# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 13.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 182 303 8.3982 10.4978 15.7467 88.4470 Constraint 176 297 8.8480 11.0600 16.5900 88.4470 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 182 314 7.8821 9.8527 14.7790 85.5352 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 190 285 9.2681 11.5851 17.3777 85.0453 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 210 279 9.7430 12.1788 18.2681 83.6962 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 259 322 9.2325 11.5406 17.3109 80.9641 Constraint 182 330 8.4897 10.6121 15.9181 80.1608 Constraint 176 322 9.2864 11.6080 17.4120 79.9700 Constraint 292 421 6.4154 8.0192 12.0288 78.3386 Constraint 210 421 5.9486 7.4357 11.1536 78.3386 Constraint 169 322 9.1369 11.4212 17.1317 77.6881 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 314 421 6.0467 7.5584 11.3375 76.7248 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 285 421 8.0716 10.0895 15.1342 76.3384 Constraint 128 292 7.2908 9.1135 13.6702 75.6352 Constraint 242 421 4.8690 6.0863 9.1294 75.6058 Constraint 259 421 6.7067 8.3834 12.5752 74.5512 Constraint 242 404 7.9861 9.9826 14.9740 74.4972 Constraint 322 421 7.8878 9.8598 14.7897 73.6335 Constraint 314 412 8.7958 10.9947 16.4921 73.6335 Constraint 128 201 7.0482 8.8103 13.2154 73.5726 Constraint 242 412 4.1686 5.2107 7.8160 73.5126 Constraint 292 412 8.5797 10.7247 16.0870 73.2454 Constraint 292 442 8.2565 10.3207 15.4810 72.5666 Constraint 259 412 6.4619 8.0773 12.1160 72.4580 Constraint 104 182 7.7500 9.6875 14.5313 72.3505 Constraint 242 399 8.0856 10.1071 15.1606 72.3310 Constraint 237 421 7.2159 9.0199 13.5299 71.7999 Constraint 237 412 6.7497 8.4371 12.6557 71.7999 Constraint 250 412 6.0105 7.5132 11.2697 71.6214 Constraint 221 421 7.6733 9.5917 14.3875 71.5512 Constraint 242 435 6.9985 8.7481 13.1221 71.5279 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 210 412 7.8478 9.8098 14.7146 71.4582 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 122 210 7.0877 8.8596 13.2894 71.3017 Constraint 210 442 5.0969 6.3711 9.5567 71.1401 Constraint 242 322 9.6053 12.0067 18.0100 71.1298 Constraint 242 429 7.9063 9.8828 14.8242 70.9416 Constraint 292 399 9.3182 11.6478 17.4717 70.7518 Constraint 182 421 8.9106 11.1383 16.7074 70.3466 Constraint 242 442 4.6754 5.8442 8.7664 70.1945 Constraint 210 303 9.8545 12.3181 18.4771 70.1726 Constraint 237 435 7.3795 9.2244 13.8366 69.8153 Constraint 128 221 8.4630 10.5788 15.8682 69.6448 Constraint 136 210 8.4102 10.5128 15.7692 69.5699 Constraint 169 272 9.4956 11.8694 17.8042 69.5057 Constraint 285 350 6.7245 8.4056 12.6085 69.4077 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 96 169 8.0269 10.0337 15.0505 68.4859 Constraint 237 442 4.1481 5.1852 7.7777 68.4818 Constraint 201 442 7.2475 9.0593 13.5890 68.4818 Constraint 221 412 8.4731 10.5914 15.8871 68.4582 Constraint 314 429 8.7909 10.9886 16.4829 68.3314 Constraint 96 297 8.4741 10.5926 15.8888 67.8478 Constraint 96 182 7.8193 9.7742 14.6612 67.8478 Constraint 221 442 7.6298 9.5372 14.3058 67.4733 Constraint 169 242 8.5594 10.6992 16.0488 67.3976 Constraint 169 442 6.8054 8.5067 12.7600 67.2436 Constraint 285 391 6.5991 8.2489 12.3733 67.0876 Constraint 128 297 8.9646 11.2058 16.8087 67.0739 Constraint 250 421 8.2163 10.2704 15.4056 67.0503 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 128 421 7.5439 9.4299 14.1448 66.5984 Constraint 210 429 8.8051 11.0064 16.5096 66.4662 Constraint 292 391 7.5353 9.4191 14.1287 66.1731 Constraint 242 391 5.9263 7.4078 11.1117 66.1420 Constraint 279 341 8.0958 10.1198 15.1797 65.8294 Constraint 96 429 7.8436 9.8045 14.7067 65.5215 Constraint 314 391 6.3154 7.8942 11.8413 65.4738 Constraint 169 421 8.6942 10.8678 16.3017 65.4465 Constraint 190 322 9.9706 12.4633 18.6949 65.3632 Constraint 104 297 8.3508 10.4385 15.6578 65.3552 Constraint 303 391 8.5276 10.6595 15.9892 65.1318 Constraint 259 391 5.9522 7.4403 11.1604 65.0874 Constraint 96 421 5.6457 7.0571 10.5856 64.5052 Constraint 210 435 8.7113 10.8891 16.3337 64.4816 Constraint 237 429 9.2190 11.5238 17.2857 64.3920 Constraint 104 292 7.9162 9.8952 14.8429 64.3718 Constraint 96 221 9.3296 11.6620 17.4931 63.9604 Constraint 122 421 7.4323 9.2904 13.9355 63.9402 Constraint 96 399 7.7229 9.6537 14.4805 63.7343 Constraint 242 303 9.8974 12.3717 18.5575 63.4214 Constraint 292 360 7.7896 9.7370 14.6055 63.3022 Constraint 285 360 6.9769 8.7212 13.0818 63.3022 Constraint 210 449 6.0034 7.5042 11.2563 63.1823 Constraint 242 382 8.2011 10.2513 15.3770 63.1420 Constraint 360 429 8.5563 10.6954 16.0430 63.0519 Constraint 250 391 7.6274 9.5343 14.3014 63.0364 Constraint 96 442 8.3535 10.4419 15.6629 62.8717 Constraint 104 330 7.6496 9.5620 14.3430 62.8628 Constraint 285 412 8.5443 10.6803 16.0205 62.8460 Constraint 88 322 7.8093 9.7617 14.6425 62.5373 Constraint 136 322 8.3822 10.4778 15.7167 62.3688 Constraint 242 360 8.4853 10.6066 15.9099 62.3566 Constraint 96 242 8.3357 10.4196 15.6295 62.3539 Constraint 104 176 9.0183 11.2729 16.9093 62.3514 Constraint 259 442 7.5653 9.4566 14.1848 62.3293 Constraint 226 442 7.3069 9.1336 13.7004 62.2442 Constraint 104 421 9.0800 11.3501 17.0251 61.6061 Constraint 88 421 8.3124 10.3904 15.5857 61.5052 Constraint 259 399 8.8807 11.1009 16.6513 61.4632 Constraint 104 314 7.2777 9.0971 13.6456 61.4599 Constraint 259 360 7.9670 9.9588 14.9382 61.3020 Constraint 169 449 6.5262 8.1578 12.2367 61.2411 Constraint 128 442 7.5304 9.4130 14.1194 61.0845 Constraint 226 412 9.1757 11.4696 17.2044 60.8000 Constraint 128 449 5.9144 7.3930 11.0896 60.7107 Constraint 104 449 8.6422 10.8028 16.2042 60.7107 Constraint 122 429 7.6590 9.5737 14.3606 60.3555 Constraint 113 322 8.3183 10.3979 15.5969 60.3177 Constraint 122 322 8.3865 10.4832 15.7247 60.3063 Constraint 242 449 7.2829 9.1036 13.6554 59.6657 Constraint 250 442 7.1437 8.9296 13.3944 59.4926 Constraint 96 449 5.9865 7.4831 11.2247 59.2132 Constraint 88 314 8.1128 10.1410 15.2114 59.1674 Constraint 128 314 8.2101 10.2626 15.3939 59.0667 Constraint 314 449 9.0217 11.2771 16.9157 58.7431 Constraint 128 242 8.3633 10.4541 15.6812 58.6641 Constraint 128 237 8.1590 10.1987 15.2981 58.5768 Constraint 88 429 8.3479 10.4349 15.6524 58.4408 Constraint 122 442 7.8744 9.8430 14.7645 58.4263 Constraint 226 421 9.4459 11.8074 17.7110 58.2384 Constraint 96 303 8.8254 11.0317 16.5476 58.1602 Constraint 96 341 9.6214 12.0268 18.0401 58.0597 Constraint 201 449 8.6576 10.8219 16.2329 57.9531 Constraint 201 421 9.3918 11.7397 17.6095 57.8105 Constraint 128 461 8.5996 10.7495 16.1243 57.7988 Constraint 399 461 8.4915 10.6144 15.9216 57.4260 Constraint 285 368 8.3193 10.3992 15.5988 57.3131 Constraint 210 391 8.8356 11.0445 16.5667 57.1841 Constraint 267 391 8.9518 11.1898 16.7847 57.0912 Constraint 285 355 8.8045 11.0057 16.5085 57.0595 Constraint 292 449 8.5556 10.6945 16.0417 56.9560 Constraint 113 210 9.4530 11.8162 17.7243 56.7383 Constraint 285 399 9.0650 11.3312 16.9968 56.6327 Constraint 303 421 9.0517 11.3147 16.9720 56.6254 Constraint 250 435 8.5578 10.6972 16.0458 56.5023 Constraint 322 449 8.9612 11.2016 16.8023 56.4867 Constraint 279 350 8.1712 10.2140 15.3210 56.4114 Constraint 404 467 8.2132 10.2664 15.3997 56.3013 Constraint 96 461 7.6250 9.5312 14.2968 56.3013 Constraint 259 382 8.6373 10.7966 16.1949 56.0984 Constraint 122 292 9.1356 11.4195 17.1293 55.6871 Constraint 250 382 8.5246 10.6557 15.9836 55.6802 Constraint 182 442 9.0807 11.3509 17.0263 55.5804 Constraint 153 442 7.1937 8.9921 13.4882 55.5145 Constraint 122 461 5.6204 7.0255 10.5383 55.3635 Constraint 122 449 4.5660 5.7076 8.5613 55.3635 Constraint 237 449 7.0903 8.8629 13.2943 55.1163 Constraint 88 449 7.5118 9.3897 14.0846 55.0217 Constraint 161 449 9.6472 12.0590 18.0885 54.8193 Constraint 399 467 8.6104 10.7630 16.1445 54.4260 Constraint 96 259 9.0609 11.3261 16.9891 54.4132 Constraint 113 449 8.3419 10.4274 15.6411 54.2900 Constraint 153 421 9.2310 11.5387 17.3081 54.2770 Constraint 80 322 6.9439 8.6798 13.0197 54.2609 Constraint 122 435 9.6716 12.0896 18.1343 54.1888 Constraint 221 391 8.5133 10.6417 15.9625 53.8841 Constraint 122 201 9.1185 11.3981 17.0971 53.3019 Constraint 96 412 9.4109 11.7636 17.6455 53.2835 Constraint 128 272 9.5804 11.9755 17.9632 52.6442 Constraint 259 404 9.5398 11.9247 17.8871 52.6265 Constraint 88 399 8.5561 10.6951 16.0427 52.5721 Constraint 104 303 9.7322 12.1652 18.2479 52.4923 Constraint 96 285 9.0096 11.2620 16.8929 52.3622 Constraint 259 368 8.5956 10.7445 16.1168 52.3130 Constraint 153 449 5.6971 7.1214 10.6821 51.8559 Constraint 144 449 7.8179 9.7724 14.6586 51.8559 Constraint 297 360 9.1824 11.4780 17.2170 51.3228 Constraint 404 473 5.3588 6.6985 10.0477 51.3014 Constraint 201 297 10.0378 12.5473 18.8209 51.2886 Constraint 153 429 9.7694 12.2117 18.3176 51.2770 Constraint 314 442 9.2350 11.5438 17.3157 51.0511 Constraint 122 314 9.2129 11.5162 17.2742 50.6821 Constraint 136 449 8.9396 11.1745 16.7617 50.4650 Constraint 242 368 9.0799 11.3498 17.0247 50.3570 Constraint 250 404 9.2612 11.5764 17.3647 50.0555 Constraint 176 442 9.3235 11.6544 17.4816 49.9225 Constraint 399 480 8.2521 10.3151 15.4727 49.9190 Constraint 128 429 9.2325 11.5407 17.3110 49.7153 Constraint 122 237 8.4705 10.5881 15.8822 49.6871 Constraint 88 461 6.8584 8.5730 12.8595 49.5389 Constraint 399 473 4.9051 6.1314 9.1970 49.5142 Constraint 80 330 8.2972 10.3715 15.5572 49.4420 Constraint 153 461 7.7092 9.6365 14.4548 49.2850 Constraint 113 461 8.5515 10.6894 16.0340 49.2850 Constraint 128 259 9.6212 12.0265 18.0398 49.2504 Constraint 122 467 8.6288 10.7860 16.1790 49.2065 Constraint 169 461 9.5987 11.9984 17.9976 48.8560 Constraint 153 237 7.8483 9.8104 14.7156 48.8558 Constraint 221 449 9.2792 11.5990 17.3985 48.7091 Constraint 259 350 8.4856 10.6070 15.9105 48.5061 Constraint 237 391 9.1712 11.4640 17.1960 48.3257 Constraint 96 350 8.5250 10.6563 15.9844 48.2724 Constraint 80 314 8.4579 10.5723 15.8585 47.8939 Constraint 297 421 8.8330 11.0413 16.5619 46.9508 Constraint 128 226 9.7669 12.2086 18.3129 46.8735 Constraint 210 399 9.7754 12.2192 18.3288 46.7955 Constraint 122 242 8.6642 10.8302 16.2453 46.6981 Constraint 96 360 7.1603 8.9504 13.4256 46.3025 Constraint 144 461 8.3314 10.4142 15.6213 46.2850 Constraint 210 461 9.6157 12.0196 18.0295 45.9529 Constraint 88 467 8.6660 10.8325 16.2487 45.8550 Constraint 182 449 9.3402 11.6753 17.5129 45.7105 Constraint 314 382 9.5308 11.9135 17.8702 45.6644 Constraint 153 435 9.7315 12.1644 18.2466 45.2771 Constraint 161 237 9.7547 12.1933 18.2900 45.2583 Constraint 267 350 9.0527 11.3159 16.9738 44.9002 Constraint 350 421 9.1151 11.3938 17.0908 44.6785 Constraint 190 442 9.4611 11.8263 17.7395 44.3612 Constraint 88 480 8.9859 11.2324 16.8486 43.9433 Constraint 412 473 7.9783 9.9729 14.9593 43.9412 Constraint 404 480 8.9660 11.2075 16.8113 43.9412 Constraint 303 368 9.0024 11.2530 16.8795 42.6386 Constraint 169 259 9.7557 12.1946 18.2919 42.4429 Constraint 285 382 9.3640 11.7050 17.5575 42.0148 Constraint 322 391 9.1974 11.4967 17.2451 41.1782 Constraint 122 399 9.4252 11.7815 17.6722 41.0274 Constraint 88 360 9.0314 11.2892 16.9339 40.7198 Constraint 96 391 8.2558 10.3198 15.4796 40.6004 Constraint 136 292 9.8798 12.3497 18.5246 40.5724 Constraint 113 314 9.8948 12.3685 18.5528 40.5021 Constraint 259 449 9.2144 11.5180 17.2770 40.2994 Constraint 322 399 8.8607 11.0759 16.6139 40.0209 Constraint 375 473 7.0909 8.8636 13.2955 39.7696 Constraint 314 375 9.0433 11.3041 16.9561 38.8708 Constraint 237 404 9.8781 12.3477 18.5215 38.4210 Constraint 88 473 8.9011 11.1263 16.6895 38.3702 Constraint 96 176 9.4666 11.8333 17.7500 38.2794 Constraint 292 429 9.1895 11.4869 17.2303 37.9606 Constraint 96 473 9.1701 11.4626 17.1940 37.9508 Constraint 285 442 9.5201 11.9001 17.8502 37.7029 Constraint 104 461 9.9310 12.4137 18.6205 37.2389 Constraint 176 449 9.7931 12.2413 18.3620 37.0524 Constraint 421 489 8.8455 11.0568 16.5852 35.6412 Constraint 259 435 9.2048 11.5060 17.2590 35.6096 Constraint 122 473 9.3433 11.6791 17.5186 35.4106 Constraint 429 497 5.1294 6.4117 9.6176 35.0892 Constraint 421 497 6.3341 7.9177 11.8765 35.0892 Constraint 429 489 6.1046 7.6308 11.4462 34.6249 Constraint 259 429 9.3721 11.7151 17.5727 34.5943 Constraint 221 360 9.5225 11.9032 17.8548 34.5380 Constraint 391 473 8.3811 10.4764 15.7147 34.1966 Constraint 382 473 8.5685 10.7106 16.0659 34.1966 Constraint 226 449 9.8824 12.3530 18.5294 34.1371 Constraint 267 421 9.2237 11.5296 17.2944 33.8946 Constraint 153 242 9.4318 11.7898 17.6847 33.8764 Constraint 272 421 9.2821 11.6026 17.4040 33.8095 Constraint 267 360 9.3549 11.6936 17.5404 33.7896 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 104 341 9.3101 11.6377 17.4565 33.5849 Constraint 421 480 9.9338 12.4173 18.6260 33.5395 Constraint 96 355 9.0672 11.3340 17.0010 33.4471 Constraint 314 404 8.5340 10.6675 16.0012 32.9796 Constraint 399 489 8.4371 10.5463 15.8195 32.9364 Constraint 96 237 9.2204 11.5255 17.2883 32.7927 Constraint 88 210 8.6800 10.8500 16.2750 32.7584 Constraint 404 489 9.7088 12.1360 18.2040 32.5316 Constraint 88 489 6.4511 8.0639 12.0958 32.5316 Constraint 250 399 10.0671 12.5838 18.8757 32.4187 Constraint 128 330 9.8159 12.2698 18.4047 32.1391 Constraint 176 259 9.8895 12.3619 18.5428 31.7162 Constraint 399 497 5.3938 6.7423 10.1134 31.6818 Constraint 368 473 9.3898 11.7373 17.6059 31.6256 Constraint 360 473 8.3688 10.4610 15.6914 31.6256 Constraint 435 497 8.4566 10.5707 15.8561 31.2770 Constraint 412 497 9.0047 11.2559 16.8838 31.2770 Constraint 404 497 7.5289 9.4111 14.1167 31.2770 Constraint 314 497 8.5167 10.6459 15.9688 31.1751 Constraint 96 497 6.2224 7.7780 11.6670 31.1751 Constraint 88 497 5.6890 7.1113 10.6669 31.1751 Constraint 355 421 9.6164 12.0205 18.0307 31.1640 Constraint 303 399 8.2101 10.2626 15.3939 30.1833 Constraint 122 489 7.3254 9.1567 13.7351 29.8734 Constraint 169 297 9.8339 12.2924 18.4386 29.8441 Constraint 113 421 9.6931 12.1164 18.1746 29.6208 Constraint 360 449 9.6764 12.0955 18.1433 29.4279 Constraint 297 391 9.6567 12.0708 18.1062 29.0346 Constraint 267 412 9.3417 11.6771 17.5156 28.8015 Constraint 242 461 9.5574 11.9467 17.9201 28.5540 Constraint 210 360 9.1967 11.4958 17.2438 28.2770 Constraint 201 322 10.0951 12.6189 18.9283 28.2218 Constraint 322 497 9.3726 11.7157 17.5736 28.1751 Constraint 250 368 9.4638 11.8298 17.7447 27.5433 Constraint 122 497 7.0506 8.8133 13.2199 27.3025 Constraint 113 489 