20.4723 0.9923 Constraint 190 636 9.6573 12.0716 18.1075 0.9923 Constraint 330 629 7.7779 9.7224 14.5836 0.9878 Constraint 330 613 10.2799 12.8499 19.2748 0.9878 Constraint 330 599 9.6271 12.0338 18.0507 0.9878 Constraint 303 636 10.5455 13.1819 19.7728 0.9878 Constraint 303 629 10.0460 12.5575 18.8363 0.9878 Constraint 297 629 6.3573 7.9466 11.9198 0.9878 Constraint 297 622 10.2732 12.8415 19.2623 0.9878 Constraint 297 613 10.8206 13.5258 20.2887 0.9878 Constraint 279 651 10.4253 13.0316 19.5474 0.9878 Constraint 279 629 9.2555 11.5694 17.3541 0.9878 Constraint 221 613 11.1034 13.8793 20.8190 0.9878 Constraint 182 613 10.8360 13.5450 20.3175 0.9878 Constraint 182 590 11.1880 13.9850 20.9775 0.9878 Constraint 176 590 10.9603 13.7004 20.5505 0.9878 Constraint 161 622 11.1448 13.9310 20.8965 0.9878 Constraint 571 644 10.4887 13.1109 19.6663 0.9846 Constraint 350 552 8.8733 11.0916 16.6373 0.9846 Constraint 314 657 9.1355 11.4193 17.1290 0.9846 Constraint 314 644 9.2033 11.5041 17.2562 0.9846 Constraint 303 657 10.1917 12.7396 19.1094 0.9846 Constraint 297 552 9.9169 12.3962 18.5942 0.9846 Constraint 292 651 10.3893 12.9866 19.4799 0.9846 Constraint 292 557 9.9967 12.4958 18.7438 0.9846 Constraint 285 644 11.1386 13.9233 20.8849 0.9846 Constraint 285 557 9.8546 12.3182 18.4774 0.9846 Constraint 285 552 7.2041 9.0051 13.5076 0.9846 Constraint 279 552 10.8947 13.6184 20.4275 0.9846 Constraint 267 552 10.6722 13.3403 20.0104 0.9846 Constraint 259 644 10.2038 12.7547 19.1321 0.9846 Constraint 259 557 9.0472 11.3089 16.9634 0.9846 Constraint 250 557 9.4593 11.8241 17.7361 0.9846 Constraint 242 644 8.4118 10.5148 15.7722 0.9846 Constraint 237 557 10.1300 12.6625 18.9938 0.9846 Constraint 226 644 9.5891 11.9864 17.9796 0.9846 Constraint 221 657 10.2789 12.8487 19.2730 0.9846 Constraint 221 644 8.3477 10.4346 15.6519 0.9846 Constraint 519 613 6.3803 7.9754 11.9631 0.9778 Constraint 519 604 6.6833 8.3541 12.5312 0.9778 Constraint 511 613 6.8994 8.6243 12.9364 0.9778 Constraint 113 297 10.4631 13.0789 19.6184 0.8957 Constraint 113 285 10.7919 13.4899 20.2348 0.8957 Constraint 113 272 10.5528 13.1910 19.7865 0.8957 Constraint 113 190 9.2806 11.6008 17.4011 0.8957 Constraint 88 176 9.5469 11.9336 17.9004 0.8957 Constraint 88 161 10.4345 13.0432 19.5648 0.8957 Constraint 259 473 10.9731 13.7164 20.5746 0.8096 Constraint 237 552 7.6020 9.5025 14.2538 0.8096 Constraint 237 544 10.8125 13.5156 20.2734 0.8096 Constraint 226 613 10.7175 13.3969 20.0953 0.8096 Constraint 226 552 10.2932 12.8665 19.2997 0.8096 Constraint 210 544 10.4224 13.0281 19.5421 0.8096 Constraint 201 585 10.6297 13.2871 19.9306 0.8096 Constraint 201 552 9.7649 12.2062 18.3092 0.8096 Constraint 190 622 8.3884 10.4855 15.7283 0.8096 Constraint 182 552 10.5515 13.1894 19.7840 0.8096 Constraint 169 557 10.4493 13.0616 19.5924 0.8096 Constraint 169 552 9.4112 11.7641 17.6461 0.8096 Constraint 153 622 9.9916 12.4896 18.7343 0.8096 Constraint 153 557 9.9025 12.3782 18.5673 0.8096 Constraint 128 552 8.7948 10.9934 16.4902 0.8096 Constraint 122 571 9.1961 11.4952 17.2427 0.8096 Constraint 122 557 5.4965 6.8707 10.3060 0.8096 Constraint 96 571 9.2539 11.5674 17.3511 0.8096 Constraint 96 557 5.1863 6.4829 9.7244 0.8096 Constraint 96 552 5.9733 7.4667 11.2000 0.8096 Constraint 96 544 8.9679 11.2098 16.8148 0.8096 Constraint 88 557 4.7265 5.9081 8.8622 0.8096 Constraint 442 636 10.1742 12.7177 19.0766 0.6667 Constraint 201 742 10.2861 12.8577 19.2865 0.6667 Constraint 161 742 9.4543 11.8178 17.7267 0.6667 Constraint 161 735 8.4692 10.5866 15.8798 0.6667 Constraint 161 729 9.4662 11.8328 17.7492 0.6667 Constraint 161 720 9.3997 11.7497 17.6245 0.6667 Constraint 144 590 10.3923 12.9904 19.4855 0.6667 Constraint 113 687 10.7676 13.4595 20.1892 0.5957 Constraint 104 687 10.0969 12.6211 18.9317 0.5957 Constraint 96 676 10.6319 13.2899 19.9349 0.5957 Constraint 96 657 7.3977 9.2471 13.8707 0.5957 Constraint 96 636 7.5583 9.4479 14.1719 0.5957 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 527 636 7.1172 8.8965 13.3447 0.5730 Constraint 519 644 10.8467 13.5584 20.3376 0.5730 Constraint 519 636 8.5065 10.6331 15.9496 0.5730 Constraint 511 636 8.4084 10.5105 15.7658 0.5730 Constraint 391 668 9.4962 11.8703 17.8054 0.5730 Constraint 368 668 8.1626 10.2032 15.3049 0.5730 Constraint 360 668 8.9643 11.2054 16.8081 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 355 698 11.0780 13.8475 20.7712 0.5730 Constraint 355 687 10.6953 13.3691 20.0536 0.5730 Constraint 355 668 5.3895 6.7369 10.1053 0.5730 Constraint 355 657 3.5466 4.4332 6.6498 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 350 668 9.1543 11.4429 17.1644 0.5730 Constraint 350 657 6.2417 7.8022 11.7033 0.5730 Constraint 590 668 10.4672 13.0840 19.6259 0.4048 Constraint 511 590 5.0807 6.3508 9.5263 0.4048 Constraint 259 668 11.1550 13.9437 20.9155 0.4048 Constraint 250 698 10.7945 13.4932 20.2397 0.4048 Constraint 242 698 10.3762 12.9703 19.4554 0.4048 Constraint 242 668 9.1556 11.4446 17.1668 0.4048 Constraint 242 657 11.0865 13.8581 20.7871 0.4048 Constraint 237 698 4.3036 5.3795 8.0693 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 237 676 8.4658 10.5822 15.8733 0.4048 Constraint 237 668 5.1247 6.4058 9.6087 0.4048 Constraint 237 657 6.2235 7.7794 11.6692 0.4048 Constraint 237 651 9.7672 12.2090 18.3135 0.4048 Constraint 226 698 6.4367 8.0458 12.0687 0.4048 Constraint 226 687 10.6659 13.3324 19.9986 0.4048 Constraint 226 676 10.9952 13.7440 20.6159 0.4048 Constraint 226 668 8.1171 10.1463 15.2195 0.4048 Constraint 226 657 10.1158 12.6448 18.9672 0.4048 Constraint 221 698 9.2067 11.5083 17.2625 0.4048 Constraint 221 668 8.5871 10.7338 16.1007 0.4048 Constraint 210 698 7.2955 9.1193 13.6790 0.4048 Constraint 210 687 10.0080 12.5100 18.7650 0.4048 Constraint 210 676 8.4754 10.5942 15.8913 0.4048 Constraint 201 729 9.2546 11.5682 17.3523 0.4048 Constraint 201 698 4.5555 5.6944 8.5416 0.4048 Constraint 201 687 8.3711 10.4639 15.6959 0.4048 Constraint 201 676 7.1609 8.9511 13.4266 0.4048 Constraint 190 676 11.0175 13.7719 20.6579 0.4048 Constraint 176 729 9.7777 12.2222 18.3333 0.4048 Constraint 169 698 8.1966 10.2457 15.3685 0.4048 Constraint 169 687 9.7608 12.2011 18.3016 0.4048 Constraint 161 676 8.0481 10.0601 15.0902 0.4048 Constraint 161 668 9.4978 11.8723 17.8084 0.4048 Constraint 161 644 8.6326 10.7907 16.1861 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 153 668 6.2813 7.8517 11.7775 0.4048 Constraint 153 657 9.6250 12.0313 18.0470 0.4048 Constraint 153 651 7.9267 9.9084 14.8626 0.4048 Constraint 153 644 4.1787 5.2234 7.8351 0.4048 Constraint 144 676 9.6590 12.0738 18.1107 0.4048 Constraint 144 668 9.6905 12.1131 18.1696 0.4048 Constraint 144 651 10.8684 13.5855 20.3783 0.4048 Constraint 144 644 6.8687 8.5859 12.8789 0.4048 Constraint 128 698 10.4838 13.1047 19.6570 0.4048 Constraint 122 676 9.3863 11.7329 17.5994 0.4048 Constraint 122 668 7.3367 9.1709 13.7564 0.4048 Constraint 88 644 10.0851 12.6064 18.9096 0.4048 Constraint 80 557 8.6085 10.7606 16.1409 0.4048 Constraint 33 375 11.0191 13.7738 20.6608 0.3388 Constraint 33 314 10.9521 13.6901 20.5351 0.3388 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 182 382 11.1724 13.9655 20.9482 0.3000 Constraint 136 391 10.4496 13.0619 19.5929 0.3000 Constraint 122 382 10.7863 13.4829 20.2244 0.3000 Constraint 122 303 10.5270 13.1587 19.7381 0.3000 Constraint 88 382 7.8194 9.7743 14.6614 0.3000 Constraint 80 391 7.5489 9.4361 14.1542 0.1000 Constraint 80 382 9.9136 12.3919 18.5879 0.1000 Constraint 80 221 9.7599 12.1998 18.2997 0.1000 Constraint 80 201 10.4561 13.0702 19.6052 0.1000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 729 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 742 0.8000 1.0000 1.5000 0.0000 Constraint 636 735 0.8000 1.0000 1.5000 0.0000 Constraint 636 729 0.8000 1.0000 1.5000 0.0000 Constraint 636 720 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 742 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 729 0.8000 1.0000 1.5000 0.0000 Constraint 613 720 0.8000 1.0000 1.5000 0.0000 Constraint 613 706 0.8000 1.0000 1.5000 0.0000 Constraint 613 698 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 729 0.8000 1.0000 1.5000 0.0000 Constraint 604 720 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 742 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 742 0.8000 1.0000 1.5000 0.0000 Constraint 590 735 0.8000 1.0000 1.5000 0.0000 Constraint 590 720 0.8000 1.0000 1.5000 0.0000 Constraint 590 698 0.8000 1.0000 1.5000 0.0000 Constraint 590 676 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 742 0.8000 1.0000 1.5000 0.0000 Constraint 585 735 0.8000 1.0000 1.5000 0.0000 Constraint 585 729 0.8000 1.0000 1.5000 0.0000 Constraint 585 720 0.8000 1.0000 1.5000 0.0000 Constraint 585 706 0.8000 1.0000 1.5000 0.0000 Constraint 585 698 0.8000 1.0000 1.5000 0.0000 Constraint 585 676 0.8000 1.0000 1.5000 0.0000 Constraint 585 668 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 735 0.8000 1.0000 1.5000 0.0000 Constraint 577 729 0.8000 1.0000 1.5000 0.0000 Constraint 577 676 0.8000 1.0000 1.5000 0.0000 Constraint 577 668 0.8000 1.0000 1.5000 0.0000 Constraint 577 651 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 742 0.8000 1.0000 1.5000 0.0000 Constraint 571 735 0.8000 1.0000 1.5000 0.0000 Constraint 571 676 0.8000 1.0000 1.5000 0.0000 Constraint 571 668 0.8000 1.0000 1.5000 0.0000 Constraint 571 636 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 742 0.8000 1.0000 1.5000 0.0000 Constraint 557 735 0.8000 1.0000 1.5000 0.0000 Constraint 557 729 0.8000 1.0000 1.5000 0.0000 Constraint 557 720 0.8000 1.0000 1.5000 0.0000 Constraint 557 706 0.8000 1.0000 1.5000 0.0000 Constraint 557 676 0.8000 1.0000 1.5000 0.0000 Constraint 557 636 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 735 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 720 0.8000 1.0000 1.5000 0.0000 Constraint 552 713 0.8000 1.0000 1.5000 0.0000 Constraint 552 706 0.8000 1.0000 1.5000 0.0000 Constraint 552 676 0.8000 1.0000 1.5000 0.0000 Constraint 552 668 0.8000 1.0000 1.5000 0.0000 Constraint 552 644 0.8000 1.0000 1.5000 0.0000 Constraint 552 636 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 742 0.8000 1.0000 1.5000 0.0000 Constraint 544 735 0.8000 1.0000 1.5000 0.0000 Constraint 544 729 0.8000 1.0000 1.5000 0.0000 Constraint 544 720 0.8000 1.0000 1.5000 0.0000 Constraint 544 713 0.8000 1.0000 1.5000 0.0000 Constraint 544 706 0.8000 1.0000 1.5000 0.0000 Constraint 544 698 0.8000 1.0000 1.5000 0.0000 Constraint 544 687 0.8000 1.0000 1.5000 0.0000 Constraint 544 676 0.8000 1.0000 1.5000 0.0000 Constraint 544 668 0.8000 1.0000 1.5000 0.0000 Constraint 544 651 0.8000 1.0000 1.5000 0.0000 Constraint 544 644 0.8000 1.0000 1.5000 0.0000 Constraint 544 636 0.8000 1.0000 1.5000 0.0000 Constraint 544 613 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 742 0.8000 1.0000 1.5000 0.0000 Constraint 535 729 0.8000 1.0000 1.5000 0.0000 Constraint 535 720 0.8000 1.0000 1.5000 0.0000 Constraint 535 706 0.8000 1.0000 1.5000 0.0000 Constraint 535 636 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 742 0.8000 1.0000 1.5000 0.0000 Constraint 527 729 0.8000 1.0000 1.5000 0.0000 Constraint 527 720 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 742 0.8000 1.0000 1.5000 0.0000 Constraint 519 729 0.8000 1.0000 1.5000 0.0000 Constraint 519 720 0.8000 1.0000 1.5000 0.0000 Constraint 519 706 0.8000 1.0000 1.5000 0.0000 Constraint 519 676 0.8000 1.0000 1.5000 0.0000 Constraint 519 651 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 742 0.8000 1.0000 1.5000 0.0000 Constraint 511 729 0.8000 1.0000 1.5000 0.0000 Constraint 511 720 0.8000 1.0000 1.5000 0.0000 Constraint 511 706 0.8000 1.0000 1.5000 0.0000 Constraint 511 676 0.8000 1.0000 1.5000 0.0000 Constraint 511 585 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 742 0.8000 1.0000 1.5000 0.0000 Constraint 489 720 0.8000 1.0000 1.5000 0.0000 Constraint 489 651 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 742 0.8000 1.0000 1.5000 0.0000 Constraint 480 729 0.8000 1.0000 1.5000 0.0000 Constraint 480 720 0.8000 1.0000 1.5000 0.0000 Constraint 480 706 0.8000 1.0000 1.5000 0.0000 Constraint 480 687 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 706 0.8000 1.0000 1.5000 0.0000 Constraint 467 698 0.8000 1.0000 1.5000 0.0000 Constraint 467 687 0.8000 1.0000 1.5000 0.0000 Constraint 467 676 0.8000 1.0000 1.5000 0.0000 Constraint 467 651 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 698 0.8000 1.0000 1.5000 0.0000 Constraint 461 687 0.8000 1.0000 1.5000 0.0000 Constraint 461 676 0.8000 1.0000 1.5000 0.0000 Constraint 461 668 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 687 0.8000 1.0000 1.5000 0.0000 Constraint 