9.2293 11.5367 17.3050 27.3025 Constraint 161 442 9.5112 11.8890 17.8334 26.6376 Constraint 104 497 8.8973 11.1216 16.6824 26.4809 Constraint 169 435 9.8813 12.3517 18.5275 25.9710 Constraint 429 511 7.4598 9.3247 13.9871 25.7176 Constraint 421 511 9.1103 11.3879 17.0818 25.7176 Constraint 250 449 9.8306 12.2883 18.4325 25.5541 Constraint 399 511 6.4575 8.0719 12.1078 25.1061 Constraint 190 421 9.9158 12.3948 18.5921 24.9189 Constraint 250 429 9.9746 12.4682 18.7023 24.8764 Constraint 404 511 8.7727 10.9659 16.4488 24.7013 Constraint 375 480 9.5336 11.9170 17.8755 24.6014 Constraint 128 497 8.6941 10.8676 16.3014 24.4841 Constraint 272 442 9.8208 12.2760 18.4139 24.1587 Constraint 292 404 9.8303 12.2879 18.4319 23.9723 Constraint 113 497 8.3937 10.4921 15.7382 23.8226 Constraint 267 341 9.8839 12.3548 18.5323 23.6159 Constraint 242 350 9.9185 12.3981 18.5971 23.5524 Constraint 322 442 9.1672 11.4591 17.1886 23.4061 Constraint 96 404 9.6185 12.0231 18.0346 23.2480 Constraint 176 267 10.1452 12.6815 19.0223 22.9234 Constraint 237 461 9.8252 12.2815 18.4223 22.8959 Constraint 80 497 8.4564 10.5705 15.8558 22.8944 Constraint 279 391 9.5243 11.9053 17.8580 22.6991 Constraint 322 429 7.8882 9.8602 14.7903 22.4356 Constraint 96 467 9.4549 11.8186 17.7279 22.0301 Constraint 391 497 8.8155 11.0193 16.5290 21.9372 Constraint 96 201 9.0092 11.2615 16.8923 21.8522 Constraint 226 435 10.1885 12.7356 19.1034 21.8337 Constraint 292 355 9.7611 12.2014 18.3020 21.6957 Constraint 88 355 9.4027 11.7533 17.6300 21.4581 Constraint 80 449 9.7380 12.1725 18.2588 21.4130 Constraint 355 497 9.0359 11.2948 16.9422 21.3580 Constraint 144 442 9.5698 11.9623 17.9434 20.7927 Constraint 88 330 9.8909 12.3636 18.5454 20.7039 Constraint 360 497 7.4553 9.3191 13.9787 20.6209 Constraint 360 442 9.8310 12.2887 18.4331 20.4482 Constraint 96 435 9.9150 12.3938 18.5906 20.4096 Constraint 96 511 9.0725 11.3407 17.0110 20.0427 Constraint 330 421 9.3572 11.6965 17.5447 19.6321 Constraint 375 497 8.5779 10.7224 16.0836 19.6209 Constraint 122 480 9.7296 12.1620 18.2430 18.9889 Constraint 169 429 10.0119 12.5149 18.7723 18.8788 Constraint 88 511 7.2418 9.0523 13.5784 18.8283 Constraint 292 368 9.0374 11.2967 16.9451 18.6440 Constraint 375 511 8.0681 10.0851 15.1277 18.6241 Constraint 360 511 8.6827 10.8534 16.2801 18.6241 Constraint 104 201 9.5044 11.8805 17.8207 17.9037 Constraint 242 497 9.4495 11.8119 17.7178 17.7685 Constraint 128 285 10.1654 12.7067 19.0601 17.6423 Constraint 272 350 10.0331 12.5414 18.8121 17.4097 Constraint 330 399 8.8063 11.0079 16.5119 17.3067 Constraint 297 399 9.6914 12.1143 18.1714 17.3067 Constraint 355 511 8.3792 10.4740 15.7110 17.2311 Constraint 80 461 9.5869 11.9836 17.9754 17.2216 Constraint 279 360 8.5400 10.6750 16.0125 17.2165 Constraint 272 391 9.9653 12.4566 18.6849 17.0327 Constraint 80 360 9.4225 11.7781 17.6671 16.8286 Constraint 88 292 8.2980 10.3725 15.5587 16.8033 Constraint 104 360 9.0545 11.3182 16.9772 16.7404 Constraint 314 435 8.3278 10.4097 15.6146 16.5069 Constraint 237 314 10.0258 12.5323 18.7984 16.3550 Constraint 303 429 8.4853 10.6067 15.9100 16.3335 Constraint 88 169 8.9513 11.1891 16.7836 16.3322 Constraint 80 489 9.4372 11.7964 17.6947 16.2280 Constraint 259 341 9.7186 12.1482 18.2223 16.1437 Constraint 285 404 9.4757 11.8447 17.7670 16.0769 Constraint 429 519 8.6228 10.7785 16.1678 16.0432 Constraint 80 421 10.0635 12.5794 18.8690 16.0103 Constraint 210 404 9.8781 12.3476 18.5213 15.9134 Constraint 144 497 9.7250 12.1562 18.2344 15.8259 Constraint 88 519 7.8790 9.8488 14.7732 15.7432 Constraint 104 221 9.7347 12.1684 18.2526 15.5281 Constraint 80 341 9.8458 12.3073 18.4609 15.2306 Constraint 267 442 9.9216 12.4020 18.6029 15.1607 Constraint 128 489 10.0837 12.6046 18.9069 15.1353 Constraint 210 497 9.7962 12.2452 18.3678 14.9471 Constraint 104 350 8.9829 11.2286 16.8429 14.8894 Constraint 104 242 9.3368 11.6710 17.5065 14.8821 Constraint 292 435 9.2610 11.5762 17.3644 14.7197 Constraint 285 375 9.6236 12.0295 18.0443 14.4223 Constraint 221 350 9.7298 12.1622 18.2433 14.4098 Constraint 322 412 9.3355 11.6693 17.5040 14.1792 Constraint 449 527 7.9650 9.9562 14.9343 14.1450 Constraint 169 314 10.0153 12.5191 18.7787 14.0680 Constraint 303 375 8.6340 10.7925 16.1887 14.0394 Constraint 122 527 8.1216 10.1520 15.2280 13.9577 Constraint 136 461 10.1460 12.6825 19.0238 13.7344 Constraint 259 355 9.4665 11.8331 17.7497 13.7321 Constraint 96 272 10.0481 12.5601 18.8401 13.6979 Constraint 96 190 10.0560 12.5701 18.8551 13.6097 Constraint 128 412 9.9069 12.3836 18.5754 13.4747 Constraint 96 480 10.2138 12.7673 19.1509 13.4603 Constraint 297 449 9.3247 11.6558 17.4838 13.4225 Constraint 267 368 9.6456 12.0570 18.0855 13.2532 Constraint 88 442 9.3413 11.6767 17.5150 13.2528 Constraint 144 237 8.7670 10.9587 16.4381 13.2013 Constraint 399 519 8.4405 10.5506 15.8259 13.1480 Constraint 169 412 9.8795 12.3494 18.5242 13.1360 Constraint 429 527 7.0952 8.8690 13.3035 13.0432 Constraint 250 314 10.1273 12.6591 18.9886 13.0314 Constraint 122 221 8.2753 10.3441 15.5162 12.8985 Constraint 113 237 8.6769 10.8462 16.2693 12.8985 Constraint 368 497 9.6413 12.0517 18.0775 12.7873 Constraint 421 527 7.6180 9.5225 14.2838 12.7785 Constraint 128 399 9.7951 12.2439 18.3658 12.6975 Constraint 96 527 7.0122 8.7652 13.1479 12.6242 Constraint 88 527 6.5198 8.1497 12.2245 12.6242 Constraint 297 429 8.9608 11.2010 16.8016 12.3855 Constraint 226 297 9.9100 12.3875 18.5813 12.3470 Constraint 303 412 8.7282 10.9103 16.3654 12.2994 Constraint 297 442 10.1191 12.6488 18.9733 12.1488 Constraint 122 226 8.5021 10.6277 15.9415 12.0027 Constraint 153 322 9.8160 12.2700 18.4050 11.9746 Constraint 182 341 10.0384 12.5480 18.8221 11.9215 Constraint 88 350 8.6890 10.8612 16.2918 11.9008 Constraint 80 350 8.4592 10.5740 15.8610 11.8257 Constraint 285 429 8.9195 11.1493 16.7240 11.8111 Constraint 360 489 9.3839 11.7299 17.5948 11.7842 Constraint 292 497 9.8084 12.2605 18.3908 11.7686 Constraint 421 629 9.2336 11.5420 17.3130 11.7554 Constraint 314 599 8.8355 11.0444 16.5666 11.7275 Constraint 242 473 9.7181 12.1477 18.2215 11.7057 Constraint 360 435 9.9751 12.4689 18.7033 11.5730 Constraint 250 360 9.1503 11.4379 17.1569 11.5623 Constraint 375 467 9.8864 12.3580 18.5370 11.5599 Constraint 303 382 9.0846 11.3557 17.0335 11.5465 Constraint 210 330 9.5194 11.8993 17.8489 11.5418 Constraint 237 399 9.9540 12.4425 18.6637 11.4767 Constraint 341 421 8.2941 10.3676 15.5514 11.4502 Constraint 292 382 9.7234 12.1542 18.2313 11.4439 Constraint 429 604 6.6376 8.2971 12.4456 11.4221 Constraint 421 604 7.7809 9.7261 14.5891 11.4221 Constraint 237 382 9.1524 11.4405 17.1608 11.4001 Constraint 201 435 9.9458 12.4322 18.6483 11.3732 Constraint 279 421 8.8468 11.0586 16.5878 11.3405 Constraint 330 449 10.2610 12.8263 19.2394 11.3293 Constraint 226 391 9.5583 11.9479 17.9218 11.3216 Constraint 429 535 8.4224 10.5281 15.7921 11.2228 Constraint 421 535 8.8836 11.1045 16.6567 11.2228 Constraint 176 421 9.5016 11.8770 17.8155 11.1074 Constraint 201 412 9.1517 11.4397 17.1595 10.9807 Constraint 404 604 8.1908 10.2384 15.3577 10.9528 Constraint 122 360 9.0196 11.2745 16.9117 10.9038 Constraint 144 489 9.4620 11.8275 17.7413 10.8979 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 113 242 8.6482 10.8103 16.2154 10.8052 Constraint 88 259 7.3254 9.1567 13.7351 10.8052 Constraint 88 242 5.1940 6.4925 9.7388 10.8052 Constraint 88 237 7.2414 9.0517 13.5776 10.8052 Constraint 88 221 8.4755 10.5943 15.8915 10.8052 Constraint 303 404 7.9386 9.9232 14.8848 10.7628 Constraint 429 629 8.7228 10.9035 16.3552 10.7391 Constraint 153 497 9.7552 12.1940 18.2909 10.7328 Constraint 221 399 10.0051 12.5064 18.7595 10.7321 Constraint 461 535 9.1881 11.4851 17.2277 10.6663 Constraint 113 182 9.3288 11.6610 17.4916 10.5928 Constraint 221 368 10.1277 12.6596 18.9894 10.4851 Constraint 429 599 7.0253 8.7816 13.1724 10.4452 Constraint 421 599 7.0454 8.8068 13.2102 10.4452 Constraint 412 599 8.3951 10.4939 15.7409 10.4452 Constraint 404 599 7.4726 9.3407 14.0111 10.4135 Constraint 88 250 8.4052 10.5066 15.7598 10.2095 Constraint 122 511 8.9939 11.2424 16.8636 10.1701 Constraint 399 527 6.2026 7.7533 11.6299 10.1481 Constraint 176 279 10.1302 12.6627 18.9941 10.0985 Constraint 399 535 6.0528 7.5660 11.3490 9.9942 Constraint 391 599 8.1825 10.2281 15.3421 9.9605 Constraint 399 604 7.8725 9.8406 14.7609 9.9365 Constraint 122 259 8.7809 10.9761 16.4642 9.9095 Constraint 314 511 9.6121 12.0151 18.0226 9.8725 Constraint 69 497 5.1329 6.4161 9.6242 9.8353 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 473 8.6479 10.8099 16.2149 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 449 9.2700 11.5876 17.3813 9.8353 Constraint 69 429 8.6744 10.8430 16.2645 9.8353 Constraint 69 421 7.6231 9.5288 14.2932 9.8353 Constraint 69 350 7.8101 9.7626 14.6439 9.8353 Constraint 355 473 10.0219 12.5273 18.7910 9.8095 Constraint 467 604 7.3610 9.2013 13.8019 9.7938 Constraint 467 599 8.5578 10.6973 16.0460 9.7938 Constraint 360 535 6.8362 8.5453 12.8180 9.7875 Constraint 382 497 9.2154 11.5193 17.2789 9.7874 Constraint 368 511 10.0828 12.6036 18.9053 9.7874 Constraint 221 330 10.0262 12.5328 18.7992 9.7761 Constraint 88 285 8.4710 10.5888 15.8832 9.6138 Constraint 259 375 10.1494 12.6867 19.0301 9.5893 Constraint 314 461 10.0438 12.5548 18.8321 9.5643 Constraint 104 489 10.0484 12.5605 18.8407 9.5643 Constraint 176 604 9.4772 11.8465 17.7697 9.5154 Constraint 350 473 9.3057 11.6321 17.4481 9.3696 Constraint 221 429 9.9994 12.4993 18.7489 9.2473 Constraint 399 590 8.0835 10.1044 15.1565 9.0311 Constraint 96 375 9.6752 12.0940 18.1410 9.0083 Constraint 480 629 8.1842 10.2302 15.3453 9.0047 Constraint 80 355 9.8696 12.3370 18.5055 8.9979 Constraint 88 435 9.8660 12.3325 18.4987 8.9903 Constraint 136 297 10.2918 12.8648 19.2972 8.9893 Constraint 153 292 9.1173 11.3967 17.0950 8.9804 Constraint 153 226 8.8503 11.0629 16.5943 8.9804 Constraint 128 350 9.6586 12.0732 18.1098 8.9776 Constraint 210 604 6.2067 7.7584 11.6376 8.9324 Constraint 404 613 9.0965 11.3706 17.0560 8.9243 Constraint 314 604 7.5078 9.3848 14.0772 8.9147 Constraint 272 360 9.8756 12.3446 18.5168 8.8942 Constraint 122 250 9.5533 11.9417 17.9125 8.8932 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 285 435 9.7153 12.1442 18.2163 8.8418 Constraint 467 585 8.1870 10.2337 15.3505 8.7775 Constraint 350 497 9.4209 11.7762 17.6642 8.7706 Constraint 136 421 9.5785 11.9731 17.9597 8.7544 Constraint 322 629 9.8702 12.3378 18.5066 8.7057 Constraint 322 604 6.4335 8.0418 12.0627 8.7057 Constraint 314 489 9.1527 11.4409 17.1613 8.6855 Constraint 80 511 9.9787 12.4734 18.7101 8.6581 Constraint 442 527 8.5808 10.7261 16.0891 8.6083 Constraint 322 535 10.1505 12.6882 19.0322 8.5730 Constraint 360 461 9.5237 11.9046 17.8569 8.5730 Constraint 355 519 8.3103 10.3878 15.5817 8.5730 Constraint 480 604 5.6679 7.0849 10.6274 8.5613 Constraint 330 391 8.9086 11.1358 16.7037 8.5513 Constraint 113 292 9.9076 12.3845 18.5767 8.5207 Constraint 242 375 9.3587 11.6984 17.5476 8.4849 Constraint 237 360 9.8068 12.2585 18.3877 8.4849 Constraint 128 435 9.8157 12.2696 18.4045 8.4076 Constraint 429 613 6.9791 8.7239 13.0859 8.4033 Constraint 473 613 8.0398 10.0497 15.0746 8.3505 Constraint 449 519 9.3448 11.6810 17.5216 8.3083 Constraint 279 355 7.6527 9.5658 14.3487 8.2627 Constraint 421 519 8.9287 11.1608 16.7413 8.2228 Constraint 412 527 8.6094 10.7617 16.1425 8.2228 Constraint 128 391 9.5640 11.9550 17.9325 8.2038 Constraint 88 391 9.2403 11.5504 17.3256 8.2038 Constraint 237 622 5.5461 6.9326 10.3989 8.1330 Constraint 210 622 7.2815 9.1019 13.6529 8.1330 Constraint 96 519 8.4113 10.5141 15.7711 8.1209 Constraint 473 629 6.3483 7.9353 11.9030 8.0048 Constraint 144 421 9.0086 11.2607 16.8911 7.9919 Constraint 480 585 6.0513 7.5641 11.3462 7.9884 Constraint 113 201 8.9283 11.1603 16.7405 7.9876 Constraint 399 599 6.0232 7.5290 11.2935 7.9596 Constraint 404 622 9.1176 11.3970 17.0955 7.9474 Constraint 399 613 9.5168 11.8960 17.8440 7.9474 Constraint 292 599 8.1619 10.2024 15.3036 7.9432 Constraint 412 535 9.5794 11.9742 17.9613 7.9228 Constraint 128 360 9.4452 11.8065 17.7098 7.9038 Constraint 113 360 9.9662 12.4578 18.6866 7.9038 Constraint 96 368 8.8302 11.0377 16.5566 7.9038 Constraint 144 242 10.2804 12.8505 19.2757 7.8992 Constraint 303 449 9.6487 12.0609 18.0913 7.8495 Constraint 69 511 6.1322 7.6653 11.4979 7.8367 Constraint 391 527 7.5999 9.4999 14.2499 7.8038 Constraint 473 599 5.7490 7.1863 10.7794 7.7939 Constraint 467 613 9.6446 12.0558 18.0836 7.7939 Constraint 473 622 8.2204 10.2756 15.4133 7.7775 Constraint 330 429 9.0925 11.3656 17.0483 7.7752 Constraint 242 622 8.0543 10.0678 15.1017 7.7282 Constraint 237 613 8.0272 10.0340 15.0510 7.7282 Constraint 226 622 9.0967 11.3709 17.0564 7.7282 Constraint 210 613 7.8764 9.8455 14.7682 7.7282 Constraint 201 622 7.5784 9.4730 14.2095 7.7282 Constraint 201 613 9.8964 12.3705 18.5558 7.7282 Constraint 210 629 6.1498 7.6872 11.5308 7.7179 Constraint 190 449 9.7986 12.2483 18.3724 7.6543 Constraint 435 629 9.1790 11.4738 17.2107 7.6503 Constraint 96 226 9.7351 12.1689 18.2533 7.6193 Constraint 88 404 9.2243 11.5303 17.2955 7.5856 Constraint 577 657 9.8532 12.3165 18.4748 7.5557 Constraint 182 599 8.5397 10.6746 16.0119 7.5384 Constraint 182 391 9.1969 11.4961 17.2442 7.4830 Constraint 480 599 7.6667 9.5834 14.3751 7.4096 Constraint 429 622 8.3193 10.3991 15.5987 7.4033 Constraint 314 473 9.1424 11.4280 17.1421 7.3718 Constraint 322 461 8.1026 10.1283 15.1924 7.3602 Constraint 473 604 5.3937 6.7421 10.1132 7.3505 Constraint 182 429 9.9364 12.4205 18.6308 7.3215 Constraint 182 412 9.3582 11.6977 17.5466 7.3215 Constraint 104 399 8.6418 10.8022 16.2033 7.2898 Constraint 104 429 8.8573 11.0716 16.6074 7.2827 Constraint 221 435 9.7944 12.2430 18.3645 7.2627 Constraint 122 190 8.8851 11.1063 16.6595 7.2153 Constraint 435 527 8.5592 10.6990 16.0485 7.2065 Constraint 404 519 9.9719 12.4649 18.6974 7.2065 Constraint 360 480 9.7463 12.1828 18.2742 7.2048 Constraint 144 527 8.8661 11.0826 16.6239 7.1702 Constraint 122 519 8.7486 10.9358 16.4037 7.1702 Constraint 128 527 9.5676 11.9595 17.9392 7.0512 Constraint 113 527 6.8302 8.5378 12.8067 7.0512 Constraint 104 527 9.0735 11.3419 17.0128 7.0512 Constraint 80 242 9.0879 11.3598 17.0397 7.0153 Constraint 412 629 9.4979 11.8724 17.8086 6.9913 Constraint 480 636 7.5827 9.4784 14.2175 6.9903 Constraint 113 429 9.1469 11.4337 17.1505 6.9898 Constraint 382 599 8.4288 10.5360 15.8040 6.9596 Constraint 375 590 7.9684 9.9606 14.9408 6.9596 Constraint 375 585 9.3838 11.7298 17.5947 6.9596 Constraint 210 599 5.4664 6.8330 10.2495 6.9554 Constraint 360 604 9.4720 11.8400 17.7601 6.9442 Constraint 330 604 9.2492 11.5615 17.3423 6.9186 Constraint 314 613 9.5004 11.8754 17.8132 6.9186 Constraint 303 604 9.9661 12.4577 18.6865 6.9186 Constraint 297 604 8.7965 10.9956 16.4934 6.9186 Constraint 292 629 9.0597 11.3246 16.9869 6.9186 Constraint 292 613 10.1483 12.6854 19.0281 6.9186 Constraint 292 604 6.8923 8.6153 12.9230 6.9186 Constraint 242 613 8.5151 10.6439 15.9658 6.9186 Constraint 182 629 8.5058 10.6323 15.9485 6.9186 Constraint 182 604 7.9824 9.9780 14.9671 6.9186 Constraint 404 535 7.9296 9.9120 14.8680 6.9065 Constraint 404 527 7.5626 9.4533 14.1800 6.9065 Constraint 88 201 9.6028 12.0035 18.0052 6.8786 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 104 237 9.1569 11.4461 17.1691 6.7962 Constraint 461 604 8.2049 10.2561 15.3841 6.7939 Constraint 461 599 8.4145 10.5181 15.7772 6.7939 Constraint 375 519 9.8925 12.3657 18.5485 6.7875 Constraint 360 527 4.9124 6.1405 9.2107 6.7875 Constraint 360 519 8.3797 10.4746 15.7119 6.7875 Constraint 341 527 8.9465 11.1831 16.7747 6.7875 Constraint 322 527 6.3291 7.9114 11.8671 6.7875 Constraint 322 489 8.4705 10.5881 15.8821 6.7875 Constraint 314 527 5.3157 6.6447 9.9670 6.7875 Constraint 314 519 8.5039 10.6299 15.9448 6.7875 Constraint 292 527 7.8984 9.8730 14.8095 6.7875 Constraint 259 527 9.4405 11.8006 17.7010 6.7875 Constraint 242 527 8.6086 10.7608 16.1412 6.7875 Constraint 210 527 8.8065 11.0081 16.5121 6.7875 Constraint 473 590 6.7083 8.3854 12.5781 6.7775 Constraint 473 585 6.1437 7.6796 11.5194 6.7775 Constraint 237 604 7.3130 9.1413 13.7119 6.7404 Constraint 201 604 7.9718 9.9647 14.9471 6.7404 Constraint 322 585 8.7301 10.9127 16.3690 6.7403 Constraint 421 622 8.7010 10.8762 16.3143 6.7365 Constraint 322 599 7.7490 9.6862 14.5293 6.7288 Constraint 399 585 8.2600 10.3250 15.4874 6.6417 Constraint 391 535 7.4478 9.3098 13.9646 6.5894 Constraint 355 535 5.1682 6.4603 9.6905 6.5894 Constraint 355 527 6.3868 7.9835 11.9752 6.5894 Constraint 350 535 8.2245 10.2806 15.4209 6.5894 Constraint 350 527 7.7372 9.6715 14.5073 6.5894 Constraint 480 613 6.8694 8.5868 12.8802 6.5614 Constraint 330 552 9.5099 11.8874 17.8310 6.5576 Constraint 429 585 8.8575 11.0718 16.6077 6.4443 Constraint 442 622 7.0156 8.7695 13.1543 6.4350 Constraint 480 590 7.4438 9.3048 13.9572 6.3932 Constraint 88 226 9.3180 11.6475 17.4712 6.2828 Constraint 80 527 7.9173 9.8967 14.8450 6.2416 Constraint 169 604 7.4190 9.2737 13.9106 6.2405 Constraint 467 629 7.6684 9.5855 14.3783 6.0067 Constraint 153 489 9.5909 11.9886 17.9829 6.0000 Constraint 80 210 9.7997 12.2496 18.3744 5.9990 Constraint 136 314 8.9947 11.2434 16.8651 5.9942 Constraint 128 303 10.1407 12.6758 19.0138 5.9942 Constraint 80 399 8.9695 11.2118 16.8177 5.9918 Constraint 404 629 6.1186 7.6483 11.4724 5.9904 Constraint 399 622 7.9379 9.9223 14.8835 5.9904 Constraint 375 629 5.0053 6.2566 9.3849 5.9904 Constraint 375 622 5.3508 6.6885 10.0328 5.9904 Constraint 375 613 8.4017 10.5021 15.7531 5.9904 Constraint 368 622 8.1084 10.1355 15.2032 5.9904 Constraint 350 429 10.0989 12.6237 18.9355 5.9890 Constraint 210 350 10.1494 12.6868 19.0302 5.9890 Constraint 122 350 10.3168 12.8960 19.3440 5.9890 Constraint 182 350 9.9055 12.3819 18.5729 5.9886 Constraint 480 622 8.9021 11.1277 16.6915 5.9884 Constraint 473 657 8.6288 10.7860 16.1791 5.9884 Constraint 128 341 8.0342 10.0428 15.0642 5.9828 Constraint 169 599 8.4389 10.5487 15.8230 5.9740 Constraint 391 590 9.0144 11.2680 16.9021 5.9702 Constraint 272 341 9.6277 12.0346 18.0518 5.9688 Constraint 412 613 8.8327 11.0409 16.5614 5.9657 Constraint 360 585 9.2441 11.5551 17.3327 5.9596 Constraint 322 613 9.6880 12.1100 18.1650 5.9308 Constraint 285 604 9.5678 11.9598 17.9397 5.9308 Constraint 259 629 10.1702 12.7128 19.0692 5.9308 Constraint 259 604 8.7441 10.9302 16.3952 5.9308 Constraint 242 629 7.7726 9.7158 14.5737 5.9308 Constraint 242 604 6.6830 8.3538 12.5307 5.9308 Constraint 237 629 4.8393 6.0491 9.0736 5.9308 Constraint 226 629 7.5958 9.4948 14.2422 5.9308 Constraint 226 604 10.0718 12.5897 18.8845 5.9308 Constraint 221 629 8.4754 10.5943 15.8914 5.9308 Constraint 221 604 8.4420 10.5525 15.8288 5.9308 Constraint 201 629 4.5201 5.6501 8.4752 5.9308 Constraint 190 629 8.5554 10.6942 16.0413 5.9308 Constraint 176 629 7.2078 9.0098 13.5147 5.9308 Constraint 461 577 8.3088 10.3860 15.5790 5.8804 Constraint 201 285 10.2812 12.8516 19.2773 5.8752 Constraint 182 360 9.5766 11.9707 17.9561 5.8752 Constraint 128 473 7.9392 9.9239 14.8859 5.8556 Constraint 104 442 8.2760 10.3450 15.5175 5.8556 Constraint 80 297 10.1687 12.7109 19.0664 5.8367 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 355 8.9645 11.2056 16.8084 5.8367 Constraint 58 322 7.7881 9.7351 14.6026 5.8367 Constraint 242 599 5.0650 6.3313 9.4970 5.8350 Constraint 322 404 7.4068 9.2584 13.8877 5.8205 Constraint 461 585 9.1276 11.4095 17.1142 5.7775 Constraint 285 449 9.1975 11.4969 17.2454 5.7563 Constraint 322 577 6.4211 8.0264 12.0396 5.7525 Constraint 314 577 6.2239 7.7798 11.6697 5.7525 Constraint 297 577 8.9637 11.2046 16.8069 5.7525 Constraint 292 577 7.8052 9.7565 14.6348 5.7525 Constraint 190 599 8.9078 11.1348 16.7021 5.7513 Constraint 176 599 8.6973 10.8716 16.3075 5.7513 Constraint 322 590 10.0223 12.5279 18.7919 5.7410 Constraint 350 511 9.9502 12.4378 18.6567 5.6582 Constraint 412 604 7.8720 9.8400 14.7600 5.6446 Constraint 421 613 8.0182 10.0228 15.0342 5.6161 Constraint 88 182 8.8050 11.0063 16.5094 5.6089 Constraint 122 412 8.3591 10.4488 15.6732 5.5877 Constraint 122 404 9.7271 12.1588 18.2382 5.5877 Constraint 391 461 10.0508 12.5635 18.8453 5.5730 Constraint 382 535 8.0655 10.0818 15.1227 5.5730 Constraint 382 527 9.1682 11.4602 17.1904 5.5730 Constraint 375 535 4.6153 5.7691 8.6537 5.5730 Constraint 375 527 7.3826 9.2282 13.8423 5.5730 Constraint 368 535 5.8421 7.3026 10.9539 5.5730 Constraint 368 527 7.6702 9.5877 14.3816 5.5730 Constraint 350 519 10.0360 12.5450 18.8174 5.5730 Constraint 330 527 8.6522 10.8152 16.2229 5.5730 Constraint 330 519 10.3375 12.9218 19.3827 5.5730 Constraint 322 519 8.9572 11.1964 16.7947 5.5730 Constraint 314 535 7.3848 9.2310 13.8466 5.5730 Constraint 303 527 9.1097 11.3871 17.0807 5.5730 Constraint 297 527 9.7215 12.1518 18.2278 5.5730 Constraint 292 535 10.3627 12.9534 19.4300 5.5730 Constraint 285 527 9.8616 12.3270 18.4906 5.5730 Constraint 250 375 10.2265 12.7831 19.1747 5.5730 Constraint 242 355 10.3270 12.9088 19.3632 5.5730 Constraint 80 519 10.2915 12.8644 19.2966 5.5730 Constraint 350 412 9.2380 11.5475 17.3212 5.5709 Constraint 136 442 9.4352 11.7940 17.6910 5.5708 Constraint 122 535 8.6109 10.7636 16.1454 5.5479 Constraint 391 511 9.1153 11.3941 17.0912 5.5478 Constraint 136 237 9.1657 11.4571 17.1856 5.5256 Constraint 104 272 9.5935 11.9919 17.9878 5.4828 Constraint 104 190 8.1834 10.2292 15.3438 5.4828 Constraint 421 590 7.7482 9.6852 14.5278 5.4549 Constraint 297 412 9.0188 11.2734 16.9102 5.3744 Constraint 267 355 9.0545 11.3181 16.9772 5.2993 Constraint 122 391 8.1649 10.2061 15.3092 5.2920 Constraint 237 599 3.9178 4.8972 7.3458 5.1683 Constraint 226 599 7.1801 8.9751 13.4627 5.1683 Constraint 221 599 6.7460 8.4325 12.6488 5.1683 Constraint 210 590 7.9284 9.9106 14.8658 5.1683 Constraint 201 599 6.5461 8.1827 12.2740 5.1683 Constraint 122 552 9.2933 11.6166 17.4249 5.1431 Constraint 104 535 9.7741 12.2176 18.3265 5.0932 Constraint 480 577 7.3762 9.2202 13.8303 5.0913 Constraint 355 599 8.3881 10.4851 15.7276 5.0067 Constraint 210 467 9.8590 12.3237 18.4855 5.0051 Constraint 128 467 8.4502 10.5628 15.8441 5.0051 Constraint 104 467 9.9312 12.4140 18.6210 5.0051 Constraint 153 412 9.8672 12.3341 18.5011 4.9920 Constraint 144 429 9.7789 12.2236 18.3354 4.9920 Constraint 489 604 8.3249 10.4062 15.6093 4.9908 Constraint 473 651 9.4760 11.8450 17.7675 4.9904 Constraint 473 636 6.8493 8.5616 12.8425 4.9904 Constraint 467 636 8.4920 10.6150 15.9226 4.9904 Constraint 404 657 8.2415 10.3018 15.4527 4.9904 Constraint 404 651 8.5264 10.6580 15.9870 4.9904 Constraint 404 636 8.8537 11.0672 16.6007 4.9904 Constraint 399 651 9.4730 11.8412 17.7618 4.9904 Constraint 399 636 9.2793 11.5992 17.3988 4.9904 Constraint 399 629 5.7727 7.2159 10.8238 4.9904 Constraint 391 629 8.9083 11.1354 16.7031 4.9904 Constraint 382 651 8.6567 10.8208 16.2312 4.9904 Constraint 382 629 7.5102 9.3878 14.0817 4.9904 Constraint 382 622 8.7552 10.9440 16.4160 4.9904 Constraint 375 657 7.6568 9.5711 14.3566 4.9904 Constraint 375 651 5.6128 7.0160 10.5241 4.9904 Constraint 375 644 8.0069 10.0087 15.0130 4.9904 Constraint 375 636 7.9973 9.9966 14.9949 4.9904 Constraint 375 604 7.3620 9.2025 13.8038 4.9904 Constraint 375 599 4.3347 5.4184 8.1276 4.9904 Constraint 368 651 9.1111 11.3888 17.0833 4.9904 Constraint 368 629 7.8009 9.7511 14.6266 4.9904 Constraint 368 599 6.4878 8.1097 12.1645 4.9904 Constraint 368 590 8.8934 11.1168 16.6752 4.9904 Constraint 360 629 8.3166 10.3957 15.5936 4.9904 Constraint 360 622 8.3688 10.4611 15.6916 4.9904 Constraint 360 599 5.7985 7.2481 10.8721 4.9904 Constraint 360 590 7.8061 9.7576 14.6365 4.9904 Constraint 355 622 9.8485 12.3107 18.4660 4.9904 Constraint 355 590 9.2739 11.5923 17.3885 4.9904 Constraint 314 571 8.1418 10.1773 15.2659 4.9654 Constraint 382 590 9.0352 11.2940 16.9411 4.9538 Constraint 412 622 9.1982 11.4978 17.2466 4.9494 Constraint 210 636 8.4068 10.5085 15.7627 4.9462 Constraint 201 636 8.4016 10.5020 15.7529 4.9462 Constraint 176 636 8.8820 11.1025 16.6537 4.9462 Constraint 297 599 9.5873 11.9841 17.9761 4.9416 Constraint 272 599 9.0808 11.3510 17.0265 4.9416 Constraint 210 368 9.5562 11.9452 17.9178 4.9120 Constraint 88 303 8.4457 10.5571 15.8357 4.9063 Constraint 88 297 8.9593 11.1991 16.7986 4.9063 Constraint 303 435 7.1024 8.8780 13.3170 4.8967 Constraint 297 435 8.7877 10.9846 16.4769 4.8967 Constraint 303 442 9.3050 11.6313 17.4469 4.8727 Constraint 113 604 8.3987 10.4983 15.7475 4.8549 Constraint 113 467 9.0841 11.3552 17.0328 4.8099 Constraint 467 577 7.3787 9.2234 13.8350 4.8035 Constraint 429 577 7.7205 9.6506 14.4760 4.8035 Constraint 404 577 7.5156 9.3945 14.0917 4.7881 Constraint 221 622 10.0151 12.5188 18.7783 4.7744 Constraint 169 622 7.7994 9.7492 14.6238 4.7744 Constraint 169 613 9.0549 11.3186 16.9779 4.7744 Constraint 169 629 6.0695 7.5869 11.3803 4.7641 Constraint 237 590 6.4944 8.1180 12.1770 4.7635 Constraint 226 590 10.2957 12.8696 19.3043 4.7635 Constraint 96 267 10.0884 12.6105 18.9157 4.7075 Constraint 96 250 8.9332 11.1665 16.7497 4.7075 Constraint 442 613 6.5871 8.2339 12.3508 4.6478 Constraint 404 590 6.3940 7.9925 11.9887 4.6360 Constraint 136 577 9.2902 11.6127 17.4191 4.5929 Constraint 128 577 7.7914 9.7392 14.6088 4.5929 Constraint 497 629 7.3720 9.2149 13.8224 4.5842 Constraint 489 629 8.5846 10.7307 16.0961 4.5842 Constraint 210 577 7.1799 8.9749 13.4624 4.5660 Constraint 201 577 9.6781 12.0976 18.1464 4.5660 Constraint 297 404 6.6814 8.3518 12.5276 4.5224 Constraint 435 599 8.4904 10.6130 15.9195 4.4702 Constraint 128 585 8.9510 11.1888 16.7832 4.4501 Constraint 429 590 5.1577 6.4471 9.6707 4.4385 Constraint 144 535 8.1954 10.2443 15.3664 4.4267 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 259 599 6.4584 8.0730 12.1095 4.3587 Constraint 250 599 7.0488 8.8109 13.2164 4.3587 Constraint 242 590 5.7226 7.1532 10.7298 4.3587 Constraint 322 473 9.0236 11.2795 16.9192 4.3581 Constraint 113 519 9.6606 12.0757 18.1136 4.3335 Constraint 88 267 9.7619 12.2023 18.3035 4.3106 Constraint 442 629 6.1197 7.6496 11.4744 4.2330 Constraint 442 604 5.0805 6.3507 9.5260 4.2330 Constraint 527 599 7.6683 9.5854 14.3780 4.2288 Constraint 96 535 7.1995 8.9994 13.4990 4.2144 Constraint 88 535 4.6155 5.7693 8.6540 4.2144 Constraint 104 391 9.4386 11.7983 17.6974 4.2099 Constraint 88 341 8.3891 10.4864 15.7296 4.2087 Constraint 104 604 7.3774 9.2218 13.8326 4.1881 Constraint 104 599 8.0416 10.0520 15.0780 4.1881 Constraint 144 226 10.2319 12.7899 19.1848 4.1801 Constraint 242 341 9.6323 12.0403 18.0605 4.1778 Constraint 489 577 8.2118 10.2647 15.3971 4.1095 Constraint 480 571 7.2944 9.1179 13.6769 4.0913 Constraint 442 519 9.3326 11.6657 17.4986 4.0333 Constraint 267 382 9.8938 12.3672 18.5509 4.0162 Constraint 88 375 9.1606 11.4507 17.1761 4.0081 Constraint 382 604 10.3792 12.9740 19.4610 4.0067 Constraint 527 622 7.6693 9.5866 14.3800 3.9921 Constraint 169 497 9.8218 12.2773 18.4159 3.9913 Constraint 136 497 9.0392 11.2990 16.9484 3.9913 Constraint 391 622 10.0759 12.5949 18.8923 3.9904 Constraint 368 604 10.0726 12.5908 18.8862 3.9904 Constraint 113 399 8.9027 11.1284 16.6925 3.9899 Constraint 497 604 7.7369 9.6711 14.5067 3.9890 Constraint 391 571 6.0137 7.5172 11.2758 3.9855 Constraint 375 577 8.5375 10.6719 16.0079 3.9855 Constraint 368 577 8.4518 10.5648 15.8472 3.9855 Constraint 368 571 7.6525 9.5656 14.3484 3.9855 Constraint 341 552 10.2789 12.8486 19.2729 3.9844 Constraint 391 604 9.5619 11.9523 17.9285 3.9701 Constraint 330 577 8.4878 10.6097 15.9146 3.9654 Constraint 322 571 9.7276 12.1595 18.2392 3.9654 Constraint 314 585 7.1483 8.9354 13.4031 3.9654 Constraint 303 577 7.5488 9.4360 14.1541 3.9654 Constraint 303 571 9.6071 12.0088 18.0132 3.9654 Constraint 285 577 7.7267 9.6584 14.4876 3.9654 Constraint 322 636 9.7003 12.1253 18.1880 3.9647 Constraint 330 676 7.8933 9.8666 14.7999 3.9616 Constraint 322 668 8.9129 11.1411 16.7116 3.9616 Constraint 322 644 8.8373 11.0466 16.5699 3.9616 Constraint 297 668 8.5461 10.6826 16.0239 3.9616 Constraint 176 657 8.8945 11.1181 16.6771 3.9616 Constraint 341 429 7.6862 9.6077 14.4115 3.9615 Constraint 341 412 7.8646 9.8308 14.7462 3.9615 Constraint 341 404 7.0242 8.7802 13.1703 3.9615 Constraint 314 590 8.4369 10.5461 15.8191 3.9538 Constraint 292 590 9.1348 11.4185 17.1278 3.9538 Constraint 285 599 8.2706 10.3382 15.5073 3.9538 Constraint 267 599 9.7545 12.1931 18.2896 3.9538 Constraint 259 590 8.4681 10.5851 15.8777 3.9538 Constraint 250 590 8.1373 10.1716 15.2574 3.9538 Constraint 237 636 8.9184 11.1480 16.7219 3.9538 Constraint 221 590 9.8456 12.3070 18.4605 3.9538 Constraint 190 604 10.3483 12.9353 19.4030 3.9461 Constraint 272 604 10.0695 12.5869 18.8804 3.9416 Constraint 88 272 9.6318 12.0398 18.0597 3.8900 Constraint 88 412 9.8726 12.3407 18.5111 3.8875 Constraint 668 742 8.0642 10.0802 15.1203 3.8557 Constraint 