449 676 0.8000 1.0000 1.5000 0.0000 Constraint 449 668 0.8000 1.0000 1.5000 0.0000 Constraint 449 657 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 687 0.8000 1.0000 1.5000 0.0000 Constraint 442 676 0.8000 1.0000 1.5000 0.0000 Constraint 442 668 0.8000 1.0000 1.5000 0.0000 Constraint 442 657 0.8000 1.0000 1.5000 0.0000 Constraint 442 651 0.8000 1.0000 1.5000 0.0000 Constraint 442 644 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 698 0.8000 1.0000 1.5000 0.0000 Constraint 435 687 0.8000 1.0000 1.5000 0.0000 Constraint 435 676 0.8000 1.0000 1.5000 0.0000 Constraint 435 668 0.8000 1.0000 1.5000 0.0000 Constraint 435 651 0.8000 1.0000 1.5000 0.0000 Constraint 435 644 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 706 0.8000 1.0000 1.5000 0.0000 Constraint 429 698 0.8000 1.0000 1.5000 0.0000 Constraint 429 687 0.8000 1.0000 1.5000 0.0000 Constraint 429 676 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 742 0.8000 1.0000 1.5000 0.0000 Constraint 421 735 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 706 0.8000 1.0000 1.5000 0.0000 Constraint 421 698 0.8000 1.0000 1.5000 0.0000 Constraint 421 687 0.8000 1.0000 1.5000 0.0000 Constraint 421 676 0.8000 1.0000 1.5000 0.0000 Constraint 421 668 0.8000 1.0000 1.5000 0.0000 Constraint 421 644 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 698 0.8000 1.0000 1.5000 0.0000 Constraint 412 687 0.8000 1.0000 1.5000 0.0000 Constraint 412 676 0.8000 1.0000 1.5000 0.0000 Constraint 412 668 0.8000 1.0000 1.5000 0.0000 Constraint 412 651 0.8000 1.0000 1.5000 0.0000 Constraint 412 644 0.8000 1.0000 1.5000 0.0000 Constraint 412 480 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 706 0.8000 1.0000 1.5000 0.0000 Constraint 404 544 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 742 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 706 0.8000 1.0000 1.5000 0.0000 Constraint 399 698 0.8000 1.0000 1.5000 0.0000 Constraint 399 544 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 742 0.8000 1.0000 1.5000 0.0000 Constraint 391 735 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 698 0.8000 1.0000 1.5000 0.0000 Constraint 391 687 0.8000 1.0000 1.5000 0.0000 Constraint 391 676 0.8000 1.0000 1.5000 0.0000 Constraint 391 644 0.8000 1.0000 1.5000 0.0000 Constraint 391 613 0.8000 1.0000 1.5000 0.0000 Constraint 391 544 0.8000 1.0000 1.5000 0.0000 Constraint 391 467 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 742 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 706 0.8000 1.0000 1.5000 0.0000 Constraint 382 676 0.8000 1.0000 1.5000 0.0000 Constraint 382 668 0.8000 1.0000 1.5000 0.0000 Constraint 382 644 0.8000 1.0000 1.5000 0.0000 Constraint 382 613 0.8000 1.0000 1.5000 0.0000 Constraint 382 544 0.8000 1.0000 1.5000 0.0000 Constraint 382 461 0.8000 1.0000 1.5000 0.0000 Constraint 382 449 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 742 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 544 0.8000 1.0000 1.5000 0.0000 Constraint 375 449 0.8000 1.0000 1.5000 0.0000 Constraint 375 442 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 742 0.8000 1.0000 1.5000 0.0000 Constraint 368 735 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 706 0.8000 1.0000 1.5000 0.0000 Constraint 368 698 0.8000 1.0000 1.5000 0.0000 Constraint 368 676 0.8000 1.0000 1.5000 0.0000 Constraint 368 544 0.8000 1.0000 1.5000 0.0000 Constraint 368 467 0.8000 1.0000 1.5000 0.0000 Constraint 368 461 0.8000 1.0000 1.5000 0.0000 Constraint 368 449 0.8000 1.0000 1.5000 0.0000 Constraint 368 442 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 742 0.8000 1.0000 1.5000 0.0000 Constraint 360 735 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 706 0.8000 1.0000 1.5000 0.0000 Constraint 360 698 0.8000 1.0000 1.5000 0.0000 Constraint 360 687 0.8000 1.0000 1.5000 0.0000 Constraint 360 676 0.8000 1.0000 1.5000 0.0000 Constraint 360 544 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 720 0.8000 1.0000 1.5000 0.0000 Constraint 355 713 0.8000 1.0000 1.5000 0.0000 Constraint 355 706 0.8000 1.0000 1.5000 0.0000 Constraint 355 676 0.8000 1.0000 1.5000 0.0000 Constraint 355 636 0.8000 1.0000 1.5000 0.0000 Constraint 355 613 0.8000 1.0000 1.5000 0.0000 Constraint 355 585 0.8000 1.0000 1.5000 0.0000 Constraint 355 544 0.8000 1.0000 1.5000 0.0000 Constraint 355 467 0.8000 1.0000 1.5000 0.0000 Constraint 355 461 0.8000 1.0000 1.5000 0.0000 Constraint 355 435 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 735 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 720 0.8000 1.0000 1.5000 0.0000 Constraint 350 713 0.8000 1.0000 1.5000 0.0000 Constraint 350 706 0.8000 1.0000 1.5000 0.0000 Constraint 350 698 0.8000 1.0000 1.5000 0.0000 Constraint 350 687 0.8000 1.0000 1.5000 0.0000 Constraint 350 676 0.8000 1.0000 1.5000 0.0000 Constraint 350 644 0.8000 1.0000 1.5000 0.0000 Constraint 350 636 0.8000 1.0000 1.5000 0.0000 Constraint 350 622 0.8000 1.0000 1.5000 0.0000 Constraint 350 613 0.8000 1.0000 1.5000 0.0000 Constraint 350 604 0.8000 1.0000 1.5000 0.0000 Constraint 350 590 0.8000 1.0000 1.5000 0.0000 Constraint 350 585 0.8000 1.0000 1.5000 0.0000 Constraint 350 557 0.8000 1.0000 1.5000 0.0000 Constraint 350 467 0.8000 1.0000 1.5000 0.0000 Constraint 350 461 0.8000 1.0000 1.5000 0.0000 Constraint 350 442 0.8000 1.0000 1.5000 0.0000 Constraint 350 435 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 742 0.8000 1.0000 1.5000 0.0000 Constraint 341 735 0.8000 1.0000 1.5000 0.0000 Constraint 341 729 0.8000 1.0000 1.5000 0.0000 Constraint 341 698 0.8000 1.0000 1.5000 0.0000 Constraint 341 687 0.8000 1.0000 1.5000 0.0000 Constraint 341 651 0.8000 1.0000 1.5000 0.0000 Constraint 341 644 0.8000 1.0000 1.5000 0.0000 Constraint 341 636 0.8000 1.0000 1.5000 0.0000 Constraint 341 629 0.8000 1.0000 1.5000 0.0000 Constraint 341 622 0.8000 1.0000 1.5000 0.0000 Constraint 341 544 0.8000 1.0000 1.5000 0.0000 Constraint 341 467 0.8000 1.0000 1.5000 0.0000 Constraint 341 461 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 735 0.8000 1.0000 1.5000 0.0000 Constraint 330 729 0.8000 1.0000 1.5000 0.0000 Constraint 330 622 0.8000 1.0000 1.5000 0.0000 Constraint 330 511 0.8000 1.0000 1.5000 0.0000 Constraint 330 473 0.8000 1.0000 1.5000 0.0000 Constraint 330 467 0.8000 1.0000 1.5000 0.0000 Constraint 330 461 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 720 0.8000 1.0000 