69 404 9.2315 11.5394 17.3091 3.8531 Constraint 88 552 7.5209 9.4011 14.1016 3.8096 Constraint 88 544 7.9201 9.9002 14.8503 3.8096 Constraint 461 629 8.2972 10.3715 15.5572 3.8035 Constraint 421 577 7.6177 9.5221 14.2831 3.8035 Constraint 221 527 9.5928 11.9910 17.9865 3.7876 Constraint 190 314 9.7402 12.1753 18.2629 3.7854 Constraint 190 303 10.2320 12.7900 19.1850 3.7854 Constraint 136 585 8.6800 10.8500 16.2750 3.7833 Constraint 182 577 7.8763 9.8453 14.7680 3.7564 Constraint 122 604 7.2709 9.0887 13.6330 3.6683 Constraint 122 599 7.6473 9.5591 14.3386 3.6683 Constraint 144 599 9.8261 12.2827 18.4240 3.6678 Constraint 412 590 6.5704 8.2130 12.3195 3.6677 Constraint 435 604 6.3378 7.9223 11.8835 3.6600 Constraint 391 585 8.2307 10.2884 15.4326 3.6523 Constraint 435 622 6.0699 7.5873 11.3810 3.6315 Constraint 435 613 5.4211 6.7764 10.1646 3.6315 Constraint 497 622 8.3422 10.4278 15.6417 3.5874 Constraint 527 629 7.7048 9.6310 14.4465 3.5873 Constraint 161 599 9.4206 11.7758 17.6637 3.5846 Constraint 442 599 6.6175 8.2719 12.4079 3.4702 Constraint 442 590 8.8959 11.1199 16.6799 3.4702 Constraint 161 544 9.7700 12.2125 18.3188 3.4267 Constraint 153 535 8.3365 10.4206 15.6309 3.4267 Constraint 144 571 9.6925 12.1156 18.1734 3.4267 Constraint 144 544 8.6042 10.7552 16.1328 3.4267 Constraint 497 599 7.5294 9.4118 14.1177 3.4160 Constraint 497 577 8.1690 10.2113 15.3169 3.4096 Constraint 80 535 7.0981 8.8727 13.3090 3.4048 Constraint 113 577 8.8979 11.1223 16.6835 3.4015 Constraint 88 577 8.1495 10.1868 15.2802 3.4015 Constraint 497 585 8.1509 10.1886 15.2829 3.3900 Constraint 449 629 8.4063 10.5078 15.7617 3.3765 Constraint 449 604 8.8616 11.0769 16.6154 3.3765 Constraint 210 644 8.2418 10.3022 15.4533 3.3740 Constraint 201 644 8.6159 10.7698 16.1548 3.3740 Constraint 190 668 9.3314 11.6643 17.4964 3.3740 Constraint 176 644 7.0791 8.8488 13.2732 3.3740 Constraint 449 622 6.3654 7.9568 11.9352 3.3479 Constraint 144 577 8.7754 10.9693 16.4540 3.3345 Constraint 297 489 9.8361 12.2951 18.4427 3.3076 Constraint 96 382 9.9868 12.4835 18.7252 3.2918 Constraint 161 604 7.2200 9.0250 13.5375 3.2635 Constraint 449 552 9.2180 11.5225 17.2838 3.2392 Constraint 104 590 9.2638 11.5797 17.3696 3.1876 Constraint 104 585 7.2247 9.0309 13.5464 3.1876 Constraint 104 577 6.4901 8.1126 12.1689 3.1876 Constraint 279 435 9.8163 12.2704 18.4056 3.1096 Constraint 480 557 8.8157 11.0196 16.5294 3.0932 Constraint 473 557 9.1963 11.4953 17.2430 3.0932 Constraint 473 552 7.8947 9.8684 14.8026 3.0932 Constraint 467 552 8.1913 10.2391 15.3586 3.0932 Constraint 461 552 7.2813 9.1016 13.6524 3.0932 Constraint 104 435 10.2558 12.8197 19.2296 3.0913 Constraint 489 585 8.5674 10.7093 16.0639 3.0900 Constraint 80 237 9.6391 12.0489 18.0733 3.0886 Constraint 144 604 7.8189 9.7737 14.6605 3.0726 Constraint 330 404 6.7153 8.3942 12.5913 3.0170 Constraint 128 604 5.9158 7.3948 11.0922 3.0016 Constraint 128 599 6.0804 7.6005 11.4008 3.0016 Constraint 96 599 6.8554 8.5692 12.8538 3.0016 Constraint 399 577 6.3107 7.8883 11.8325 3.0009 Constraint 375 552 7.9253 9.9066 14.8599 3.0009 Constraint 368 557 8.5536 10.6920 16.0380 3.0009 Constraint 360 552 7.7488 9.6860 14.5290 3.0009 Constraint 153 527 9.7272 12.1590 18.2385 3.0000 Constraint 136 527 10.2015 12.7519 19.1278 3.0000 Constraint 113 552 8.6526 10.8158 16.2237 3.0000 Constraint 113 535 7.6856 9.6070 14.4105 3.0000 Constraint 80 552 9.5868 11.9835 17.9752 3.0000 Constraint 80 544 10.0944 12.6180 18.9270 3.0000 Constraint 58 350 9.8494 12.3117 18.4676 3.0000 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 322 10.2102 12.7628 19.1442 3.0000 Constraint 51 122 8.9814 11.2268 16.8402 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 153 314 9.8848 12.3561 18.5341 3.0000 Constraint 144 322 10.0194 12.5243 18.7865 3.0000 Constraint 136 330 9.9453 12.4316 18.6474 3.0000 Constraint 80 429 8.8613 11.0766 16.6149 3.0000 Constraint 473 644 9.0047 11.2559 16.8839 2.9981 Constraint 88 604 8.5160 10.6450 15.9675 2.9967 Constraint 136 341 7.0862 8.8577 13.2866 2.9942 Constraint 122 341 9.7213 12.1516 18.2274 2.9942 Constraint 113 341 8.2299 10.2874 15.4311 2.9942 Constraint 104 285 9.8366 12.2958 18.4437 2.9942 Constraint 104 259 9.7689 12.2112 18.3168 2.9942 Constraint 519 622 8.7912 10.9890 16.4835 2.9922 Constraint 237 322 10.2816 12.8520 19.2780 2.9918 Constraint 88 368 10.2683 12.8354 19.2531 2.9918 Constraint 169 350 9.3723 11.7153 17.5730 2.9886 Constraint 153 272 10.2427 12.8033 19.2050 2.9886 Constraint 391 577 4.8704 6.0880 9.1321 2.9855 Constraint 382 585 8.8013 11.0017 16.5025 2.9855 Constraint 382 577 7.6899 9.6124 14.4186 2.9855 Constraint 368 585 10.0566 12.5707 18.8561 2.9855 Constraint 350 577 10.2282 12.7853 19.1779 2.9855 Constraint 429 636 9.1824 11.4779 17.2169 2.9846 Constraint 330 706 8.0066 10.0083 15.0124 2.9769 Constraint 330 668 7.7723 9.7154 14.5731 2.9769 Constraint 330 644 9.4344 11.7930 17.6895 2.9769 Constraint 297 706 8.3589 10.4487 15.6730 2.9769 Constraint 292 622 10.3993 12.9991 19.4987 2.9769 Constraint 279 399 10.1745 12.7181 19.0771 2.9769 Constraint 279 368 9.9302 12.4127 18.6191 2.9769 Constraint 267 399 10.2741 12.8427 19.2640 2.9769 Constraint 250 622 9.8247 12.2809 18.4214 2.9769 Constraint 182 706 9.1708 11.4635 17.1953 2.9769 Constraint 169 636 5.8374 7.2968 10.9451 2.9769 Constraint 599 668 9.6238 12.0298 18.0447 2.9739 Constraint 330 651 9.2403 11.5503 17.3255 2.9724 Constraint 322 676 8.3323 10.4153 15.6230 2.9692 Constraint 322 651 9.3177 11.6471 17.4707 2.9692 Constraint 297 644 9.6988 12.1235 18.1852 2.9692 Constraint 190 644 9.3636 11.7045 17.5568 2.9692 Constraint 182 676 8.7952 10.9940 16.4910 2.9692 Constraint 182 644 7.1838 8.9798 13.4697 2.9692 Constraint 382 571 6.1606 7.7007 11.5511 2.9692 Constraint 375 571 6.6112 8.2640 12.3960 2.9692 Constraint 360 577 7.0059 8.7574 13.1361 2.9692 Constraint 360 571 6.9815 8.7269 13.0903 2.9692 Constraint 341 449 9.4944 11.8680 17.8020 2.9634 Constraint 272 449 10.2754 12.8442 19.2663 2.9634 Constraint 210 341 10.3340 12.9175 19.3763 2.9634 Constraint 297 368 10.2128 12.7660 19.1490 2.9118 Constraint 237 467 8.9897 11.2372 16.8557 2.9118 Constraint 144 557 8.6757 10.8446 16.2670 2.9028 Constraint 182 399 9.2811 11.6014 17.4021 2.8709 Constraint 80 303 9.7766 12.2207 18.3311 2.8367 Constraint 69 527 6.9775 8.7219 13.0829 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 69 412 10.3436 12.9295 19.3943 2.8367 Constraint 69 210 10.0878 12.6097 18.9145 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 58 399 10.0653 12.5816 18.8724 2.8367 Constraint 467 622 8.9329 11.1661 16.7492 2.8035 Constraint 461 622 7.2822 9.1028 13.6541 2.8035 Constraint 449 599 6.2591 7.8238 11.7357 2.8035 Constraint 449 577 8.8687 11.0859 16.6288 2.8035 Constraint 435 577 9.4935 11.8669 17.8003 2.8035 Constraint 279 412 10.2597 12.8247 19.2370 2.8035 Constraint 279 404 8.1561 10.1951 15.2926 2.8035 Constraint 473 577 3.9527 4.9408 7.4113 2.7872 Constraint 461 613 8.4302 10.5377 15.8066 2.7872 Constraint 113 657 8.6297 10.7871 16.1806 2.7852 Constraint 104 657 8.1524 10.1905 15.2858 2.7852 Constraint 322 435 8.6350 10.7938 16.1907 2.7795 Constraint 237 585 9.1171 11.3963 17.0945 2.7788 Constraint 237 577 7.7052 9.6315 14.4472 2.7788 Constraint 210 585 8.4358 10.5448 15.8171 2.7788 Constraint 449 613 7.2424 9.0531 13.5796 2.7750 Constraint 113 442 10.2633 12.8292 19.2438 2.7600 Constraint 599 698 8.9064 11.1330 16.6995 2.7363 Constraint 297 375 8.3638 10.4548 15.6822 2.7352 Constraint 292 375 9.9718 12.4648 18.6972 2.7352 Constraint 279 375 9.3027 11.6283 17.4425 2.7352 Constraint 404 585 7.7586 9.6982 14.5474 2.6677 Constraint 113 585 7.6468 9.5585 14.3377 2.6629 Constraint 88 585 8.7888 10.9860 16.4790 2.6629 Constraint 267 330 10.2800 12.8499 19.2749 2.6582 Constraint 421 552 9.3675 11.7094 17.5641 2.6498 Constraint 421 544 9.1767 11.4709 17.2063 2.6498 Constraint 242 585 7.7008 9.6260 14.4390 2.6359 Constraint 429 552 8.9636 11.2045 16.8068 2.6335 Constraint 176 577 8.4986 10.6233 15.9349 2.5968 Constraint 169 577 7.4066 9.2583 13.8874 2.5968 Constraint 161 577 7.7613 9.7016 14.5524 2.5968 Constraint 122 577 6.9995 8.7493 13.1240 2.5968 Constraint 96 577 8.6593 10.8241 16.2362 2.5968 Constraint 489 622 8.4680 10.5850 15.8774 2.5893 Constraint 489 613 8.6257 10.7821 16.1732 2.5893 Constraint 519 629 8.9115 11.1394 16.7091 2.5874 Constraint 511 629 8.5935 10.7419 16.1128 2.5874 Constraint 272 412 9.9744 12.4681 18.7021 2.5709 Constraint 210 382 10.3953 12.9941 19.4912 2.5709 Constraint 190 412 10.0692 12.5865 18.8797 2.5709 Constraint 176 412 10.0071 12.5089 18.7633 2.5709 Constraint 391 519 10.1318 12.6648 18.9972 2.5479 Constraint 242 535 10.0132 12.5166 18.7748 2.5479 Constraint 242 519 7.4781 9.3476 14.0214 2.5479 Constraint 242 511 7.2780 9.0975 13.6463 2.5479 Constraint 136 226 9.5431 11.9289 17.8933 2.5369 Constraint 442 552 9.8415 12.3019 18.4529 2.4623 Constraint 442 535 8.8792 11.0990 16.6486 2.4623 Constraint 435 590 8.1920 10.2401 15.3601 2.4539 Constraint 511 599 8.9321 11.1651 16.7476 2.4192 Constraint 497 590 9.0524 11.3156 16.9733 2.4179 Constraint 489 599 7.6900 9.6125 14.4187 2.4179 Constraint 489 590 9.8725 12.3407 18.5110 2.4179 Constraint 590 657 9.5278 11.9097 17.8646 2.4010 Constraint 176 676 9.4706 11.8383 17.7574 2.3894 Constraint 169 668 8.8209 11.0261 16.5392 2.3894 Constraint 169 644 7.3054 9.1318 13.6977 2.3894 Constraint 176 651 9.3918 11.7398 17.6097 2.3817 Constraint 144 552 9.5329 11.9161 17.8742 2.3334 Constraint 629 706 8.2403 10.3004 15.4506 2.3315 Constraint 622 706 9.0959 11.3699 17.0548 2.3315 Constraint 622 698 10.1424 12.6780 19.0171 2.3315 Constraint 613 687 9.4670 11.8337 17.7506 2.3315 Constraint 604 706 9.7835 12.2294 18.3440 2.3315 Constraint 604 687 7.5375 9.4218 14.1328 2.3315 Constraint 599 706 6.5315 8.1644 12.2466 2.3315 Constraint 599 687 6.3982 7.9977 11.9966 2.3315 Constraint 577 706 9.1003 11.3754 17.0630 2.3315 Constraint 571 706 8.9503 11.1879 16.7818 2.3315 Constraint 442 511 8.3613 10.4517 15.6775 2.3144 Constraint 519 599 8.1665 10.2081 15.3121 2.2308 Constraint 314 480 8.8394 11.0493 16.5740 2.2125 Constraint 128 644 9.0555 11.3194 16.9791 2.1920 Constraint 122 629 7.0419 8.8024 13.2036 2.1920 Constraint 96 622 8.6153 10.7691 16.1537 2.1920 Constraint 96 604 7.4063 9.2578 13.8867 2.1920 Constraint 88 599 8.9082 11.1353 16.7029 2.1920 Constraint 128 404 9.9255 12.4069 18.6103 2.1895 Constraint 104 412 9.6334 12.0417 18.0626 2.1895 Constraint 449 535 8.2639 10.3299 15.4949 2.1623 Constraint 355 651 8.4145 10.5181 15.7771 2.1459 Constraint 153 552 10.1294 12.6617 18.9926 2.1431 Constraint 489 571 8.5893 10.7366 16.1049 2.0932 Constraint 467 544 7.3150 9.1438 13.7157 2.0932 Constraint 461 557 9.7020 12.1276 18.1913 2.0932 Constraint 461 544 7.4535 9.3169 13.9754 2.0932 Constraint 314 467 9.6929 12.1161 18.1742 2.0932 Constraint 303 467 9.1620 11.4525 17.1787 2.0932 Constraint 297 480 8.8569 11.0712 16.6068 2.0932 Constraint 297 473 7.4525 9.3156 13.9734 2.0932 Constraint 297 467 6.0963 7.6204 11.4305 2.0932 Constraint 297 461 9.0964 11.3705 17.0558 2.0932 Constraint 292 473 7.7865 9.7331 14.5997 2.0932 Constraint 292 467 8.5327 10.6659 15.9989 2.0932 Constraint 279 429 8.3726 10.4658 15.6986 2.0932 Constraint 272 473 9.3970 11.7463 17.6194 2.0932 Constraint 272 467 9.3005 11.6257 17.4385 2.0932 Constraint 272 429 9.3583 11.6979 17.5469 2.0932 Constraint 221 473 10.3193 12.8991 19.3486 2.0932 Constraint 210 473 7.2230 9.0287 13.5431 2.0932 Constraint 201 473 9.7332 12.1665 18.2497 2.0932 Constraint 182 480 8.3941 10.4926 15.7389 2.0932 Constraint 182 473 6.9213 8.6517 12.9775 2.0932 Constraint 182 467 8.3746 10.4682 15.7024 2.0932 Constraint 176 473 9.1772 11.4715 17.2073 2.0932 Constraint 169 535 8.8325 11.0406 16.5610 2.0932 Constraint 169 480 8.8303 11.0378 16.5568 2.0932 Constraint 169 473 6.4455 8.0569 12.0853 2.0932 Constraint 169 467 10.1525 12.6906 19.0359 2.0932 Constraint 161 535 7.2072 9.0090 13.5135 2.0932 Constraint 161 497 9.8602 12.3253 18.4880 2.0932 Constraint 161 480 7.1619 8.9524 13.4285 2.0932 Constraint 161 473 7.3339 9.1674 13.7511 2.0932 Constraint 161 467 9.9677 12.4596 18.6894 2.0932 Constraint 153 473 9.6864 12.1081 18.1621 2.0932 Constraint 144 480 10.1906 12.7382 19.1073 2.0932 Constraint 144 473 9.3012 11.6265 17.4398 2.0932 Constraint 136 535 9.2858 11.6072 17.4109 2.0932 Constraint 136 473 8.5404 10.6755 16.0133 2.0932 Constraint 128 535 8.2740 10.3425 15.5137 2.0932 Constraint 128 480 8.8491 11.0614 16.5921 2.0932 Constraint 113 473 9.8646 12.3308 18.4962 2.0932 Constraint 104 473 6.9064 8.6330 12.9496 2.0932 Constraint 122 590 9.4821 11.8527 17.7790 2.0721 Constraint 122 585 7.7404 9.6755 14.5133 2.0721 Constraint 330 412 8.6936 10.8670 16.3004 2.0189 Constraint 421 571 8.2589 10.3236 15.4854 2.0163 Constraint 412 571 8.9100 11.1374 16.7062 2.0163 Constraint 399 552 8.8755 11.0944 16.6416 2.0163 Constraint 355 571 8.3311 10.4139 15.6208 2.0163 Constraint 442 577 8.0290 10.0362 15.0543 2.0144 Constraint 391 557 6.9000 8.6250 12.9376 2.0009 Constraint 391 552 4.4313 5.5392 8.3088 2.0009 Constraint 382 557 7.3366 9.1708 13.7562 2.0009 Constraint 382 552 5.6671 7.0839 10.6258 2.0009 Constraint 368 552 5.4283 6.7854 10.1781 2.0009 Constraint 355 552 7.9621 9.9526 14.9289 2.0009 Constraint 69 467 10.2606 12.8258 19.2387 1.9999 Constraint 497 657 7.2598 9.0747 13.6121 1.9981 Constraint 497 644 9.0724 11.3405 17.0108 1.9981 Constraint 480 668 8.7005 10.8757 16.3135 1.9981 Constraint 480 657 8.5356 10.6695 16.0043 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 473 668 6.9545 8.6931 13.0397 1.9981 Constraint 557 629 8.2887 10.3609 15.5413 1.9980 Constraint 544 629 9.4176 11.7720 17.6580 1.9980 Constraint 544 622 9.3960 11.7451 17.6176 1.9980 Constraint 629 713 7.2997 9.1246 13.6870 1.9962 Constraint 341 604 8.8639 11.0798 16.6197 1.9962 Constraint 341 599 8.8635 11.0793 16.6190 1.9962 Constraint 341 590 7.7418 9.6772 14.5158 1.9962 Constraint 341 585 5.2670 6.5837 9.8755 1.9962 Constraint 341 577 4.9150 6.1438 9.2157 1.9962 Constraint 341 571 6.0004 7.5005 11.2508 1.9962 Constraint 330 585 10.0534 12.5668 18.8502 1.9962 Constraint 330 571 7.3487 9.1859 13.7788 1.9962 Constraint 104 571 8.7676 10.9595 16.4392 1.9962 Constraint 527 613 8.4197 10.5247 15.7870 1.9941 Constraint 527 604 6.4163 8.0204 12.0306 1.9941 Constraint 330 720 9.5377 11.9221 17.8831 1.9846 Constraint 330 713 7.5067 9.3834 14.0750 1.9846 Constraint 330 687 9.7457 12.1821 18.2731 1.9846 Constraint 303 599 10.2611 12.8264 19.2396 1.9846 Constraint 297 713 9.0889 11.3611 17.0417 1.9846 Constraint 297 676 7.5566 9.4458 14.1687 1.9846 Constraint 292 676 10.3952 12.9940 19.4911 1.9846 Constraint 285 590 9.8815 12.3519 18.5278 1.9846 Constraint 279 706 10.3991 12.9989 19.4983 1.9846 Constraint 272 706 9.7943 12.2429 18.3643 1.9846 Constraint 272 668 9.6116 12.0145 18.0218 1.9846 Constraint 176 706 10.2032 12.7540 19.1310 1.9846 Constraint 404 571 5.4508 6.8135 10.2203 1.9846 Constraint 399 571 4.8254 6.0318 9.0477 1.9846 Constraint 375 557 6.5926 8.2407 12.3610 1.9846 Constraint 360 557 7.7178 9.6473 14.4709 1.9846 Constraint 585 657 9.1964 11.4955 17.2432 1.9827 Constraint 314 557 8.1862 10.2328 15.3492 1.9827 Constraint 330 636 8.2794 10.3492 15.5239 1.9801 Constraint 297 636 8.9892 11.2365 16.8548 1.9801 Constraint 330 657 7.8760 9.8450 14.7674 1.9769 Constraint 322 657 7.2372 9.0465 13.5697 1.9769 Constraint 297 657 7.8177 9.7722 14.6583 1.9769 Constraint 272 657 9.5760 11.9699 17.9549 1.9769 Constraint 190 657 9.6770 12.0963 18.1444 1.9769 Constraint 182 657 6.5888 8.2360 12.3540 1.9769 Constraint 527 644 9.9338 12.4172 18.6259 1.9759 Constraint 511 622 9.0621 11.3277 16.9915 1.9759 Constraint 303 585 9.8953 12.3692 18.5538 1.9692 Constraint 292 585 7.8920 9.8650 14.7975 1.9692 Constraint 292 571 7.9270 9.9088 14.8632 1.9692 Constraint 285 585 9.5667 11.9584 17.9376 1.9692 Constraint 285 571 7.7020 9.6275 14.4412 1.9692 Constraint 279 577 9.0086 11.2608 16.8912 1.9692 Constraint 272 577 8.3504 10.4380 15.6569 1.9692 Constraint 267 577 8.2086 10.2607 15.3911 1.9692 Constraint 267 571 9.7471 12.1839 18.2759 1.9692 Constraint 259 585 8.9977 11.2472 16.8708 1.9692 Constraint 259 577 4.8894 6.1118 9.1677 1.9692 Constraint 259 571 5.6666 7.0833 10.6250 1.9692 Constraint 250 577 7.4155 9.2694 13.9041 1.9692 Constraint 250 571 5.3243 6.6553 9.9830 1.9692 Constraint 242 577 3.8055 4.7569 7.1353 1.9692 Constraint 242 571 3.7085 4.6356 6.9534 1.9692 Constraint 237 571 6.7731 8.4663 12.6995 1.9692 Constraint 226 577 9.1179 11.3974 17.0961 1.9692 Constraint 226 571 9.2552 11.5690 17.3535 1.9692 Constraint 221 585 10.3325 12.9156 19.3734 1.9692 Constraint 221 577 6.6368 8.2960 12.4440 1.9692 Constraint 221 571 8.3847 10.4809 15.7213 1.9692 Constraint 210 571 7.8219 9.7774 14.6661 1.9692 Constraint 190 577 10.3828 12.9786 19.4678 1.9692 Constraint 136 272 10.3355 12.9194 19.3790 1.9412 Constraint 136 221 10.0851 12.6063 18.9095 1.9412 Constraint 292 461 10.0698 12.5873 18.8810 1.8981 Constraint 182 497 10.3738 12.9672 19.4508 1.8981 Constraint 153 604 6.8323 8.5404 12.8106 1.8812 Constraint 153 599 7.8215 9.7769 14.6653 1.8812 Constraint 144 636 8.6981 10.8727 16.3090 1.8582 Constraint 144 629 8.4161 10.5201 15.7802 1.8582 Constraint 144 585 9.0306 11.2883 16.9324 1.8582 Constraint 80 292 10.0053 12.5066 18.7598 1.8189 Constraint 552 622 9.4646 11.8308 17.7462 1.8077 Constraint 104 557 8.3254 10.4068 15.6102 1.8077 Constraint 292 552 8.9778 11.2222 16.8333 1.7942 Constraint 259 552 9.0173 11.2716 16.9074 1.7942 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 242 552 7.5013 9.3766 14.0649 1.7942 Constraint 210 557 9.6891 12.1114 18.1671 1.7942 Constraint 210 552 8.3974 10.4968 15.7451 1.7942 Constraint 467 590 5.2659 6.5824 9.8736 1.7872 Constraint 461 644 10.2116 12.7645 19.1468 1.7872 Constraint 461 590 3.3842 4.2303 6.3454 1.7872 Constraint 449 651 8.8351 11.0439 16.5658 1.7872 Constraint 449 644 9.9363 12.4204 18.6306 1.7872 Constraint 449 590 6.2744 7.8430 11.7645 1.7872 Constraint 449 585 9.9539 12.4424 18.6635 1.7872 Constraint 322 622 10.3515 12.9394 19.4090 1.7872 Constraint 322 467 9.4528 11.8160 17.7241 1.7872 Constraint 272 404 10.1868 12.7334 19.1002 1.7872 Constraint 182 404 8.1847 10.2308 15.3462 1.7872 Constraint 161 636 9.0330 11.2913 16.9369 1.7872 Constraint 161 629 8.9436 11.1795 16.7692 1.7872 Constraint 161 613 9.6248 12.0310 18.0466 1.7872 Constraint 161 585 7.8387 9.7984 14.6975 1.7872 Constraint 136 657 7.1117 8.8896 13.3344 1.7872 Constraint 136 636 5.7969 7.2462 10.8693 1.7872 Constraint 136 629 4.6170 5.7712 8.6569 1.7872 Constraint 136 604 4.8997 6.1246 9.1869 1.7872 Constraint 136 599 7.5344 9.4180 14.1270 1.7872 Constraint 128 657 8.4148 10.5186 15.7778 1.7872 Constraint 128 651 8.5836 10.7295 16.0943 1.7872 Constraint 128 636 6.6865 8.3581 12.5372 1.7872 Constraint 128 629 4.3395 5.4244 8.1365 1.7872 Constraint 128 622 7.2867 9.1084 13.6626 1.7872 Constraint 128 613 7.3990 9.2487 13.8731 1.7872 Constraint 128 590 8.3184 10.3980 15.5969 1.7872 Constraint 122 657 9.9610 12.4513 18.6769 1.7872 Constraint 122 636 9.3904 11.7381 17.6071 1.7872 Constraint 113 636 8.6219 10.7774 16.1661 1.7872 Constraint 113 629 5.6900 7.1126 10.6688 1.7872 Constraint 113 599 8.4574 10.5717 15.8576 1.7872 Constraint 104 651 6.5019 8.1274 12.1911 1.7872 Constraint 104 644 9.2128 11.5160 17.2739 1.7872 Constraint 104 636 7.6828 9.6035 14.4053 1.7872 Constraint 104 629 3.8781 4.8477 7.2715 1.7872 Constraint 104 622 6.9782 8.7228 13.0841 1.7872 Constraint 96 651 8.8209 11.0261 16.5391 1.7872 Constraint 96 629 5.9742 7.4678 11.2016 1.7872 Constraint 88 651 10.3560 12.9450 19.4175 1.7872 Constraint 88 629 8.0104 10.0130 15.0195 1.7872 Constraint 330 435 8.0328 10.0410 15.0616 1.7189 Constraint 96 279 10.1966 12.7458 19.1187 1.7189 Constraint 442 585 6.5729 8.2162 12.3243 1.6831 Constraint 435 585 8.1151 10.1439 15.2158 1.6831 Constraint 421 585 7.5840 9.4800 14.2200 1.6831 Constraint 412 585 6.9833 8.7291 13.0936 1.6831 Constraint 122 613 9.1287 11.4108 17.1162 1.6673 Constraint 599 713 6.1760 7.7200 11.5799 1.6648 Constraint 435 552 8.9168 11.1460 16.7190 1.6335 Constraint 435 544 8.2356 10.2945 15.4418 1.6335 Constraint 435 535 5.9426 7.4282 11.1424 1.6335 Constraint 435 519 5.7412 7.1765 10.7647 1.6335 Constraint 435 511 4.4206 5.5258 8.2886 1.6335 Constraint 429 557 10.0521 12.5651 18.8477 1.6335 Constraint 429 544 8.7291 10.9113 16.3670 1.6335 Constraint 412 519 8.1407 10.1759 15.2638 1.6335 Constraint 412 511 5.9768 7.4709 11.2064 1.6335 Constraint 136 644 8.3078 10.3848 15.5772 1.5963 Constraint 113 644 10.0681 12.5851 18.8777 1.5963 Constraint 497 636 7.9848 9.9810 14.9715 1.5730 Constraint 497 613 7.1787 8.9734 13.4601 1.5730 Constraint 391 657 9.7675 12.2094 18.3140 1.5730 Constraint 368 657 8.6963 10.8704 16.3056 1.5730 Constraint 360 657 8.7110 10.8887 16.3331 1.5730 Constraint 527 657 5.6954 7.1193 10.6790 1.5710 Constraint 527 651 8.4736 10.5920 15.8880 1.5710 Constraint 341 657 9.5625 11.9531 17.9296 1.5576 Constraint 153 613 9.9345 12.4181 18.6271 1.4763 Constraint 153 585 7.7574 9.6968 14.5452 1.4763 Constraint 442 557 9.1116 11.3895 17.0842 1.4459 Constraint 535 622 5.9173 7.3966 11.0949 1.4029 Constraint 535 613 7.7738 9.7173 14.5760 1.4029 Constraint 535 604 7.0255 8.7819 13.1728 1.4029 Constraint 527 668 8.2804 10.3505 15.5258 1.4029 Constraint 519 668 10.0923 12.6154 18.9231 1.4029 Constraint 519 657 8.4097 10.5122 15.7682 1.4029 Constraint 176 698 9.8345 12.2931 18.4397 1.3971 Constraint 169 657 9.5997 11.9996 17.9994 1.3971 Constraint 292 668 10.2997 12.8746 19.3119 1.3894 Constraint 237 644 7.9563 9.9454 14.9180 1.3894 Constraint 210 668 8.2856 10.3571 15.5356 1.3894 Constraint 210 657 7.9502 9.9377 14.9066 1.3894 Constraint 201 668 8.4423 10.5529 15.8294 1.3894 Constraint 201 657 9.3922 11.7402 17.6103 1.3894 Constraint 201 651 9.2943 11.6179 17.4268 1.3894 Constraint 590 706 9.8921 12.3651 18.5477 1.3335 Constraint 435 571 10.1727 12.7159 19.0739 1.3335 Constraint 435 557 8.5023 10.6278 15.9417 1.3335 Constraint 412 544 10.2970 12.8712 19.3068 1.3335 Constraint 237 511 7.9993 9.9992 14.9988 1.3335 Constraint 210 511 8.6557 10.8196 16.2294 1.3335 Constraint 201 511 10.1508 12.6885 19.0328 1.3335 Constraint 169 544 10.1009 12.6262 18.9392 1.3335 Constraint 169 511 8.0333 10.0416 15.0624 1.3335 Constraint 161 511 9.9317 12.4146 18.6219 1.3335 Constraint 153 571 9.7223 12.1529 18.2294 1.3335 Constraint 153 544 6.2938 7.8672 11.8008 1.3335 Constraint 153 519 7.4040 9.2550 13.8824 1.3335 Constraint 153 511 5.5102 6.8878 10.3317 1.3335 Constraint 144 519 6.5377 8.1721 12.2581 1.3335 Constraint 144 511 7.2353 9.0441 13.5662 1.3335 Constraint 128 519 9.7200 12.1500 18.2250 1.3335 Constraint 128 511 8.5913 10.7391 16.1086 1.3335 Constraint 122 544 7.7787 9.7234 14.5851 1.3335 Constraint 113 544 10.1580 12.6975 19.0463 1.3335 Constraint 113 511 9.8749 12.3436 18.5154 1.3335 Constraint 442 571 9.5507 11.9384 17.9075 1.3163 Constraint 297 382 8.5818 10.7273 16.0909 1.3163 Constraint 279 382 8.3566 10.4458 15.6686 1.3163 Constraint 442 544 7.7749 9.7187 14.5780 1.2981 Constraint 322 382 7.7062 9.6328 14.4491 1.2981 Constraint 96 585 9.7146 12.1432 18.2149 1.2625 Constraint 519 590 8.3988 10.4985 15.7478 1.2144 Constraint 391 489 6.6769 8.3461 12.5192 1.2144 Constraint 391 480 5.6569 7.0711 10.6066 1.2144 Constraint 382 519 9.7185 12.1481 18.2221 1.2144 Constraint 382 511 8.7412 10.9265 16.3897 1.2144 Constraint 382 489 7.2620 9.0775 13.6162 1.2144 Constraint 382 480 4.2722 5.3402 8.0103 1.2144 Constraint 375 489 8.9414 11.1767 16.7651 1.2144 Constraint 368 489 9.4669 11.8337 17.7505 1.2144 Constraint 368 480 7.0504 8.8130 13.2195 1.2144 Constraint 350 489 8.9427 11.1784 16.7676 1.2144 Constraint 350 480 10.1186 12.6482 18.9723 1.2144 Constraint 341 535 9.8488 12.3110 18.4665 1.2144 Constraint 341 511 10.3718 12.9648 19.4471 1.2144 Constraint 341 497 5.9419 7.4274 11.1411 1.2144 Constraint 341 489 7.8308 9.7886 14.6828 1.2144 Constraint 303 497 10.3642 12.9552 19.4328 1.2144 Constraint 303 489 8.7292 10.9115 16.3673 1.2144 Constraint 292 519 9.0591 11.3239 16.9859 1.2144 Constraint 292 489 6.3263 7.9079 11.8618 1.2144 Constraint 292 480 10.1408 12.6760 19.0140 1.2144 Constraint 285 497 10.3780 12.9725 19.4587 1.2144 Constraint 285 489 7.0351 8.7938 13.1908 1.2144 Constraint 285 480 9.6392 12.0489 18.0734 1.2144 Constraint 267 489 9.3743 11.7178 17.5767 1.2144 Constraint 259 519 8.0159 10.0198 15.0297 1.2144 Constraint 259 497 9.1295 11.4119 17.1178 1.2144 Constraint 259 489 5.1701 6.4627 9.6940 1.2144 Constraint 259 480 8.0609 10.0761 15.1141 1.2144 Constraint 259 330 10.1758 12.7198 19.0796 1.2144 Constraint 250 527 9.9982 12.4978 18.7467 1.2144 Constraint 250 519 7.1876 8.9845 13.4767 1.2144 Constraint 250 511 10.3391 12.9239 19.3858 1.2144 Constraint 250 489 6.4126 8.0157 12.0236 1.2144 Constraint 250 480 7.1196 8.8995 13.3492 1.2144 Constraint 242 489 3.5212 4.4015 6.6023 1.2144 Constraint 242 480 6.5917 8.2397 12.3595 1.2144 Constraint 237 527 9.7272 12.1589 18.2384 1.2144 Constraint 237 519 8.1344 10.1680 15.2520 1.2144 Constraint 237 489 9.6479 12.0599 18.0898 1.2144 Constraint 226 519 9.6801 12.1001 18.1502 1.2144 Constraint 226 489 9.3572 11.6965 17.5447 1.2144 Constraint 226 314 10.3151 12.8939 19.3408 1.2144 Constraint 221 519 8.2803 10.3504 15.5256 1.2144 Constraint 221 497 9.9331 12.4164 18.6246 1.2144 Constraint 221 489 6.5848 8.2310 12.3466 1.2144 Constraint 221 480 10.1069 12.6336 18.9504 1.2144 Constraint 210 519 7.9078 9.8848 14.8272 1.2144 Constraint 210 489 8.1623 10.2028 15.3043 1.2144 Constraint 182 527 9.3854 11.7318 17.5977 1.2144 Constraint 182 489 9.8530 12.3162 18.4743 1.2144 Constraint 169 527 10.3805 12.9757 19.4635 1.2144 Constraint 144 657 9.2335 11.5419 17.3128 1.1914 Constraint 136 668 9.2068 11.5085 17.2627 1.1914 Constraint 136 651 7.2313 9.0392 13.5587 1.1914 Constraint 136 622 7.0927 8.8659 13.2988 1.1914 Constraint 136 613 6.7236 8.4045 12.6067 1.1914 Constraint 136 590 9.1766 11.4707 17.2060 1.1914 Constraint 113 651 7.4856 9.3570 14.0356 1.1914 Constraint 113 622 9.1104 11.3880 17.0820 1.1914 Constraint 104 613 8.4503 10.5628 15.8443 1.1914 Constraint 88 657 10.3894 12.9868 19.4802 1.1914 Constraint 80 657 8.6727 10.8409 16.2613 1.1914 Constraint 80 651 7.3178 9.1473 13.7209 1.1914 Constraint 80 629 7.0227 8.7783 13.1675 1.1914 Constraint 80 622 9.2976 11.6219 17.4329 1.1914 Constraint 80 599 9.2290 11.5362 17.3043 1.1914 Constraint 80 442 9.6345 12.0432 18.0647 1.1914 Constraint 449 557 9.8838 12.3548 18.5321 1.1459 Constraint 355 644 9.2784 11.5981 17.3971 1.1459 Constraint 350 651 9.9689 12.4611 18.6917 1.1459 Constraint 449 544 10.2246 12.7808 19.1711 1.0163 Constraint 412 577 4.0122 5.0153 7.5229 1.0163 Constraint 412 557 8.9379 11.1723 16.7585 1.0163 Constraint 412 552 5.8940 7.3675 11.0512 1.0163 Constraint 404 552 8.6501 10.8127 16.2190 1.0163 Constraint 355 577 7.4031 9.2539 13.8808 1.0163 Constraint 355 449 9.9468 12.4335 18.6503 1.0163 Constraint 355 442 10.3295 12.9119 19.3678 1.0163 Constraint 355 429 8.6984 10.8730 16.3096 1.0163 Constraint 350 571 9.8698 12.3373 18.5060 1.0163 Constraint 350 544 9.6767 12.0958 18.1437 1.0163 Constraint 80 375 10.0830 12.6038 18.9057 1.0163 Constraint 69 382 8.5596 10.6995 16.0492 1.0163 Constraint 69 285 8.4018 10.5022 15.7533 1.0163 Constraint 69 259 9.9626 12.4532 18.6798 1.0163 Constraint 58 375 8.2818 10.3523 15.5285 1.0163 Constraint 51 375 10.0852 12.6065 18.9097 1.0163 Constraint 51 314 8.1908 10.2385 15.3577 1.0163 Constraint 51 285 9.7781 12.2226 18.3339 1.0163 Constraint 51 259 9.1874 11.4842 17.2263 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 242 8.0307 10.0384 15.0575 1.0163 Constraint 128 668 8.3309 10.4136 15.6204 1.0005 Constraint 122 651 9.4673 11.8342 17.7513 1.0005 Constraint 122 644 8.3602 10.4502 15.6753 1.0005 Constraint 122 622 8.1332 10.1664 15.2497 1.0005 Constraint 96 644 8.6171 10.7714 16.1571 1.0005 Constraint 96 613 8.8156 11.0195 16.5293 1.0005 Constraint 96 590 8.9537 11.1921 16.7881 1.0005 Constraint 489 636 6.8434 8.5543 12.8314 1.0000 Constraint 480 651 8.9817 11.2271 16.8407 1.0000 Constraint 480 644 6.6408 8.3010 12.4515 1.0000 Constraint 473 687 10.0755 12.5943 18.8915 1.0000 Constraint 473 676 10.2676 12.8345 19.2517 1.0000 Constraint 473 571 4.6017 5.7521 8.6282 1.0000 Constraint 467 668 9.2723 11.5904 17.3856 1.0000 Constraint 467 657 8.4741 10.5927 15.8890 1.0000 Constraint 467 644 9.9581 12.4477 18.6715 1.0000 Constraint 467 571 8.8124 11.0155 16.5232 1.0000 Constraint 461 636 8.5833 10.7291 16.0936 1.0000 Constraint 461 571 9.9284 12.4105 18.6157 1.0000 Constraint 435 657 9.9291 12.4113 18.6170 1.0000 Constraint 429 657 7.7969 9.7461 14.6191 1.0000 Constraint 429 571 7.4999 9.3749 14.0623 1.0000 Constraint 421 657 10.1195 12.6493 18.9740 1.0000 Constraint 421 636 9.7105 12.1381 18.2072 1.0000 