1.5000 0.0000 Constraint 322 687 0.8000 1.0000 1.5000 0.0000 Constraint 322 544 0.8000 1.0000 1.5000 0.0000 Constraint 322 511 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 729 0.8000 1.0000 1.5000 0.0000 Constraint 314 720 0.8000 1.0000 1.5000 0.0000 Constraint 314 687 0.8000 1.0000 1.5000 0.0000 Constraint 314 676 0.8000 1.0000 1.5000 0.0000 Constraint 314 668 0.8000 1.0000 1.5000 0.0000 Constraint 314 651 0.8000 1.0000 1.5000 0.0000 Constraint 314 636 0.8000 1.0000 1.5000 0.0000 Constraint 314 622 0.8000 1.0000 1.5000 0.0000 Constraint 314 544 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 720 0.8000 1.0000 1.5000 0.0000 Constraint 303 687 0.8000 1.0000 1.5000 0.0000 Constraint 303 676 0.8000 1.0000 1.5000 0.0000 Constraint 303 668 0.8000 1.0000 1.5000 0.0000 Constraint 303 651 0.8000 1.0000 1.5000 0.0000 Constraint 303 644 0.8000 1.0000 1.5000 0.0000 Constraint 303 622 0.8000 1.0000 1.5000 0.0000 Constraint 303 613 0.8000 1.0000 1.5000 0.0000 Constraint 303 590 0.8000 1.0000 1.5000 0.0000 Constraint 303 544 0.8000 1.0000 1.5000 0.0000 Constraint 303 535 0.8000 1.0000 1.5000 0.0000 Constraint 303 519 0.8000 1.0000 1.5000 0.0000 Constraint 303 511 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 729 0.8000 1.0000 1.5000 0.0000 Constraint 297 687 0.8000 1.0000 1.5000 0.0000 Constraint 297 590 0.8000 1.0000 1.5000 0.0000 Constraint 297 571 0.8000 1.0000 1.5000 0.0000 Constraint 297 557 0.8000 1.0000 1.5000 0.0000 Constraint 297 544 0.8000 1.0000 1.5000 0.0000 Constraint 297 535 0.8000 1.0000 1.5000 0.0000 Constraint 297 519 0.8000 1.0000 1.5000 0.0000 Constraint 297 511 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 720 0.8000 1.0000 1.5000 0.0000 Constraint 292 713 0.8000 1.0000 1.5000 0.0000 Constraint 292 706 0.8000 1.0000 1.5000 0.0000 Constraint 292 698 0.8000 1.0000 1.5000 0.0000 Constraint 292 687 0.8000 1.0000 1.5000 0.0000 Constraint 292 544 0.8000 1.0000 1.5000 0.0000 Constraint 292 511 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 720 0.8000 1.0000 1.5000 0.0000 Constraint 285 713 0.8000 1.0000 1.5000 0.0000 Constraint 285 706 0.8000 1.0000 1.5000 0.0000 Constraint 285 687 0.8000 1.0000 1.5000 0.0000 Constraint 285 676 0.8000 1.0000 1.5000 0.0000 Constraint 285 668 0.8000 1.0000 1.5000 0.0000 Constraint 285 657 0.8000 1.0000 1.5000 0.0000 Constraint 285 651 0.8000 1.0000 1.5000 0.0000 Constraint 285 636 0.8000 1.0000 1.5000 0.0000 Constraint 285 629 0.8000 1.0000 1.5000 0.0000 Constraint 285 622 0.8000 1.0000 1.5000 0.0000 Constraint 285 613 0.8000 1.0000 1.5000 0.0000 Constraint 285 544 0.8000 1.0000 1.5000 0.0000 Constraint 285 511 0.8000 1.0000 1.5000 0.0000 Constraint 285 473 0.8000 1.0000 1.5000 0.0000 Constraint 285 467 0.8000 1.0000 1.5000 0.0000 Constraint 285 461 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 729 0.8000 1.0000 1.5000 0.0000 Constraint 279 720 0.8000 1.0000 1.5000 0.0000 Constraint 279 713 0.8000 1.0000 1.5000 0.0000 Constraint 279 687 0.8000 1.0000 1.5000 0.0000 Constraint 279 676 0.8000 1.0000 1.5000 0.0000 Constraint 279 668 0.8000 1.0000 1.5000 0.0000 Constraint 279 657 0.8000 1.0000 1.5000 0.0000 Constraint 279 644 0.8000 1.0000 1.5000 0.0000 Constraint 279 636 0.8000 1.0000 1.5000 0.0000 Constraint 279 622 0.8000 1.0000 1.5000 0.0000 Constraint 279 613 0.8000 1.0000 1.5000 0.0000 Constraint 279 604 0.8000 1.0000 1.5000 0.0000 Constraint 279 590 0.8000 1.0000 1.5000 0.0000 Constraint 279 585 0.8000 1.0000 1.5000 0.0000 Constraint 279 571 0.8000 1.0000 1.5000 0.0000 Constraint 279 557 0.8000 1.0000 1.5000 0.0000 Constraint 279 544 0.8000 1.0000 1.5000 0.0000 Constraint 279 535 0.8000 1.0000 1.5000 0.0000 Constraint 279 527 0.8000 1.0000 1.5000 0.0000 Constraint 279 519 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 497 0.8000 1.0000 1.5000 0.0000 Constraint 279 480 0.8000 1.0000 1.5000 0.0000 Constraint 279 473 0.8000 1.0000 1.5000 0.0000 Constraint 279 461 0.8000 1.0000 1.5000 0.0000 Constraint 279 449 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 729 0.8000 1.0000 1.5000 0.0000 Constraint 272 720 0.8000 1.0000 1.5000 0.0000 Constraint 272 713 0.8000 1.0000 1.5000 0.0000 Constraint 272 687 0.8000 1.0000 1.5000 0.0000 Constraint 272 651 0.8000 1.0000 1.5000 0.0000 Constraint 272 622 0.8000 1.0000 1.5000 0.0000 Constraint 272 613 0.8000 1.0000 1.5000 0.0000 Constraint 272 590 0.8000 1.0000 1.5000 0.0000 Constraint 272 585 0.8000 1.0000 1.5000 0.0000 Constraint 272 557 0.8000 1.0000 1.5000 0.0000 Constraint 272 552 0.8000 1.0000 1.5000 0.0000 Constraint 272 544 0.8000 1.0000 1.5000 0.0000 Constraint 272 535 0.8000 1.0000 1.5000 0.0000 Constraint 272 527 0.8000 1.0000 1.5000 0.0000 Constraint 272 519 0.8000 1.0000 1.5000 0.0000 Constraint 272 511 0.8000 1.0000 1.5000 0.0000 Constraint 272 497 0.8000 1.0000 1.5000 0.0000 Constraint 272 461 0.8000 1.0000 1.5000 0.0000 Constraint 272 435 0.8000 1.0000 1.5000 0.0000 Constraint 272 399 0.8000 1.0000 1.5000 0.0000 Constraint 272 382 0.8000 1.0000 1.5000 0.0000 Constraint 272 375 0.8000 1.0000 1.5000 0.0000 Constraint 272 368 0.8000 1.0000 1.5000 0.0000 Constraint 272 355 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 720 0.8000 1.0000 1.5000 0.0000 Constraint 267 713 0.8000 1.0000 1.5000 0.0000 Constraint 267 706 0.8000 1.0000 1.5000 0.0000 Constraint 267 698 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 676 0.8000 1.0000 1.5000 0.0000 Constraint 267 668 0.8000 1.0000 1.5000 0.0000 Constraint 267 657 0.8000 1.0000 1.5000 0.0000 Constraint 267 651 0.8000 1.0000 1.5000 0.0000 Constraint 267 644 0.8000 1.0000 1.5000 0.0000 Constraint 267 636 0.8000 1.0000 1.5000 0.0000 Constraint 267 629 0.8000 1.0000 1.5000 0.0000 Constraint 267 622 0.8000 1.0000 1.5000 0.0000 Constraint 267 613 0.8000 1.0000 1.5000 0.0000 Constraint 267 604 0.8000 1.0000 1.5000 0.0000 Constraint 267 590 0.8000 1.0000 1.5000 0.0000 Constraint 267 585 0.8000 1.0000 1.5000 0.0000 Constraint 267 557 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 535 0.8000 1.0000 1.5000 0.0000 Constraint 267 527 0.8000 1.0000 1.5000 0.0000 Constraint 267 519 0.8000 1.0000 1.5000 0.0000 Constraint 267 511 0.8000 1.0000 1.5000 0.0000 Constraint 267 497 0.8000 1.0000 1.5000 0.0000 Constraint 267 480 0.8000 1.0000 1.5000 0.0000 Constraint 267 473 0.8000 1.0000 1.5000 0.0000 Constraint 267 467 0.8000 1.0000 1.5000 0.0000 Constraint 267 461 0.8000 