Constraint 412 657 9.6869 12.1086 18.1629 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 404 687 8.6870 10.8587 16.2881 1.0000 Constraint 404 668 9.1501 11.4376 17.1563 1.0000 Constraint 399 687 10.0466 12.5582 18.8373 1.0000 Constraint 399 668 9.8918 12.3648 18.5472 1.0000 Constraint 399 657 6.3181 7.8977 11.8465 1.0000 Constraint 399 644 9.0236 11.2795 16.9193 1.0000 Constraint 399 557 7.7088 9.6361 14.4541 1.0000 Constraint 391 651 10.0309 12.5387 18.8080 1.0000 Constraint 382 687 8.7387 10.9234 16.3851 1.0000 Constraint 382 657 7.6142 9.5178 14.2767 1.0000 Constraint 375 698 8.5125 10.6406 15.9610 1.0000 Constraint 375 687 5.9127 7.3909 11.0863 1.0000 Constraint 375 676 7.8588 9.8234 14.7352 1.0000 Constraint 375 668 8.1288 10.1610 15.2415 1.0000 Constraint 368 687 9.6089 12.0111 18.0167 1.0000 Constraint 368 636 10.1229 12.6536 18.9804 1.0000 Constraint 360 651 8.4208 10.5259 15.7889 1.0000 Constraint 360 636 8.7946 10.9932 16.4898 1.0000 Constraint 360 613 9.6361 12.0451 18.0677 1.0000 Constraint 355 629 7.8913 9.8641 14.7962 1.0000 Constraint 355 557 8.8986 11.1232 16.6848 1.0000 Constraint 314 629 9.5009 11.8761 17.8141 1.0000 Constraint 657 742 10.3777 12.9721 19.4581 0.9981 Constraint 657 735 6.8040 8.5051 12.7576 0.9981 Constraint 651 742 10.3891 12.9864 19.4796 0.9981 Constraint 651 735 8.2078 10.2598 15.3896 0.9981 Constraint 644 742 6.3980 7.9974 11.9962 0.9981 Constraint 644 735 5.7327 7.1659 10.7489 0.9981 Constraint 644 729 9.7135 12.1418 18.2127 0.9981 Constraint 644 720 9.1384 11.4230 17.1345 0.9981 Constraint 629 742 7.6822 9.6027 14.4041 0.9981 Constraint 629 735 5.9832 7.4790 11.2185 0.9981 Constraint 629 729 9.8680 12.3350 18.5026 0.9981 Constraint 629 720 8.8014 11.0017 16.5026 0.9981 Constraint 622 735 9.6441 12.0552 18.0828 0.9981 Constraint 622 729 8.4502 10.5627 15.8440 0.9981 Constraint 622 720 9.2851 11.6063 17.4095 0.9981 Constraint 622 713 6.1490 7.6863 11.5294 0.9981 Constraint 613 742 10.2619 12.8274 19.2410 0.9981 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 613 713 9.0649 11.3311 16.9967 0.9981 Constraint 604 742 8.0595 10.0744 15.1116 0.9981 Constraint 604 735 8.8596 11.0744 16.6117 0.9981 Constraint 604 713 7.8759 9.8448 14.7672 0.9981 Constraint 604 698 8.9142 11.1428 16.7142 0.9981 Constraint 604 676 9.4549 11.8186 17.7279 0.9981 Constraint 599 729 8.7329 10.9162 16.3742 0.9981 Constraint 599 720 8.0738 10.0923 15.1384 0.9981 Constraint 599 676 9.8789 12.3486 18.5228 0.9981 Constraint 590 729 10.3165 12.8956 19.3434 0.9981 Constraint 590 713 6.6136 8.2670 12.4005 0.9981 Constraint 590 687 9.8371 12.2963 18.4445 0.9981 Constraint 585 713 9.0195 11.2744 16.9116 0.9981 Constraint 577 713 6.5224 8.1530 12.2296 0.9981 Constraint 577 698 8.4435 10.5543 15.8315 0.9981 Constraint 577 687 8.7240 10.9050 16.3574 0.9981 Constraint 571 729 9.8530 12.3163 18.4744 0.9981 Constraint 571 720 10.0309 12.5386 18.8079 0.9981 Constraint 571 713 5.3450 6.6812 10.0218 0.9981 Constraint 571 687 10.3707 12.9633 19.4450 0.9981 Constraint 571 657 9.0163 11.2704 16.9056 0.9981 Constraint 571 651 10.2944 12.8680 19.3020 0.9981 Constraint 557 713 9.4188 11.7735 17.6602 0.9981 Constraint 557 687 9.4462 11.8077 17.7116 0.9981 Constraint 557 668 10.3037 12.8796 19.3194 0.9981 Constraint 557 657 6.2669 7.8336 11.7504 0.9981 Constraint 557 651 7.9421 9.9276 14.8914 0.9981 Constraint 557 644 10.1670 12.7088 19.0632 0.9981 Constraint 552 657 8.1605 10.2006 15.3009 0.9981 Constraint 552 629 10.0549 12.5686 18.8529 0.9981 Constraint 544 657 8.6579 10.8224 16.2335 0.9981 Constraint 535 735 8.9201 11.1501 16.7251 0.9981 Constraint 535 713 9.7139 12.1424 18.2135 0.9981 Constraint 535 698 8.6861 10.8576 16.2864 0.9981 Constraint 535 687 9.2070 11.5087 17.2631 0.9981 Constraint 535 668 7.7306 9.6632 14.4948 0.9981 Constraint 535 657 4.9366 6.1708 9.2562 0.9981 Constraint 535 651 7.8508 9.8135 14.7203 0.9981 Constraint 535 644 8.3096 10.3870 15.5805 0.9981 Constraint 535 629 4.4518 5.5648 8.3471 0.9981 Constraint 527 735 9.6496 12.0620 18.0930 0.9981 Constraint 527 713 8.9334 11.1668 16.7502 0.9981 Constraint 527 706 10.1745 12.7181 19.0772 0.9981 Constraint 527 698 6.3442 7.9303 11.8954 0.9981 Constraint 527 687 6.7382 8.4227 12.6341 0.9981 Constraint 527 676 9.5579 11.9474 17.9211 0.9981 Constraint 519 713 10.3460 12.9326 19.3988 0.9981 Constraint 519 698 8.4419 10.5524 15.8287 0.9981 Constraint 519 687 10.3324 12.9155 19.3733 0.9981 Constraint 511 735 8.6213 10.7766 16.1649 0.9981 Constraint 511 713 9.0139 11.2673 16.9010 0.9981 Constraint 511 698 8.7420 10.9275 16.3912 0.9981 Constraint 511 668 8.5904 10.7380 16.1070 0.9981 Constraint 511 657 7.3691 9.2114 13.8172 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 497 706 8.3556 10.4446 15.6668 0.9981 Constraint 497 698 4.7218 5.9023 8.8534 0.9981 Constraint 497 687 7.2198 9.0248 13.5372 0.9981 Constraint 497 676 8.1861 10.2326 15.3489 0.9981 Constraint 497 668 4.6526 5.8158 8.7236 0.9981 Constraint 497 651 7.9897 9.9871 14.9806 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 489 706 8.2414 10.3018 15.4527 0.9981 Constraint 489 698 5.0606 6.3257 9.4886 0.9981 Constraint 489 687 8.4643 10.5803 15.8705 0.9981 Constraint 489 668 7.9303 9.9129 14.8694 0.9981 Constraint 489 657 7.0987 8.8734 13.3101 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 480 698 8.7725 10.9656 16.4485 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 473 706 9.9078 12.3847 18.5771 0.9981 Constraint 341 557 4.0760 5.0950 7.6424 0.9981 Constraint 341 480 4.0799 5.0998 7.6497 0.9981 Constraint 330 557 7.3426 9.1782 13.7673 0.9981 Constraint 330 480 7.3610 9.2013 13.8019 0.9981 Constraint 322 557 8.2644 10.3305 15.4957 0.9981 Constraint 322 480 8.2735 10.3419 15.5128 0.9981 Constraint 314 713 10.2837 12.8546 19.2819 0.9981 Constraint 314 698 9.6487 12.0609 18.0914 0.9981 Constraint 285 698 10.3873 12.9841 19.4762 0.9981 Constraint 136 557 9.9704 12.4630 18.6945 0.9981 Constraint 136 480 9.9638 12.4548 18.6821 0.9981 Constraint 136 404 8.4503 10.5629 15.8444 0.9981 Constraint 136 399 9.9197 12.3997 18.5995 0.9981 Constraint 136 382 9.9465 12.4331 18.6497 0.9981 Constraint 113 404 7.4760 9.3449 14.0174 0.9981 Constraint 104 480 7.7733 9.7166 14.5749 0.9981 Constraint 104 404 5.5230 6.9037 10.3556 0.9981 Constraint 104 382 7.7674 9.7093 14.5640 0.9981 Constraint 341 706 10.1238 12.6547 18.9820 0.9923 Constraint 330 698 8.6480 10.8099 16.2149 0.9923 Constraint 322 706 9.9120 12.3900 18.5849 0.9923 Constraint 297 698 8.3888 10.4860 15.7290 0.9923 Constraint 279 698 10.3953 12.9942 19.4913 0.9923 Constraint 272 698 9.8110 12.2637 18.3956 0.9923 Constraint 190 636 9.6573 12.0716 18.1075 0.9923 Constraint 182 698 8.6724 10.8405 16.2607 0.9923 Constraint 182 636 7.5308 9.4135 14.1203 0.9923 Constraint 330 629 7.7779 9.7224 14.5836 0.9878 Constraint 330 613 10.2799 12.8499 19.2748 0.9878 Constraint 330 599 9.6271 12.0338 18.0507 0.9878 Constraint 303 629 10.0460 12.5575 18.8363 0.9878 Constraint 297 651 9.1241 11.4051 17.1077 0.9878 Constraint 297 629 6.3573 7.9466 11.9198 0.9878 Constraint 297 622 10.2732 12.8415 19.2623 0.9878 Constraint 279 629 9.2555 11.5694 17.3541 0.9878 Constraint 272 629 8.5073 10.6341 15.9511 0.9878 Constraint 577 644 7.7173 9.6467 14.4700 0.9846 Constraint 350 552 8.8733 11.0916 16.6373 0.9846 Constraint 322 552 8.0453 10.0566 15.0849 0.9846 Constraint 314 657 9.1355 11.4193 17.1290 0.9846 Constraint 314 644 9.2033 11.5041 17.2562 0.9846 Constraint 314 552 3.9736 4.9670 7.4505 0.9846 Constraint 303 657 10.1917 12.7396 19.1094 0.9846 Constraint 303 552 7.1148 8.8935 13.3402 0.9846 Constraint 297 552 9.9169 12.3962 18.5942 0.9846 Constraint 292 657 7.6006 9.5007 14.2511 0.9846 Constraint 292 651 10.3893 12.9866 19.4799 0.9846 Constraint 292 644 6.9525 8.6907 13.0360 0.9846 Constraint 292 557 9.9967 12.4958 18.7438 0.9846 Constraint 285 557 9.8546 12.3182 18.4774 0.9846 Constraint 285 552 7.2041 9.0051 13.5076 0.9846 Constraint 272 644 9.4982 11.8727 17.8091 0.9846 Constraint 259 644 10.2038 12.7547 19.1321 0.9846 Constraint 259 557 9.0472 11.3089 16.9634 0.9846 Constraint 250 557 9.4593 11.8241 17.7361 0.9846 Constraint 242 644 8.4118 10.5148 15.7722 0.9846 Constraint 242 557 7.3860 9.2325 13.8487 0.9846 Constraint 237 557 10.1300 12.6625 18.9938 0.9846 Constraint 226 644 9.5891 11.9864 17.9796 0.9846 Constraint 221 657 10.2789 12.8487 19.2730 0.9846 Constraint 221 644 8.3477 10.4346 15.6519 0.9846 Constraint 210 651 8.5172 10.6465 15.9698 0.9846 Constraint 182 651 8.6451 10.8063 16.2095 0.9846 Constraint 519 613 6.3803 7.9754 11.9631 0.9778 Constraint 519 604 6.6833 8.3541 12.5312 0.9778 Constraint 511 613 6.8994 8.6243 12.9364 0.9778 Constraint 511 604 6.4944 8.1180 12.1770 0.9778 Constraint 122 297 9.0856 11.3569 17.0354 0.8957 Constraint 113 259 8.8607 11.0759 16.6138 0.8957 Constraint 113 226 8.5140 10.6425 15.9638 0.8957 Constraint 113 221 8.0603 10.0754 15.1131 0.8957 Constraint 113 190 9.2806 11.6008 17.4011 0.8957 Constraint 88 176 9.5469 11.9336 17.9004 0.8957 Constraint 341 473 8.5816 10.7270 16.0905 0.8096 Constraint 242 544 9.3561 11.6951 17.5426 0.8096 Constraint 237 552 7.6020 9.5025 14.2538 0.8096 Constraint 226 552 10.2932 12.8665 19.2997 0.8096 Constraint 221 552 9.0097 11.2621 16.8931 0.8096 Constraint 201 590 8.6839 10.8549 16.2823 0.8096 Constraint 201 552 9.7649 12.2062 18.3092 0.8096 Constraint 190 622 8.3884 10.4855 15.7283 0.8096 Constraint 176 622 8.8413 11.0516 16.5774 0.8096 Constraint 169 590 9.6769 12.0962 18.1443 0.8096 Constraint 169 585 9.6221 12.0276 18.0414 0.8096 Constraint 169 552 9.4112 11.7641 17.6461 0.8096 Constraint 153 622 9.9916 12.4896 18.7343 0.8096 Constraint 153 590 9.6007 12.0009 18.0014 0.8096 Constraint 153 577 4.1698 5.2123 7.8184 0.8096 Constraint 153 557 9.9025 12.3782 18.5673 0.8096 Constraint 128 557 8.9806 11.2258 16.8387 0.8096 Constraint 128 552 8.7948 10.9934 16.4902 0.8096 Constraint 122 571 9.1961 11.4952 17.2427 0.8096 Constraint 122 557 5.4965 6.8707 10.3060 0.8096 Constraint 113 557 8.0629 10.0786 15.1179 0.8096 Constraint 104 552 10.2219 12.7774 19.1661 0.8096 Constraint 96 571 9.2539 11.5674 17.3511 0.8096 Constraint 96 557 5.1863 6.4829 9.7244 0.8096 Constraint 96 552 5.9733 7.4667 11.2000 0.8096 Constraint 96 544 8.9679 11.2098 16.8148 0.8096 Constraint 88 571 8.5072 10.6340 15.9511 0.8096 Constraint 88 557 4.7265 5.9081 8.8622 0.8096 Constraint 442 636 10.1742 12.7177 19.0766 0.6667 Constraint 201 742 10.2861 12.8577 19.2865 0.6667 Constraint 161 742 9.4543 11.8178 17.7267 0.6667 Constraint 161 735 8.4692 10.5866 15.8798 0.6667 Constraint 161 729 9.4662 11.8328 17.7492 0.6667 Constraint 161 720 9.3997 11.7497 17.6245 0.6667 Constraint 153 629 9.6609 12.0762 18.1142 0.6667 Constraint 144 613 9.0096 11.2620 16.8930 0.6667 Constraint 144 590 10.3923 12.9904 19.4855 0.6667 Constraint 136 242 10.3017 12.8771 19.3157 0.5957 Constraint 113 250 10.1113 12.6392 18.9587 0.5957 Constraint 104 687 10.0969 12.6211 18.9317 0.5957 Constraint 96 657 7.3977 9.2471 13.8707 0.5957 Constraint 96 636 7.5583 9.4479 14.1719 0.5957 Constraint 88 622 9.6351 12.0439 18.0658 0.5957 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 527 636 7.1172 8.8965 13.3447 0.5730 Constraint 519 636 8.5065 10.6331 15.9496 0.5730 Constraint 511 636 8.4084 10.5105 15.7658 0.5730 Constraint 391 668 9.4962 11.8703 17.8054 0.5730 Constraint 368 668 8.1626 10.2032 15.3049 0.5730 Constraint 360 668 8.9643 11.2054 16.8081 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 355 668 5.3895 6.7369 10.1053 0.5730 Constraint 355 657 3.5466 4.4332 6.6498 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 350 668 9.1543 11.4429 17.1644 0.5730 Constraint 350 657 6.2417 7.8022 11.7033 0.5730 Constraint 511 590 5.0807 6.3508 9.5263 0.4048 Constraint 242 698 10.3762 12.9703 19.4554 0.4048 Constraint 242 668 9.1556 11.4446 17.1668 0.4048 Constraint 237 698 4.3036 5.3795 8.0693 0.4048 Constraint 237 687 7.5159 9.3949 14.0924 0.4048 Constraint 237 676 8.4658 10.5822 15.8733 0.4048 Constraint 237 668 5.1247 6.4058 9.6087 0.4048 Constraint 237 657 6.2235 7.7794 11.6692 0.4048 Constraint 237 651 9.7672 12.2090 18.3135 0.4048 Constraint 226 698 6.4367 8.0458 12.0687 0.4048 Constraint 226 668 8.1171 10.1463 15.2195 0.4048 Constraint 226 657 10.1158 12.6448 18.9672 0.4048 Constraint 221 698 9.2067 11.5083 17.2625 0.4048 Constraint 221 668 8.5871 10.7338 16.1007 0.4048 Constraint 210 698 7.2955 9.1193 13.6790 0.4048 Constraint 210 687 10.0080 12.5100 18.7650 0.4048 Constraint 210 676 8.4754 10.5942 15.8913 0.4048 Constraint 201 729 9.2546 11.5682 17.3523 0.4048 Constraint 201 698 4.5555 5.6944 8.5416 0.4048 Constraint 201 687 8.3711 10.4639 15.6959 0.4048 Constraint 201 676 7.1609 8.9511 13.4266 0.4048 Constraint 190 698 8.3744 10.4680 15.7020 0.4048 Constraint 176 729 9.7777 12.2222 18.3333 0.4048 Constraint 169 698 8.1966 10.2457 15.3685 0.4048 Constraint 169 687 9.7608 12.2011 18.3016 0.4048 Constraint 169 676 6.2847 7.8559 11.7838 0.4048 Constraint 169 651 9.5851 11.9814 17.9721 0.4048 Constraint 161 676 8.0481 10.0601 15.0902 0.4048 Constraint 161 668 9.4978 11.8723 17.8084 0.4048 Constraint 161 644 8.6326 10.7907 16.1861 0.4048 Constraint 153 698 9.9176 12.3970 18.5955 0.4048 Constraint 153 687 9.7397 12.1747 18.2620 0.4048 Constraint 153 676 5.7542 7.1927 10.7891 0.4048 Constraint 153 668 6.2813 7.8517 11.7775 0.4048 Constraint 153 657 9.6250 12.0313 18.0470 0.4048 Constraint 153 651 7.9267 9.9084 14.8626 0.4048 Constraint 153 644 4.1787 5.2234 7.8351 0.4048 Constraint 153 636 10.2795 12.8493 19.2740 0.4048 Constraint 144 676 9.6590 12.0738 18.1107 0.4048 Constraint 144 668 9.6905 12.1131 18.1696 0.4048 Constraint 144 644 6.8687 8.5859 12.8789 0.4048 Constraint 128 676 8.9551 11.1938 16.7908 0.4048 Constraint 122 676 9.3863 11.7329 17.5994 0.4048 Constraint 122 668 7.3367 9.1709 13.7564 0.4048 Constraint 96 668 8.6239 10.7798 16.1698 0.4048 Constraint 88 644 10.0851 12.6064 18.9096 0.4048 Constraint 88 613 8.5456 10.6821 16.0231 0.4048 Constraint 88 590 9.9659 12.4574 18.6862 0.4048 Constraint 80 557 8.6085 10.7606 16.1409 0.4048 Constraint 33 285 9.9963 12.4954 18.7431 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 242 9.3080 11.6350 17.4525 0.3388 Constraint 122 330 9.1838 11.4797 17.2196 0.3000 Constraint 122 272 9.6226 12.0282 18.0423 0.3000 Constraint 113 391 9.3111 11.6388 17.4583 0.3000 Constraint 113 297 10.2825 12.8532 19.2797 0.3000 Constraint 88 382 7.8194 9.7743 14.6614 0.3000 