1.0000 1.5000 0.0000 Constraint 267 449 0.8000 1.0000 1.5000 0.0000 Constraint 267 435 0.8000 1.0000 1.5000 0.0000 Constraint 267 429 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 713 0.8000 1.0000 1.5000 0.0000 Constraint 259 706 0.8000 1.0000 1.5000 0.0000 Constraint 259 687 0.8000 1.0000 1.5000 0.0000 Constraint 259 676 0.8000 1.0000 1.5000 0.0000 Constraint 259 657 0.8000 1.0000 1.5000 0.0000 Constraint 259 651 0.8000 1.0000 1.5000 0.0000 Constraint 259 636 0.8000 1.0000 1.5000 0.0000 Constraint 259 544 0.8000 1.0000 1.5000 0.0000 Constraint 259 467 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 687 0.8000 1.0000 1.5000 0.0000 Constraint 250 676 0.8000 1.0000 1.5000 0.0000 Constraint 250 668 0.8000 1.0000 1.5000 0.0000 Constraint 250 657 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 644 0.8000 1.0000 1.5000 0.0000 Constraint 250 636 0.8000 1.0000 1.5000 0.0000 Constraint 250 613 0.8000 1.0000 1.5000 0.0000 Constraint 250 544 0.8000 1.0000 1.5000 0.0000 Constraint 250 535 0.8000 1.0000 1.5000 0.0000 Constraint 250 473 0.8000 1.0000 1.5000 0.0000 Constraint 250 467 0.8000 1.0000 1.5000 0.0000 Constraint 250 461 0.8000 1.0000 1.5000 0.0000 Constraint 250 355 0.8000 1.0000 1.5000 0.0000 Constraint 250 350 0.8000 1.0000 1.5000 0.0000 Constraint 250 341 0.8000 1.0000 1.5000 0.0000 Constraint 250 330 0.8000 1.0000 1.5000 0.0000 Constraint 250 322 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 742 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 713 0.8000 1.0000 1.5000 0.0000 Constraint 242 706 0.8000 1.0000 1.5000 0.0000 Constraint 242 687 0.8000 1.0000 1.5000 0.0000 Constraint 242 676 0.8000 1.0000 1.5000 0.0000 Constraint 242 651 0.8000 1.0000 1.5000 0.0000 Constraint 242 467 0.8000 1.0000 1.5000 0.0000 Constraint 242 330 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 742 0.8000 1.0000 1.5000 0.0000 Constraint 237 735 0.8000 1.0000 1.5000 0.0000 Constraint 237 729 0.8000 1.0000 1.5000 0.0000 Constraint 237 720 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 497 0.8000 1.0000 1.5000 0.0000 Constraint 237 480 0.8000 1.0000 1.5000 0.0000 Constraint 237 473 0.8000 1.0000 1.5000 0.0000 Constraint 237 375 0.8000 1.0000 1.5000 0.0000 Constraint 237 355 0.8000 1.0000 1.5000 0.0000 Constraint 237 350 0.8000 1.0000 1.5000 0.0000 Constraint 237 341 0.8000 1.0000 1.5000 0.0000 Constraint 237 330 0.8000 1.0000 1.5000 0.0000 Constraint 237 303 0.8000 1.0000 1.5000 0.0000 Constraint 237 297 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 742 0.8000 1.0000 1.5000 0.0000 Constraint 226 735 0.8000 1.0000 1.5000 0.0000 Constraint 226 729 0.8000 1.0000 1.5000 0.0000 Constraint 226 720 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 706 0.8000 1.0000 1.5000 0.0000 Constraint 226 651 0.8000 1.0000 1.5000 0.0000 Constraint 226 636 0.8000 1.0000 1.5000 0.0000 Constraint 226 585 0.8000 1.0000 1.5000 0.0000 Constraint 226 557 0.8000 1.0000 1.5000 0.0000 Constraint 226 544 0.8000 1.0000 1.5000 0.0000 Constraint 226 535 0.8000 1.0000 1.5000 0.0000 Constraint 226 511 0.8000 1.0000 1.5000 0.0000 Constraint 226 497 0.8000 1.0000 1.5000 0.0000 Constraint 226 480 0.8000 1.0000 1.5000 0.0000 Constraint 226 473 0.8000 1.0000 1.5000 0.0000 Constraint 226 467 0.8000 1.0000 1.5000 0.0000 Constraint 226 461 0.8000 1.0000 1.5000 0.0000 Constraint 226 429 0.8000 1.0000 1.5000 0.0000 Constraint 226 404 0.8000 1.0000 1.5000 0.0000 Constraint 226 399 0.8000 1.0000 1.5000 0.0000 Constraint 226 375 0.8000 1.0000 1.5000 0.0000 Constraint 226 368 0.8000 1.0000 1.5000 0.0000 Constraint 226 360 0.8000 1.0000 1.5000 0.0000 Constraint 226 355 0.8000 1.0000 1.5000 0.0000 Constraint 226 350 0.8000 1.0000 1.5000 0.0000 Constraint 226 341 0.8000 1.0000 1.5000 0.0000 Constraint 226 330 0.8000 1.0000 1.5000 0.0000 Constraint 226 303 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 742 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 729 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 713 0.8000 1.0000 1.5000 0.0000 Constraint 221 706 0.8000 1.0000 1.5000 0.0000 Constraint 221 687 0.8000 1.0000 1.5000 0.0000 Constraint 221 676 0.8000 1.0000 1.5000 0.0000 Constraint 221 651 0.8000 1.0000 1.5000 0.0000 Constraint 221 636 0.8000 1.0000 1.5000 0.0000 Constraint 221 557 0.8000 1.0000 1.5000 0.0000 Constraint 221 544 0.8000 1.0000 1.5000 0.0000 Constraint 221 535 0.8000 1.0000 1.5000 0.0000 Constraint 221 511 0.8000 1.0000 1.5000 0.0000 Constraint 221 467 0.8000 1.0000 1.5000 0.0000 Constraint 221 461 0.8000 1.0000 1.5000 0.0000 Constraint 221 375 0.8000 1.0000 1.5000 0.0000 Constraint 221 355 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 742 0.8000 1.0000 1.5000 0.0000 Constraint 210 735 0.8000 1.0000 1.5000 0.0000 Constraint 210 729 0.8000 1.0000 1.5000 0.0000 Constraint 210 720 0.8000 1.0000 1.5000 0.0000 Constraint 210 713 0.8000 1.0000 1.5000 0.0000 Constraint 210 706 0.8000 1.0000 1.5000 0.0000 Constraint 210 375 0.8000 1.0000 1.5000 0.0000 Constraint 210 355 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 735 0.8000 1.0000 1.5000 0.0000 Constraint 201 720 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 706 0.8000 1.0000 1.5000 0.0000 Constraint 201 557 0.8000 1.0000 1.5000 0.0000 Constraint 201 544 0.8000 1.0000 1.5000 0.0000 Constraint 201 535 0.8000 1.0000 1.5000 0.0000 Constraint 201 497 0.8000 1.0000 1.5000 0.0000 Constraint 201 489 0.8000 1.0000 1.5000 0.0000 Constraint 201 480 0.8000 1.0000 1.5000 0.0000 Constraint 201 404 0.8000 1.0000 1.5000 0.0000 Constraint 201 399 0.8000 1.0000 1.5000 0.0000 Constraint 201 382 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 368 0.8000 1.0000 1.5000 0.0000 Constraint 201 355 0.8000 1.0000 1.5000 0.0000 Constraint 201 350 0.8000 1.0000 1.5000 0.0000 Constraint 201 341 0.8000 1.0000 1.5000 0.0000 Constraint 201 330 0.8000 1.0000 1.5000 0.0000 Constraint 201 303 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 742 0.8000 1.0000 1.5000 0.0000 Constraint 190 735 0.8000 1.0000 1.5000 0.0000 Constraint 190 729 0.8000 1.0000 1.5000 0.0000 Constraint 190 720 0.8000 1.0000 1.5000 0.0000 Constraint 190 713 0.8000 1.0000 1.5000 0.0000 Constraint 190 687 0.8000 1.0000 1.5000 0.0000 Constraint 190 651 0.8000 1.0000 1.5000 0.0000 Constraint 190 613 0.8000 1.0000 1.5000 0.0000 Constraint 190 590 0.8000 1.0000 1.5000 0.0000 Constraint 190 585 0.8000 1.0000 1.5000 0.0000 Constraint 190 571 0.8000 1.0000 1.5000 0.0000 Constraint 190 557 0.8000 1.0000 1.5000 0.0000 Constraint 190 552 0.8000 1.0000 1.5000 0.0000 Constraint 190 544 0.8000 1.0000 1.5000 0.0000 Constraint 190 535 0.8000 1.0000 1.5000 0.0000 Constraint 190 527 0.8000 1.0000 1.5000 0.0000 Constraint 190 519 0.8000 1.0000 1.5000 0.0000 Constraint 190 511 0.8000 1.0000 1.5000 0.0000 Constraint 190 497 0.8000 1.0000 1.5000 0.0000 Constraint 190 480 0.8000 1.0000 1.5000 0.0000 Constraint 190 467 0.8000 1.0000 1.5000 0.0000 Constraint 190 461 0.8000 1.0000 1.5000 0.0000 Constraint 190 435 0.8000 1.0000 1.5000 0.0000 Constraint 190 429 0.8000 1.0000 1.5000 0.0000 Constraint 190 404 0.8000 1.0000 1.5000 0.0000 Constraint 190 399 0.8000 1.0000 1.5000 0.0000 Constraint 190 382 0.8000 1.0000 1.5000 0.0000 Constraint 190 375 0.8000 1.0000 1.5000 0.0000 Constraint 190 368 0.8000 1.0000 1.5000 0.0000 Constraint 190 360 0.8000 1.0000 1.5000 0.0000 Constraint 190 355 0.8000 1.0000 1.5000 0.0000 Constraint 190 350 0.8000 1.0000 1.5000 0.0000 Constraint 190 341 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 742 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 720 0.8000 1.0000 1.5000 0.0000 Constraint 182 687 0.8000 1.0000 1.5000 0.0000 Constraint 182 571 0.8000 1.0000 1.5000 0.0000 Constraint 182 557 0.8000 1.0000 1.5000 0.0000 Constraint 182 544 0.8000 1.0000 1.5000 0.0000 Constraint 182 535 0.8000 1.0000 1.5000 0.0000 Constraint 182 519 0.8000 1.0000 1.5000 0.0000 Constraint 182 511 0.8000 1.0000 1.5000 0.0000 Constraint 182 461 0.8000 1.0000 1.5000 0.0000 Constraint 182 375 0.8000 1.0000 1.5000 0.0000 Constraint 182 368 0.8000 1.0000 1.5000 0.0000 Constraint 182 355 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 742 0.8000 1.0000 1.5000 0.0000 Constraint 176 735 0.8000 1.0000 1.5000 0.0000 Constraint 176 720 0.8000 1.0000 1.5000 0.0000 Constraint 176 713 0.8000 1.0000 1.5000 0.0000 Constraint 176 687 0.8000 1.0000 1.5000 0.0000 Constraint 176 613 0.8000 1.0000 1.5000 0.0000 Constraint 176 571 0.8000 1.0000 1.5000 0.0000 Constraint 176 557 0.8000 1.0000 1.5000 0.0000 Constraint 176 552 0.8000 1.0000 1.5000 0.0000 Constraint 176 544 0.8000 1.0000 1.5000 0.0000 Constraint 176 535 0.8000 1.0000 1.5000 0.0000 Constraint 176 527 0.8000 1.0000 1.5000 0.0000 Constraint 176 519 0.8000 1.0000 1.5000 0.0000 Constraint 176 511 0.8000 1.0000 1.5000 0.0000 Constraint 176 497 0.8000 1.0000 1.5000 0.0000 Constraint 176 489 0.8000 1.0000 1.5000 0.0000 Constraint 176 467 0.8000 1.0000 1.5000 0.0000 Constraint 176 461 0.8000 1.0000 1.5000 0.0000 Constraint 176 435 0.8000 1.0000 1.5000 0.0000 Constraint 176 429 0.8000 1.0000 1.5000 0.0000 Constraint 176 404 0.8000 1.0000 1.5000 0.0000 Constraint 176 399 0.8000 1.0000 1.5000 0.0000 Constraint 176 391 0.8000 1.0000 1.5000 0.0000 Constraint 176 382 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 368 0.8000 1.0000 1.5000 0.0000 Constraint 176 360 0.8000 1.0000 1.5000 0.0000 Constraint 176 355 0.8000 1.0000 1.5000 0.0000 Constraint 176 350 0.8000 1.0000 1.5000 0.0000 Constraint 176 341 0.8000 1.0000 1.5000 0.0000 Constraint 176 303 0.8000 1.0000 1.5000 0.0000 Constraint 176 250 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 742 0.8000 1.0000 1.5000 0.0000 Constraint 169 735 0.8000 1.0000 1.5000 0.0000 Constraint 169 729 0.8000 1.0000 1.5000 0.0000 Constraint 169 720 0.8000 1.0000 1.5000 0.0000 Constraint 169 713 0.8000 1.0000 1.5000 0.0000 Constraint 169 706 0.8000 1.0000 1.5000 0.0000 Constraint 169 571 0.8000 1.0000 1.5000 0.0000 Constraint 169 489 0.8000 1.0000 1.5000 0.0000 Constraint 169 404 0.8000 1.0000 1.5000 0.0000 Constraint 169 382 0.8000 1.0000 1.5000 0.0000 Constraint 169 375 0.8000 1.0000 1.5000 0.0000 Constraint 169 368 0.8000 1.0000 1.5000 0.0000 Constraint 169 360 0.8000 1.0000 1.5000 0.0000 Constraint 169 355 0.8000 1.0000 1.5000 0.0000 Constraint 169 341 0.8000 1.0000 1.5000 0.0000 Constraint 169 303 0.8000 1.0000 1.5000 0.0000 Constraint 169 279 0.8000 1.0000 1.5000 0.0000 Constraint 169 267 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 713 0.8000 1.0000 1.5000 0.0000 Constraint 161 706 0.8000 1.0000 1.5000 0.0000 Constraint 161 698 0.8000 1.0000 1.5000 0.0000 Constraint 161 687 0.8000 1.0000 1.5000 0.0000 Constraint 161 657 0.8000 1.0000 1.5000 0.0000 Constraint 161 651 0.8000 1.0000 1.5000 0.0000 Constraint 161 571 0.8000 1.0000 1.5000 0.0000 Constraint 161 557 0.8000 1.0000 1.5000 0.0000 Constraint 161 552 0.8000 1.0000 1.5000 0.0000 Constraint 161 527 0.8000 1.0000 1.5000 0.0000 Constraint 161 519 0.8000 1.0000 1.5000 0.0000 Constraint 161 429 0.8000 1.0000 1.5000 0.0000 Constraint 161 412 0.8000 1.0000 1.5000 0.0000 Constraint 161 404 0.8000 1.0000 1.5000 0.0000 Constraint 161 399 0.8000 1.0000 1.5000 0.0000 Constraint 161 391 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 360 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 350 0.8000 1.0000 1.5000 0.0000 Constraint 161 341 0.8000 1.0000 1.5000 0.0000 Constraint 161 330 0.8000 1.0000 1.5000 0.0000 Constraint 161 314 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 297 0.8000 1.0000 1.5000 0.0000 Constraint 161 292 0.8000 1.0000 1.5000 0.0000 Constraint 161 285 0.8000 1.0000 1.5000 0.0000 Constraint 161 279 0.8000 1.0000 1.5000 0.0000 Constraint 161 272 0.8000 1.0000 1.5000 0.0000 Constraint 161 267 0.8000 1.0000 1.5000 0.0000 Constraint 161 259 0.8000 1.0000 1.5000 0.0000 Constraint 161 250 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 742 0.8000 1.0000 1.5000 0.0000 Constraint 153 735 0.8000 1.0000 1.5000 0.0000 Constraint 153 729 0.8000 1.0000 1.5000 0.0000 Constraint 153 720 0.8000 1.0000 1.5000 0.0000 Constraint 153 713 0.8000 1.0000 1.5000 0.0000 Constraint 153 706 0.8000 1.0000 1.5000 0.0000 Constraint 153 404 0.8000 1.0000 1.5000 0.0000 Constraint 153 382 0.8000 1.0000 1.5000 0.0000 Constraint 153 375 0.8000 1.0000 1.5000 0.0000 Constraint 153 368 0.8000 1.0000 1.5000 0.0000 Constraint 153 360 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 350 0.8000 1.0000 1.5000 0.0000 Constraint 153 330 0.8000 1.0000 1.5000 0.0000 Constraint 153 303 0.8000 1.0000 1.5000 0.0000 Constraint 153 297 0.8000 1.0000 1.5000 0.0000 Constraint 153 285 0.8000 1.0000 1.5000 0.0000 Constraint 153 279 0.8000 1.0000 1.5000 0.0000 Constraint 153 267 0.8000 1.0000 1.5000 0.0000 Constraint 153 250 