Constraint 88 279 9.6069 12.0086 18.0129 0.3000 Constraint 88 190 9.6017 12.0021 18.0032 0.3000 Constraint 88 161 10.2191 12.7738 19.1607 0.3000 Constraint 80 391 7.5489 9.4361 14.1542 0.1000 Constraint 80 382 9.9136 12.3919 18.5879 0.1000 Constraint 80 285 9.7619 12.2024 18.3036 0.1000 Constraint 80 259 8.6797 10.8496 16.2745 0.1000 Constraint 80 221 9.7599 12.1998 18.2997 0.1000 Constraint 80 182 10.3459 12.9324 19.3986 0.1000 Constraint 80 169 8.5175 10.6469 15.9704 0.1000 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 729 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 742 0.8000 1.0000 1.5000 0.0000 Constraint 636 735 0.8000 1.0000 1.5000 0.0000 Constraint 636 729 0.8000 1.0000 1.5000 0.0000 Constraint 636 720 0.8000 1.0000 1.5000 0.0000 Constraint 636 713 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 742 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 729 0.8000 1.0000 1.5000 0.0000 Constraint 613 720 0.8000 1.0000 1.5000 0.0000 Constraint 613 706 0.8000 1.0000 1.5000 0.0000 Constraint 613 698 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 729 0.8000 1.0000 1.5000 0.0000 Constraint 604 720 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 742 0.8000 1.0000 1.5000 0.0000 Constraint 599 735 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 742 0.8000 1.0000 1.5000 0.0000 Constraint 590 735 0.8000 1.0000 1.5000 0.0000 Constraint 590 720 0.8000 1.0000 1.5000 0.0000 Constraint 590 698 0.8000 1.0000 1.5000 0.0000 Constraint 590 676 0.8000 1.0000 1.5000 0.0000 Constraint 590 668 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 742 0.8000 1.0000 1.5000 0.0000 Constraint 585 735 0.8000 1.0000 1.5000 0.0000 Constraint 585 729 0.8000 1.0000 1.5000 0.0000 Constraint 585 720 0.8000 1.0000 1.5000 0.0000 Constraint 585 706 0.8000 1.0000 1.5000 0.0000 Constraint 585 698 0.8000 1.0000 1.5000 0.0000 Constraint 585 687 0.8000 1.0000 1.5000 0.0000 Constraint 585 676 0.8000 1.0000 1.5000 0.0000 Constraint 585 668 0.8000 1.0000 1.5000 0.0000 Constraint 585 651 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 742 0.8000 1.0000 1.5000 0.0000 Constraint 577 735 0.8000 1.0000 1.5000 0.0000 Constraint 577 729 0.8000 1.0000 1.5000 0.0000 Constraint 577 720 0.8000 1.0000 1.5000 0.0000 Constraint 577 676 0.8000 1.0000 1.5000 0.0000 Constraint 577 668 0.8000 1.0000 1.5000 0.0000 Constraint 577 651 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 742 0.8000 1.0000 1.5000 0.0000 Constraint 571 735 0.8000 1.0000 1.5000 0.0000 Constraint 571 698 0.8000 1.0000 1.5000 0.0000 Constraint 571 676 0.8000 1.0000 1.5000 0.0000 Constraint 571 668 0.8000 1.0000 1.5000 0.0000 Constraint 571 644 0.8000 1.0000 1.5000 0.0000 Constraint 571 636 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 742 0.8000 1.0000 1.5000 0.0000 Constraint 557 735 0.8000 1.0000 1.5000 0.0000 Constraint 557 729 0.8000 1.0000 1.5000 0.0000 Constraint 557 720 0.8000 1.0000 1.5000 0.0000 Constraint 557 706 0.8000 1.0000 1.5000 0.0000 Constraint 557 698 0.8000 1.0000 1.5000 0.0000 Constraint 557 676 0.8000 1.0000 1.5000 0.0000 Constraint 557 636 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 742 0.8000 1.0000 1.5000 0.0000 Constraint 552 735 0.8000 1.0000 1.5000 0.0000 Constraint 552 729 0.8000 1.0000 1.5000 0.0000 Constraint 552 720 0.8000 1.0000 1.5000 0.0000 Constraint 552 713 0.8000 1.0000 1.5000 0.0000 Constraint 552 706 0.8000 1.0000 1.5000 0.0000 Constraint 552 698 0.8000 1.0000 1.5000 0.0000 Constraint 552 687 0.8000 1.0000 1.5000 0.0000 Constraint 552 676 0.8000 1.0000 1.5000 0.0000 Constraint 552 668 0.8000 1.0000 1.5000 0.0000 Constraint 552 651 0.8000 1.0000 1.5000 0.0000 Constraint 552 644 0.8000 1.0000 1.5000 0.0000 Constraint 552 636 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 742 0.8000 1.0000 1.5000 0.0000 Constraint 544 735 0.8000 1.0000 1.5000 0.0000 Constraint 544 729 0.8000 1.0000 1.5000 0.0000 Constraint 544 720 0.8000 1.0000 1.5000 0.0000 Constraint 544 713 0.8000 1.0000 1.5000 0.0000 Constraint 544 706 0.8000 1.0000 1.5000 0.0000 Constraint 544 698 0.8000 1.0000 1.5000 0.0000 Constraint 544 687 0.8000 1.0000 1.5000 0.0000 Constraint 544 676 0.8000 1.0000 1.5000 0.0000 Constraint 544 668 0.8000 1.0000 1.5000 0.0000 Constraint 544 651 0.8000 1.0000 1.5000 0.0000 Constraint 544 644 0.8000 1.0000 1.5000 0.0000 Constraint 544 636 0.8000 1.0000 1.5000 0.0000 Constraint 544 613 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 742 0.8000 1.0000 1.5000 0.0000 Constraint 535 729 0.8000 1.0000 1.5000 0.0000 Constraint 535 720 0.8000 1.0000 1.5000 0.0000 Constraint 535 706 0.8000 1.0000 1.5000 0.0000 Constraint 535 676 0.8000 1.0000 1.5000 0.0000 Constraint 535 636 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 742 0.8000 1.0000 1.5000 0.0000 Constraint 527 729 0.8000 1.0000 1.5000 0.0000 Constraint 527 720 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 742 0.8000 1.0000 1.5000 0.0000 Constraint 519 735 0.8000 1.0000 1.5000 0.0000 Constraint 519 729 0.8000 1.0000 1.5000 0.0000 Constraint 519 720 0.8000 1.0000 1.5000 0.0000 Constraint 519 706 0.8000 1.0000 1.5000 0.0000 Constraint 519 676 0.8000 1.0000 1.5000 0.0000 Constraint 519 651 0.8000 1.0000 1.5000 0.0000 Constraint 519 644 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 742 0.8000 1.0000 1.5000 0.0000 Constraint 511 729 0.8000 1.0000 1.5000 0.0000 Constraint 511 720 0.8000 1.0000 1.5000 0.0000 Constraint 511 706 0.8000 1.0000 1.5000 0.0000 Constraint 511 687 0.8000 1.0000 1.5000 0.0000 Constraint 511 676 0.8000 1.0000 1.5000 0.0000 Constraint 511 651 0.8000 1.0000 1.5000 0.0000 Constraint 511 644 0.8000 1.0000 1.5000 0.0000 Constraint 511 585 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 742 0.8000 1.0000 1.5000 0.0000 Constraint 489 729 0.8000 1.0000 1.5000 0.0000 Constraint 489 720 0.8000 1.0000 1.5000 0.0000 Constraint 489 676 0.8000 1.0000 1.5000 0.0000 Constraint 489 651 0.8000 1.0000 1.5000 0.0000 Constraint 489 644 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 742 0.8000 1.0000 1.5000 0.0000 Constraint 480 729 0.8000 1.0000 1.5000 0.0000 Constraint 480 720 0.8000 1.0000 1.5000 0.0000 Constraint 480 706 0.8000 1.0000 1.5000 0.0000 Constraint 480 687 0.8000 1.0000 1.5000 0.0000 Constraint 480 676 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 706 0.8000 1.0000 1.5000 0.0000 Constraint 467 698 0.8000 1.0000 1.5000 0.0000 Constraint 467 687 0.8000 1.0000 1.5000 0.0000 Constraint 467 676 0.8000 1.0000 1.5000 0.0000 Constraint 467 651 0.8000 1.0000 1.5000 0.0000 Constraint 467 557 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 706 0.8000 1.0000 1.5000 0.0000 Constraint 461 698 0.8000 1.0000 1.5000 0.0000 Constraint 461 687 0.8000 1.0000 1.5000 0.0000 Constraint 461 676 0.8000 1.0000 1.5000 0.0000 Constraint 461 668 0.8000 1.0000 1.5000 0.0000 Constraint 461 657 0.8000 1.0000 1.5000 0.0000 Constraint 461 651 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 735 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 698 0.8000 1.0000 1.5000 0.0000 Constraint 449 687 0.8000 1.0000 1.5000 0.0000 Constraint 449 676 0.8000 1.0000 1.5000 0.0000 Constraint 449 668 0.8000 1.0000 1.5000 0.0000 Constraint 449 657 0.8000 1.0000 1.5000 0.0000 Constraint 449 636 0.8000 1.0000 1.5000 0.0000 Constraint 449 571 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 742 0.8000 1.0000 1.5000 0.0000 Constraint 442 735 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 713 0.8000 1.0000 1.5000 0.0000 Constraint 442 706 0.8000 1.0000 1.5000 0.0000 Constraint 442 698 0.8000 1.0000 1.5000 0.0000 Constraint 442 687 0.8000 1.0000 1.5000 0.0000 Constraint 442 676 0.8000 1.0000 1.5000 0.0000 Constraint 442 668 0.8000 1.0000 1.5000 0.0000 Constraint 442 657 0.8000 1.0000 1.5000 0.0000 Constraint 442 651 0.8000 1.0000 1.5000 0.0000 Constraint 442 644 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 729 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 706 0.8000 1.0000 1.5000 0.0000 Constraint 435 698 0.8000 1.0000 1.5000 0.0000 Constraint 435 687 0.8000 1.0000 1.5000 0.0000 Constraint 435 676 0.8000 1.0000 1.5000 0.0000 Constraint 435 668 0.8000 1.0000 1.5000 0.0000 Constraint 435 651 0.8000 1.0000 1.5000 0.0000 Constraint 435 644 0.8000 1.0000 1.5000 0.0000 Constraint 435 636 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 713 0.8000 1.0000 1.5000 0.0000 Constraint 429 706 0.8000 1.0000 1.5000 0.0000 Constraint 429 698 0.8000 1.0000 1.5000 0.0000 Constraint 429 687 0.8000 1.0000 1.5000 0.0000 Constraint 429 676 0.8000 1.0000 1.5000 0.0000 Constraint 429 668 0.8000 1.0000 1.5000 0.0000 Constraint 429 651 0.8000 1.0000 1.5000 0.0000 Constraint 429 644 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 742 0.8000 1.0000 1.5000 0.0000 Constraint 421 735 0.8000 1.0000 1.5000 0.0000 Constraint 421 729 0.8000 1.0000 1.5000 0.0000 Constraint 421 720 0.8000 1.0000 1.5000 0.0000 Constraint 421 713 0.8000 1.0000 1.5000 0.0000 Constraint 421 706 0.8000 1.0000 1.5000 0.0000 Constraint 421 698 0.8000 1.0000 1.5000 0.0000 Constraint 421 687 0.8000 1.0000 1.5000 0.0000 Constraint 421 676 0.8000 1.0000 1.5000 0.0000 Constraint 421 668 0.8000 1.0000 1.5000 0.0000 Constraint 421 651 0.8000 1.0000 1.5000 0.0000 Constraint 421 644 0.8000 1.0000 1.5000 0.0000 Constraint 421 557 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 742 0.8000 1.0000 1.5000 0.0000 Constraint 412 735 0.8000 1.0000 1.5000 0.0000 Constraint 412 729 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 706 0.8000 1.0000 1.5000 0.0000 Constraint 412 698 0.8000 1.0000 1.5000 0.0000 Constraint 412 687 0.8000 1.0000 1.5000 0.0000 Constraint 412 676 0.8000 1.0000 1.5000 0.0000 Constraint 412 668 0.8000 1.0000 1.5000 0.0000 Constraint 412 651 0.8000 1.0000 1.5000 0.0000 Constraint 412 644 0.8000 1.0000 1.5000 0.0000 Constraint 412 636 0.8000 1.0000 1.5000 0.0000 Constraint 412 489 0.8000 1.0000 1.5000 0.0000 Constraint 412 480 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 742 0.8000 1.0000 1.5000 0.0000 Constraint 404 735 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 706 0.8000 1.0000 1.5000 0.0000 Constraint 404 676 0.8000 1.0000 1.5000 0.0000 Constraint 404 644 0.8000 1.0000 1.5000 0.0000 Constraint 404 557 0.8000 1.0000 1.5000 0.0000 Constraint 404 544 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 742 0.8000 1.0000 1.5000 0.0000 Constraint 399 735 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 720 0.8000 1.0000 1.5000 0.0000 Constraint 399 713 0.8000 1.0000 1.5000 0.0000 Constraint 399 706 0.8000 1.0000 1.5000 0.0000 Constraint 399 698 0.8000 1.0000 1.5000 0.0000 Constraint 399 676 0.8000 1.0000 1.5000 0.0000 Constraint 399 544 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 742 0.8000 1.0000 1.5000 0.0000 Constraint 391 735 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 713 0.8000 1.0000 1.5000 0.0000 Constraint 391 706 0.8000 1.0000 1.5000 0.0000 Constraint 391 698 0.8000 1.0000 1.5000 0.0000 Constraint 391 687 0.8000 1.0000 1.5000 0.0000 Constraint 391 676 0.8000 1.0000 1.5000 0.0000 Constraint 391 644 0.8000 1.0000 1.5000 0.0000 Constraint 391 636 0.8000 1.0000 1.5000 0.0000 Constraint 391 613 0.8000 1.0000 1.5000 0.0000 Constraint 391 544 0.8000 1.0000 1.5000 0.0000 Constraint 391 467 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 742 0.8000 1.0000 1.5000 0.0000 Constraint 382 735 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 706 0.8000 1.0000 1.5000 0.0000 Constraint 382 698 0.8000 1.0000 1.5000 0.0000 Constraint 382 676 0.8000 1.0000 1.5000 0.0000 Constraint 382 668 0.8000 1.0000 1.5000 0.0000 Constraint 382 644 0.8000 1.0000 1.5000 0.0000 Constraint 382 636 0.8000 1.0000 1.5000 0.0000 Constraint 382 613 0.8000 1.0000 1.5000 0.0000 Constraint 382 544 0.8000 1.0000 1.5000 0.0000 Constraint 382 467 0.8000 1.0000 1.5000 0.0000 Constraint 382 461 0.8000 1.0000 1.5000 0.0000 Constraint 382 449 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 742 0.8000 1.0000 1.5000 0.0000 Constraint 375 735 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 706 0.8000 1.0000 1.5000 0.0000 Constraint 375 544 0.8000 1.0000 1.5000 0.0000 Constraint 375 461 0.8000 1.0000 1.5000 0.0000 Constraint 375 449 0.8000 1.0000 1.5000 0.0000 Constraint 375 442 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 742 0.8000 1.0000 1.5000 0.0000 Constraint 368 735 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 706 0.8000 1.0000 1.5000 0.0000 Constraint 368 698 0.8000 1.0000 1.5000 0.0000 Constraint 368 676 0.8000 1.0000 1.5000 0.0000 Constraint 368 644 0.8000 1.0000 1.5000 0.0000 Constraint 368 613 0.8000 1.0000 1.5000 0.0000 Constraint 368 544 0.8000 1.0000 1.5000 0.0000 Constraint 368 519 0.8000 1.0000 1.5000 0.0000 Constraint 368 467 0.8000 1.0000 1.5000 0.0000 Constraint 368 461 0.8000 1.0000 1.5000 0.0000 Constraint 368 449 0.8000 1.0000 1.5000 0.0000 Constraint 368 442 0.8000 1.0000 1.5000 0.0000 Constraint 368 435 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 742 0.8000 1.0000 1.5000 0.0000 Constraint 360 735 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 720 0.8000 1.0000 1.5000 0.0000 Constraint 360 713 0.8000 1.0000 1.5000 0.0000 Constraint 360 706 0.8000 1.0000 1.5000 0.0000 Constraint 360 698 0.8000 1.0000 1.5000 0.0000 Constraint 360 687 0.8000 1.0000 1.5000 0.0000 Constraint 360 676 0.8000 1.0000 1.5000 0.0000 Constraint 360 644 0.8000 1.0000 1.5000 0.0000 Constraint 360 544 0.8000 1.0000 1.5000 0.0000 Constraint 360 467 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 729 0.8000 1.0000 1.5000 0.0000 Constraint 355 720 0.8000 1.0000 1.5000 0.0000 Constraint 355 713 0.8000 1.0000 1.5000 0.0000 Constraint 355 706 0.8000 1.0000 1.5000 0.0000 Constraint 355 698 0.8000 1.0000 1.5000 0.0000 Constraint 355 687 0.8000 1.0000 1.5000 0.0000 Constraint 355 676 0.8000 1.0000 1.5000 0.0000 Constraint 355 636 0.8000 1.0000 1.5000 0.0000 Constraint 355 613 0.8000 1.0000 1.5000 0.0000 Constraint 355 604 0.8000 1.0000 1.5000 0.0000 Constraint 355 585 0.8000 1.0000 1.5000 0.0000 Constraint 355 544 0.8000 1.0000 1.5000 0.0000 Constraint 355 489 0.8000 1.0000 1.5000 0.0000 Constraint 355 480 0.8000 1.0000 1.5000 0.0000 Constraint 355 467 0.8000 1.0000 1.5000 0.0000 Constraint 355 461 0.8000 1.0000 1.5000 0.0000 Constraint 355 435 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 735 0.8000 1.0000 1.5000 0.0000 Constraint 350 729 0.8000 1.0000 1.5000 0.0000 Constraint 350 720 0.8000 1.0000 1.5000 0.0000 Constraint 350 713 0.8000 1.0000 1.5000 0.0000 Constraint 350 706 0.8000 1.0000 1.5000 0.0000 Constraint 350 698 0.8000 1.0000 1.5000 0.0000 Constraint 350 687 0.8000 1.0000 1.5000 0.0000 Constraint 350 676 0.8000 1.0000 1.5000 0.0000 Constraint 350 644 0.8000 1.0000 1.5000 0.0000 Constraint 350 636 0.8000 1.0000 1.5000 0.0000 Constraint 350 629 0.8000 1.0000 1.5000 0.0000 Constraint 350 622 0.8000 1.0000 1.5000 0.0000 Constraint 350 613 0.8000 1.0000 1.5000 0.0000 Constraint 350 604 0.8000 1.0000 1.5000 0.0000 Constraint 350 599 0.8000 1.0000 1.5000 0.0000 Constraint 350 590 0.8000 1.0000 1.5000 0.0000 Constraint 350 585 0.8000 1.0000 1.5000 0.0000 Constraint 350 557 0.8000 1.0000 1.5000 0.0000 Constraint 350 467 0.8000 1.0000 1.5000 0.0000 Constraint 350 461 0.8000 1.0000 1.5000 0.0000 Constraint 350 449 0.8000 1.0000 1.5000 0.0000 Constraint 350 442 0.8000 1.0000 1.5000 0.0000 Constraint 350 435 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 742 0.8000 1.0000 1.5000 0.0000 Constraint 341 735 0.8000 1.0000 1.5000 0.0000 Constraint 341 729 0.8000 1.0000 1.5000 0.0000 Constraint 341 720 0.8000 1.0000 1.5000 0.0000 Constraint 341 713 0.8000 1.0000 1.5000 0.0000 Constraint 341 698 0.8000 1.0000 1.5000 0.0000 Constraint 341 687 0.8000 1.0000 1.5000 0.0000 Constraint 341 676 0.8000 1.0000 1.5000 0.0000 Constraint 341 668 0.8000 1.0000 1.5000 0.0000 Constraint 341 651 0.8000 1.0000 1.5000 0.0000 Constraint 341 644 0.8000 1.0000 1.5000 0.0000 Constraint 341 636 0.8000 1.0000 1.5000 0.0000 Constraint 341 629 0.8000 1.0000 1.5000 0.0000 Constraint 341 622 0.8000 1.0000 1.5000 0.0000 Constraint 341 613 0.8000 1.0000 1.5000 0.0000 Constraint 341 544 0.8000 1.0000 1.5000 0.0000 Constraint 341 519 0.8000 1.0000 1.5000 0.0000 Constraint 341 467 0.8000 1.0000 1.5000 0.0000 Constraint 341 461 0.8000 1.0000 1.5000 0.0000 Constraint 341 442 0.8000 1.0000 1.5000 0.0000 Constraint 341 435 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 735 0.8000 1.0000 1.5000 0.0000 Constraint 330 729 0.8000 1.0000 1.5000 0.0000 Constraint 330 622 0.8000 1.0000 1.5000 0.0000 Constraint 330 590 0.8000 1.0000 1.5000 0.0000 Constraint 330 544 0.8000 1.0000 1.5000 0.0000 Constraint 330 535 0.8000 1.0000 1.5000 0.0000 Constraint 330 511 0.8000 1.0000 1.5000 0.0000 Constraint 330 497 0.8000 1.0000 1.5000 0.0000 Constraint 330 489 0.8000 1.0000 1.5000 0.0000 Constraint 330 473 0.8000 1.0000 1.5000 0.0000 Constraint 330 467 0.8000 1.0000 1.5000 0.0000 Constraint 330 461 0.8000 1.0000 1.5000 0.0000 Constraint 330 442 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 735 0.8000 1.0000 1.5000 0.0000 Constraint 322 729 0.8000 1.0000 1.5000 0.0000 Constraint 322 720 0.8000 1.0000 1.5000 0.0000 Constraint 322 713 0.8000 1.0000 1.5000 0.0000 Constraint 322 698 0.8000 1.0000 1.5000 0.0000 Constraint 322 687 0.8000 1.0000 1.5000 0.0000 Constraint 322 544 0.8000 1.0000 1.5000 0.0000 Constraint 322 511 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 729 0.8000 1.0000 1.5000 0.0000 Constraint 314 720 0.8000 1.0000 1.5000 0.0000 Constraint 314 706 0.8000 1.0000 1.5000 0.0000 Constraint 314 687 0.8000 1.0000 1.5000 0.0000 Constraint 314 676 0.8000 1.0000 1.5000 0.0000 Constraint 314 668 0.8000 1.0000 1.5000 0.0000 Constraint 314 651 0.8000 1.0000 1.5000 0.0000 Constraint 314 636 0.8000 1.0000 1.5000 0.0000 Constraint 314 622 0.8000 1.0000 1.5000 0.0000 Constraint 314 544 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 735 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 720 0.8000 1.0000 1.5000 0.0000 Constraint 303 713 0.8000 1.0000 1.5000 0.0000 Constraint 303 706 0.8000 1.0000 1.5000 0.0000 Constraint 303 698 0.8000 1.0000 1.5000 0.0000 Constraint 303 687 0.8000 1.0000 1.5000 0.0000 Constraint 303 676 0.8000 1.0000 1.5000 0.0000 Constraint 303 668 0.8000 1.0000 1.5000 0.0000 Constraint 303 651 0.8000 1.0000 1.5000 0.0000 Constraint 303 644 0.8000 1.0000 1.5000 0.0000 Constraint 303 636 0.8000 1.0000 1.5000 0.0000 Constraint 303 622 0.8000 1.0000 1.5000 0.0000 Constraint 303 613 0.8000 1.0000 1.5000 0.0000 Constraint 303 590 0.8000 1.0000 1.5000 0.0000 Constraint 303 557 0.8000 1.0000 1.5000 0.0000 Constraint 303 544 0.8000 1.0000 1.5000 0.0000 Constraint 303 535 0.8000 1.0000 1.5000 0.0000 Constraint 303 519 0.8000 1.0000 1.5000 0.0000 Constraint 303 511 0.8000 1.0000 1.5000 0.0000 Constraint 303 480 0.8000 1.0000 1.5000 0.0000 Constraint 303 473 0.8000 1.0000 1.5000 0.0000 Constraint 303 461 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 735 0.8000 1.0000 1.5000 0.0000 Constraint 297 729 0.8000 1.0000 1.5000 0.0000 Constraint 297 720 0.8000 1.0000 1.5000 0.0000 Constraint 297 687 0.8000 1.0000 1.5000 0.0000 Constraint 297 613 0.8000 1.0000 1.5000 0.0000 Constraint 297 590 0.8000 1.0000 1.5000 0.0000 Constraint 297 585 0.8000 1.0000 1.5000 0.0000 Constraint 297 571 0.8000 1.0000 1.5000 0.0000 Constraint 297 557 0.8000 1.0000 1.5000 0.0000 Constraint 297 544 0.8000 1.0000 1.5000 0.0000 Constraint 297 535 0.8000 1.0000 1.5000 0.0000 Constraint 297 519 0.8000 1.0000 1.5000 0.0000 Constraint 297 511 0.8000 1.0000 1.5000 0.0000 Constraint 297 497 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 742 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 729 0.8000 1.0000 1.5000 0.0000 Constraint 292 720 0.8000 1.0000 1.5000 0.0000 Constraint 292 713 0.8000 1.0000 1.5000 0.0000 Constraint 292 706 0.8000 1.0000 1.5000 0.0000 Constraint 292 698 0.8000 1.0000 1.5000 0.0000 Constraint 292 687 0.8000 1.0000 1.5000 0.0000 Constraint 292 636 0.8000 1.0000 1.5000 0.0000 Constraint 292 544 0.8000 1.0000 1.5000 0.0000 Constraint 292 511 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 729 0.8000 1.0000 1.5000 0.0000 Constraint 285 720 0.8000 1.0000 1.5000 0.0000 Constraint 285 713 0.8000 1.0000 1.5000 0.0000 Constraint 285 706 0.8000 1.0000 1.5000 0.0000 Constraint 285 687 0.8000 1.0000 1.5000 0.0000 Constraint 285 676 0.8000 1.0000 1.5000 0.0000 Constraint 285 668 0.8000 1.0000 1.5000 0.0000 Constraint 285 657 0.8000 1.0000 1.5000 0.0000 Constraint 285 651 0.8000 1.0000 1.5000 0.0000 Constraint 285 644 0.8000 1.0000 1.5000 0.0000 Constraint 285 636 0.8000 1.0000 1.5000 0.0000 Constraint 285 629 0.8000 1.0000 1.5000 0.0000 Constraint 285 622 0.8000 1.0000 1.5000 0.0000 Constraint 285 613 0.8000 1.0000 1.5000 0.0000 Constraint 285 544 0.8000 1.0000 1.5000 0.0000 Constraint 285 535 0.8000 1.0000 1.5000 0.0000 Constraint 285 519 0.8000 1.0000 1.5000 0.0000 Constraint 285 511 0.8000 1.0000 1.5000 0.0000 Constraint 285 473 0.8000 1.0000 1.5000 0.0000 Constraint 285 467 0.8000 1.0000 1.5000 0.0000 Constraint 285 461 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 735 0.8000 1.0000 1.5000 0.0000 Constraint 279 729 0.8000 1.0000 1.5000 0.0000 Constraint 279 720 0.8000 1.0000 1.5000 0.0000 Constraint 279 713 0.8000 1.0000 1.5000 0.0000 Constraint 279 687 0.8000 1.0000 1.5000 0.0000 Constraint 279 676 0.8000 1.0000 1.5000 0.0000 Constraint 279 668 0.8000 1.0000 1.5000 0.0000 Constraint 279 657 0.8000 1.0000 1.5000 0.0000 Constraint 279 651 0.8000 1.0000 1.5000 0.0000 Constraint 279 644 0.8000 1.0000 1.5000 0.0000 Constraint 279 636 0.8000 1.0000 1.5000 0.0000 Constraint 279 622 0.8000 1.0000 1.5000 0.0000 Constraint 279 613 0.8000 1.0000 1.5000 0.0000 Constraint 279 604 0.8000 1.0000 1.5000 0.0000 Constraint 279 599 0.8000 1.0000 1.5000 0.0000 Constraint 279 590 0.8000 1.0000 1.5000 0.0000 Constraint 279 585 0.8000 1.0000 1.5000 0.0000 Constraint 279 571 0.8000 1.0000 1.5000 0.0000 Constraint 279 557 0.8000 1.0000 1.5000 0.0000 Constraint 279 552 0.8000 1.0000 1.5000 0.0000 Constraint 279 544 0.8000 1.0000 1.5000 0.0000 Constraint 279 535 0.8000 1.0000 1.5000 0.0000 Constraint 279 527 0.8000 1.0000 1.5000 0.0000 Constraint 279 519 0.8000 1.0000 1.5000 0.0000 Constraint 279 511 0.8000 1.0000 1.5000 0.0000 Constraint 279 497 0.8000 1.0000 1.5000 0.0000 Constraint 279 489 0.8000 1.0000 1.5000 0.0000 Constraint 279 480 0.8000 1.0000 1.5000 0.0000 Constraint 279 473 0.8000 1.0000 1.5000 0.0000 Constraint 279 467 0.8000 1.0000 1.5000 0.0000 Constraint 279 461 0.8000 1.0000 1.5000 0.0000 Constraint 279 449 0.8000 1.0000 1.5000 0.0000 Constraint 279 442 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 742 0.8000 1.0000 1.5000 0.0000 Constraint 272 735 0.8000 1.0000 1.5000 0.0000 Constraint 272 729 0.8000 1.0000 1.5000 0.0000 Constraint 272 720 0.8000 1.0000 1.5000 0.0000 Constraint 272 713 0.8000 1.0000 1.5000 0.0000 Constraint 272 687 0.8000 1.0000 1.5000 0.0000 Constraint 272 676 0.8000 1.0000 1.5000 0.0000 Constraint 272 651 0.8000 1.0000 1.5000 0.0000 Constraint 272 636 0.8000 1.0000 1.5000 0.0000 Constraint 272 622 0.8000 1.0000 1.5000 0.0000 Constraint 272 613 0.8000 1.0000 1.5000 0.0000 Constraint 272 590 0.8000 1.0000 1.5000 0.0000 Constraint 272 585 0.8000 1.0000 1.5000 0.0000 Constraint 272 571 0.8000 1.0000 1.5000 0.0000 Constraint 272 557 0.8000 1.0000 1.5000 0.0000 Constraint 272 552 0.8000 1.0000 1.5000 0.0000 Constraint 272 544 0.8000 1.0000 1.5000 0.0000 Constraint 272 535 0.8000 1.0000 1.5000 0.0000 Constraint 272 527 0.8000 1.0000 1.5000 0.0000 Constraint 272 519 0.8000 1.0000 1.5000 0.0000 Constraint 272 511 0.8000 1.0000 1.5000 0.0000 Constraint 272 497 0.8000 1.0000 1.5000 0.0000 Constraint 272 489 0.8000 1.0000 1.5000 0.0000 Constraint 272 480 0.8000 1.0000 1.5000 0.0000 Constraint 272 461 0.8000 1.0000 1.5000 0.0000 Constraint 272 435 0.8000 1.0000 1.5000 0.0000 Constraint 272 399 0.8000 1.0000 1.5000 0.0000 Constraint 272 382 0.8000 1.0000 1.5000 0.0000 Constraint 272 375 0.8000 1.0000 1.5000 0.0000 Constraint 272 368 0.8000 1.0000 1.5000 0.0000 Constraint 272 355 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 729 0.8000 1.0000 1.5000 0.0000 Constraint 267 720 0.8000 1.0000 1.5000 0.0000 Constraint 267 713 0.8000 1.0000 1.5000 0.0000 Constraint 267 706 0.8000 1.0000 1.5000 0.0000 Constraint 267 698 0.8000 1.0000 1.5000 0.0000 Constraint 267 687 0.8000 1.0000 1.5000 0.0000 Constraint 267 676 0.8000 1.0000 1.5000 0.0000 Constraint 267 668 0.8000 1.0000 1.5000 0.0000 Constraint 267 657 0.8000 1.0000 1.5000 0.0000 Constraint 267 651 0.8000 1.0000 1.5000 0.0000 Constraint 267 644 0.8000 1.0000 1.5000 0.0000 Constraint 267 636 0.8000 1.0000 1.5000 0.0000 Constraint 267 629 0.8000 1.0000 1.5000 0.0000 Constraint 267 622 0.8000 1.0000 1.5000 0.0000 Constraint 267 613 0.8000 1.0000 1.5000 0.0000 Constraint 267 604 0.8000 1.0000 1.5000 0.0000 Constraint 267 590 0.8000 1.0000 1.5000 0.0000 Constraint 267 585 0.8000 1.0000 1.5000 0.0000 Constraint 267 557 0.8000 1.0000 1.5000 0.0000 Constraint 267 552 0.8000 1.0000 1.5000 0.0000 Constraint 267 544 0.8000 1.0000 1.5000 0.0000 Constraint 267 535 0.8000 1.0000 1.5000 0.0000 Constraint 267 527 0.8000 1.0000 1.5000 0.0000 Constraint 267 519 0.8000 1.0000 1.5000 0.0000 Constraint 267 511 0.8000 1.0000 1.5000 0.0000 Constraint 267 497 0.8000 1.0000 1.5000 0.0000 Constraint 267 480 0.8000 1.0000 1.5000 0.0000 Constraint 267 473 0.8000 1.0000 1.5000 0.0000 Constraint 267 467 0.8000 1.0000 1.5000 0.0000 Constraint 267 461 0.8000 1.0000 1.5000 0.0000 Constraint 267 449 0.8000 1.0000 1.5000 0.0000 Constraint 267 435 0.8000 1.0000 1.5000 0.0000 Constraint 267 429 0.8000 1.0000 1.5000 0.0000 Constraint 267 404 0.8000 1.0000 1.5000 0.0000 Constraint 267 375 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 742 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 729 0.8000 1.0000 1.5000 0.0000 Constraint 259 720 0.8000 1.0000 1.5000 0.0000 Constraint 259 713 0.8000 1.0000 1.5000 0.0000 Constraint 259 706 0.8000 1.0000 1.5000 0.0000 Constraint 259 698 0.8000 1.0000 1.5000 0.0000 Constraint 259 687 0.8000 1.0000 1.5000 0.0000 Constraint 259 676 0.8000 1.0000 1.5000 0.0000 Constraint 259 668 0.8000 1.0000 1.5000 0.0000 Constraint 259 657 0.8000 1.0000 1.5000 0.0000 Constraint 259 651 0.8000 1.0000 1.5000 0.0000 Constraint 259 636 0.8000 1.0000 1.5000 0.0000 Constraint 259 622 0.8000 1.0000 1.5000 0.0000 Constraint 259 613 0.8000 1.0000 1.5000 0.0000 Constraint 259 544 0.8000 1.0000 1.5000 0.0000 Constraint 259 535 0.8000 1.0000 1.5000 0.0000 Constraint 259 511 0.8000 1.0000 1.5000 0.0000 Constraint 259 473 0.8000 1.0000 1.5000 0.0000 Constraint 259 467 0.8000 1.0000 1.5000 0.0000 Constraint 259 461 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 729 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 713 0.8000 1.0000 1.5000 0.0000 Constraint 250 706 0.8000 1.0000 1.5000 0.0000 Constraint 250 698 0.8000 1.0000 1.5000 0.0000 Constraint 250 687 0.8000 1.0000 1.5000 0.0000 Constraint 250 676 0.8000 1.0000 1.5000 0.0000 Constraint 250 668 0.8000 1.0000 1.5000 0.0000 Constraint 250 657 0.8000 1.0000 1.5000 0.0000 Constraint 250 651 0.8000 1.0000 1.5000 0.0000 Constraint 250 644 0.8000 1.0000 1.5000 0.0000 Constraint 250 636 0.8000 1.0000 1.5000 0.0000 Constraint 250 629 0.8000 1.0000 1.5000 0.0000 Constraint 250 613 0.8000 1.0000 1.5000 0.0000 Constraint 250 604 0.8000 1.0000 1.5000 0.0000 Constraint 250 585 0.8000 1.0000 1.5000 0.0000 Constraint 250 544 0.8000 1.0000 1.5000 0.0000 Constraint 250 535 0.8000 1.0000 1.5000 0.0000 Constraint 250 497 0.8000 1.0000 1.5000 0.0000 Constraint 250 473 0.8000 1.0000 1.5000 0.0000 Constraint 250 467 0.8000 1.0000 1.5000 0.0000 Constraint 250 461 0.8000 1.0000 1.5000 0.0000 Constraint 250 355 0.8000 1.0000 1.5000 0.0000 Constraint 250 350 0.8000 1.0000 1.5000 0.0000 Constraint 250 341 0.8000 1.0000 1.5000 0.0000 Constraint 250 330 0.8000 1.0000 1.5000 0.0000 Constraint 250 322 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 742 0.8000 1.0000 1.5000 0.0000 Constraint 242 735 0.8000 1.0000 1.5000 0.0000 Constraint 242 729 0.8000 1.0000 1.5000 0.0000 Constraint 242 720 0.8000 1.0000 1.5000 0.0000 Constraint 242 713 0.8000 1.0000 1.5000 0.0000 Constraint 242 706 0.8000 1.0000 1.5000 0.0000 Constraint 242 687 0.8000 1.0000 1.5000 0.0000 Constraint 242 676 0.8000 1.0000 1.5000 0.0000 Constraint 242 657 0.8000 1.0000 1.5000 0.0000 Constraint 242 651 0.8000 1.0000 1.5000 0.0000 Constraint 242 636 0.8000 1.0000 1.5000 0.0000 Constraint 242 467 0.8000 1.0000 1.5000 0.0000 Constraint 242 330 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 742 0.8000 1.0000 1.5000 0.0000 Constraint 237 735 0.8000 1.0000 1.5000 0.0000 Constraint 237 729 0.8000 1.0000 1.5000 0.0000 Constraint 237 720 0.8000 1.0000 1.5000 0.0000 Constraint 237 713 0.8000 1.0000 1.5000 0.0000 Constraint 237 706 0.8000 1.0000 1.5000 0.0000 Constraint 237 544 0.8000 1.0000 1.5000 0.0000 Constraint 