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 742 0.8000 1.0000 1.5000 0.0000 Constraint 144 735 0.8000 1.0000 1.5000 0.0000 Constraint 144 729 0.8000 1.0000 1.5000 0.0000 Constraint 144 720 0.8000 1.0000 1.5000 0.0000 Constraint 144 713 0.8000 1.0000 1.5000 0.0000 Constraint 144 706 0.8000 1.0000 1.5000 0.0000 Constraint 144 698 0.8000 1.0000 1.5000 0.0000 Constraint 144 687 0.8000 1.0000 1.5000 0.0000 Constraint 144 622 0.8000 1.0000 1.5000 0.0000 Constraint 144 412 0.8000 1.0000 1.5000 0.0000 Constraint 144 404 0.8000 1.0000 1.5000 0.0000 Constraint 144 399 0.8000 1.0000 1.5000 0.0000 Constraint 144 391 0.8000 1.0000 1.5000 0.0000 Constraint 144 382 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 368 0.8000 1.0000 1.5000 0.0000 Constraint 144 360 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 350 0.8000 1.0000 1.5000 0.0000 Constraint 144 330 0.8000 1.0000 1.5000 0.0000 Constraint 144 314 0.8000 1.0000 1.5000 0.0000 Constraint 144 303 0.8000 1.0000 1.5000 0.0000 Constraint 144 297 0.8000 1.0000 1.5000 0.0000 Constraint 144 285 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 272 0.8000 1.0000 1.5000 0.0000 Constraint 144 267 0.8000 1.0000 1.5000 0.0000 Constraint 144 259 0.8000 1.0000 1.5000 0.0000 Constraint 144 250 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 742 0.8000 1.0000 1.5000 0.0000 Constraint 136 735 0.8000 1.0000 1.5000 0.0000 Constraint 136 729 0.8000 1.0000 1.5000 0.0000 Constraint 136 720 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 698 0.8000 1.0000 1.5000 0.0000 Constraint 136 687 0.8000 1.0000 1.5000 0.0000 Constraint 136 571 0.8000 1.0000 1.5000 0.0000 Constraint 136 552 0.8000 1.0000 1.5000 0.0000 Constraint 136 489 0.8000 1.0000 1.5000 0.0000 Constraint 136 435 0.8000 1.0000 1.5000 0.0000 Constraint 136 412 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 360 0.8000 1.0000 1.5000 0.0000 Constraint 136 355 0.8000 1.0000 1.5000 0.0000 Constraint 136 350 0.8000 1.0000 1.5000 0.0000 Constraint 136 303 0.8000 1.0000 1.5000 0.0000 Constraint 136 285 0.8000 1.0000 1.5000 0.0000 Constraint 136 279 0.8000 1.0000 1.5000 0.0000 Constraint 136 267 0.8000 1.0000 1.5000 0.0000 Constraint 136 259 0.8000 1.0000 1.5000 0.0000 Constraint 136 250 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 742 0.8000 1.0000 1.5000 0.0000 Constraint 128 735 0.8000 1.0000 1.5000 0.0000 Constraint 128 729 0.8000 1.0000 1.5000 0.0000 Constraint 128 720 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 687 0.8000 1.0000 1.5000 0.0000 Constraint 128 571 0.8000 1.0000 1.5000 0.0000 Constraint 128 375 0.8000 1.0000 1.5000 0.0000 Constraint 128 368 0.8000 1.0000 1.5000 0.0000 Constraint 128 355 0.8000 1.0000 1.5000 0.0000 Constraint 128 279 0.8000 1.0000 1.5000 0.0000 Constraint 128 267 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 698 0.8000 1.0000 1.5000 0.0000 Constraint 122 687 0.8000 1.0000 1.5000 0.0000 Constraint 122 375 0.8000 1.0000 1.5000 0.0000 Constraint 122 368 0.8000 1.0000 1.5000 0.0000 Constraint 122 355 0.8000 1.0000 1.5000 0.0000 Constraint 122 279 0.8000 1.0000 1.5000 0.0000 Constraint 122 267 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 713 0.8000 1.0000 1.5000 0.0000 Constraint 113 706 0.8000 1.0000 1.5000 0.0000 Constraint 113 698 0.8000 1.0000 1.5000 0.0000 Constraint 113 676 0.8000 1.0000 1.5000 0.0000 Constraint 113 590 0.8000 1.0000 1.5000 0.0000 Constraint 113 571 0.8000 1.0000 1.5000 0.0000 Constraint 113 412 0.8000 1.0000 1.5000 0.0000 Constraint 113 375 0.8000 1.0000 1.5000 0.0000 Constraint 113 368 0.8000 1.0000 1.5000 0.0000 Constraint 113 355 0.8000 1.0000 1.5000 0.0000 Constraint 113 303 0.8000 1.0000 1.5000 0.0000 Constraint 113 279 0.8000 1.0000 1.5000 0.0000 Constraint 113 267 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 713 0.8000 1.0000 1.5000 0.0000 Constraint 104 706 0.8000 1.0000 1.5000 0.0000 Constraint 104 698 0.8000 1.0000 1.5000 0.0000 Constraint 104 544 0.8000 1.0000 1.5000 0.0000 Constraint 104 519 0.8000 1.0000 1.5000 0.0000 Constraint 104 511 0.8000 1.0000 1.5000 0.0000 Constraint 104 375 0.8000 1.0000 1.5000 0.0000 Constraint 104 368 0.8000 1.0000 1.5000 0.0000 Constraint 104 279 0.8000 1.0000 1.5000 0.0000 Constraint 104 267 0.8000 1.0000 1.5000 0.0000 Constraint 104 250 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 698 0.8000 1.0000 1.5000 0.0000 Constraint 96 687 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 713 0.8000 1.0000 1.5000 0.0000 Constraint 88 706 0.8000 1.0000 1.5000 0.0000 Constraint 88 687 0.8000 1.0000 1.5000 0.0000 Constraint 88 676 0.8000 1.0000 1.5000 0.0000 Constraint 88 668 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 676 0.8000 1.0000 1.5000 0.0000 Constraint 80 668 0.8000 1.0000 1.5000 0.0000 Constraint 80 644 0.8000 1.0000 1.5000 0.0000 Constraint 80 613 0.8000 1.0000 1.5000 0.0000 Constraint 80 590 0.8000 1.0000 1.5000 0.0000 Constraint 80 585 0.8000 1.0000 1.5000 0.0000 Constraint 80 577 0.8000 1.0000 1.5000 0.0000 Constraint 80 571 0.8000 1.0000 1.5000 0.0000 Constraint 80 480 0.8000 1.0000 1.5000 0.0000 Constraint 80 473 0.8000 1.0000 1.5000 0.0000 Constraint 80 467 0.8000 1.0000 1.5000 0.0000 Constraint 80 435 0.8000 1.0000 1.5000 0.0000 Constraint 80 368 0.8000 1.0000 1.5000 0.0000 Constraint 80 279 0.8000 1.0000 1.5000 0.0000 Constraint 80 272 0.8000 1.0000 1.5000 0.0000 Constraint 80 267 0.8000 1.0000 1.5000 0.0000 Constraint 80 226 0.8000 1.0000 1.5000 0.0000 Constraint 80 190 0.8000 1.0000 1.5000 0.0000 Constraint 80 176 0.8000 1.0000 1.5000 0.0000 Constraint 80 161 0.8000 1.0000 1.5000 0.0000 Constraint 80 153 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 577 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 552 0.8000 1.0000 1.5000 0.0000 Constraint 69 544 0.8000 1.0000 1.5000 0.0000 Constraint 69 535 0.8000 1.0000 1.5000 0.0000 Constraint 69 435 0.8000 1.0000 1.5000 0.0000 Constraint 69 279 0.8000 1.0000 1.5000 0.0000 Constraint 69 272 0.8000 1.0000 1.5000 0.0000 Constraint 69 267 0.8000 1.0000 1.5000 0.0000 Constraint 69 250 0.8000 1.0000 1.5000 0.0000 Constraint 69 237 0.8000 1.0000 1.5000 0.0000 Constraint 69 226 0.8000 1.0000 1.5000 0.0000 Constraint 69 221 0.8000 1.0000 1.5000 0.0000 Constraint 69 201 0.8000 1.0000 1.5000 0.0000 Constraint 69 190 0.8000 1.0000 1.5000 0.0000 Constraint 69 182 0.8000 1.0000 1.5000 0.0000 Constraint 69 176 0.8000 1.0000 1.5000 0.0000 Constraint 69 169 0.8000 1.0000 1.5000 0.0000 Constraint 69 161 0.8000 1.0000 1.5000 0.0000 Constraint 69 153 0.8000 1.0000 1.5000 0.0000 Constraint 69 144 0.8000 1.0000 1.5000 0.0000 Constraint 69 136 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 585 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 557 0.8000 1.0000 1.5000 0.0000 Constraint 58 552 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 535 0.8000 1.0000 1.5000 0.0000 Constraint 58 480 0.8000 1.0000 1.5000 0.0000 Constraint 58 473 0.8000 1.0000 1.5000 0.0000 Constraint 58 467 0.8000 1.0000 1.5000 0.0000 Constraint 58 461 0.8000 1.0000 1.5000 0.0000 Constraint 58 449 0.8000 1.0000 1.5000 0.0000 Constraint 58 442 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 429 0.8000 1.0000 1.5000 0.0000 Constraint 58 412 0.8000 1.0000 1.5000 0.0000 Constraint 58 404 0.8000 1.0000 1.5000 0.0000 Constraint 58 391 0.8000 1.0000 1.5000 0.0000 Constraint 58 382 0.8000 1.0000 1.5000 0.0000 Constraint 58 297 0.8000 1.0000 1.5000 0.0000 Constraint 58 292 0.8000 1.0000 1.5000 0.0000 Constraint 58 285 0.8000 1.0000 1.5000 0.0000 Constraint 58 279 0.8000 1.0000 1.5000 0.0000 Constraint 58 272 0.8000 1.0000 1.5000 0.0000 Constraint 58 267 0.8000 1.0000 1.5000 0.0000 Constraint 58 259 0.8000 1.0000 1.5000 0.0000 Constraint 58 250 0.8000 1.0000 1.5000 0.0000 Constraint 58 242 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 221 0.8000 1.0000 1.5000 0.0000 Constraint 58 210 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 182 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 169 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 153 0.8000 1.0000 1.5000 0.0000 Constraint 58 144 0.8000 1.0000 1.5000 0.0000 Constraint 58 136 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 467 0.8000 1.0000 1.5000 0.0000 Constraint 51 449 0.8000 1.0000 1.5000 0.0000 Constraint 51 442 0.8000 1.0000 1.5000 0.0000 Constraint 51 435 0.8000 1.0000 1.5000 0.0000 Constraint 51 429 0.8000 1.0000 1.5000 0.0000 Constraint 51 421 0.8000 1.0000 1.5000 0.0000 Constraint 51 412 0.8000 1.0000 1.5000 0.0000 Constraint 51 404 0.8000 1.0000 1.5000 0.0000 Constraint 51 399 0.8000 1.0000 1.5000 0.0000 Constraint 51 391 0.8000 1.0000 1.5000 0.0000 Constraint 51 382 0.8000 1.0000 1.5000 0.0000 Constraint 51 368 0.8000 1.0000 1.5000 0.0000 Constraint 51 360 0.8000 1.0000 1.5000 0.0000 Constraint 51 350 0.8000 1.0000 1.5000 0.0000 Constraint 51 341 0.8000 1.0000 1.5000 0.0000 Constraint 51 330 0.8000 1.0000 1.5000 0.0000 Constraint 51 297 0.8000 1.0000 1.5000 0.0000 Constraint 51 292 0.8000 1.0000 1.5000 0.0000 Constraint 51 279 0.8000 1.0000 1.5000 0.0000 Constraint 51 272 0.8000 1.0000 1.5000 0.0000 Constraint 51 267 0.8000 1.0000 1.5000 0.0000 Constraint 51 237 0.8000 1.0000 1.5000 0.0000 Constraint 51 226 0.8000 1.0000 1.5000 0.0000 Constraint 51 221 0.8000 1.0000 1.5000 0.0000 Constraint 51 210 0.8000 1.0000 1.5000 0.0000 Constraint 51 201 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 182 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 169 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 153 0.8000 1.0000 1.5000 0.0000 Constraint 51 144 0.8000 1.0000 1.5000 0.0000 Constraint 51 136 0.8000 1.0000 1.5000 0.0000 Constraint 51 128 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 480 0.8000 1.0000 1.5000 0.0000 Constraint 41 473 0.8000 1.0000 1.5000 0.0000 Constraint 41 467 0.8000 1.0000 1.5000 0.0000 Constraint 41 461 0.8000 1.0000 1.5000 0.0000 Constraint 41 449 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 429 0.8000 1.0000 1.5000 0.0000 Constraint 41 421 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 399 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 375 0.8000 1.0000 1.5000 0.0000 Constraint 41 368 0.8000 1.0000 1.5000 0.0000 Constraint 41 360 0.8000 1.0000 1.5000 0.0000 Constraint 41 355 0.8000 1.0000 1.5000 0.0000 Constraint 41 350 0.8000 1.0000 1.5000 0.0000 Constraint 41 341 0.8000 1.0000 1.5000 0.0000 Constraint 41 330 0.8000 1.0000 1.5000 0.0000 Constraint 41 322 0.8000 1.0000 1.5000 0.0000 Constraint 41 314 0.8000 1.0000 1.5000 0.0000 Constraint 41 303 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 292 0.8000 1.0000 1.5000 0.0000 Constraint 41 285 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 267 0.8000 1.0000 1.5000 0.0000 Constraint 41 259 0.8000 1.0000 1.5000 0.0000 Constraint 41 250 0.8000 1.0000 1.5000 0.0000 Constraint 41 237 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 221 0.8000 1.0000 1.5000 0.0000 Constraint 41 210 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 144 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 122 0.8000 1.0000 1.5000 0.0000 Constraint 41 113 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 511 0.8000 1.0000 1.5000 0.0000 Constraint 33 489 0.8000 1.0000 1.5000 0.0000 Constraint 33 480 0.8000 1.0000 1.5000 0.0000 Constraint 33 473 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 461 0.8000 1.0000 1.5000 0.0000 Constraint 33 449 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 429 0.8000 1.0000 1.5000 0.0000 Constraint 33 421 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 404 0.8000 1.0000 1.5000 0.0000 Constraint 33 399 0.8000 1.0000 1.5000 0.0000 Constraint 33 391 0.8000 1.0000 1.5000 0.0000 Constraint 33 382 0.8000 1.0000 1.5000 0.0000 Constraint 33 368 0.8000 1.0000 1.5000 0.0000 Constraint 33 360 0.8000 1.0000 1.5000 0.0000 Constraint 33 355 0.8000 1.0000 1.5000 0.0000 Constraint 33 350 0.8000 1.0000 1.5000 0.0000 Constraint 33 341 0.8000 1.0000 1.5000 0.0000 Constraint 33 330 0.8000 1.0000 1.5000 0.0000 Constraint 33 322 0.8000 1.0000 1.5000 0.0000 Constraint 33 303 0.8000 1.0000 1.5000 0.0000 Constraint 33 297 0.8000 1.0000 1.5000 0.0000 Constraint 33 292 0.8000 1.0000 1.5000 0.0000 Constraint 33 279 0.8000 1.0000 1.5000 0.0000 Constraint 33 272 0.8000 1.0000 1.5000 0.0000 Constraint 33 267 0.8000 1.0000 1.5000 0.0000 Constraint 33 237 0.8000 1.0000 1.5000 0.0000 Constraint 33 226 0.8000 1.0000 1.5000 0.0000 Constraint 33 221 0.8000 1.0000 1.5000 0.0000 Constraint 33 210 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 144 0.8000 1.0000 1.5000 0.0000 Constraint 33 136 0.8000 1.0000 1.5000 0.0000 Constraint 33 128 0.8000 1.0000 1.5000 0.0000 Constraint 33 122 0.8000 1.0000 1.5000 0.0000 Constraint 33 104 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: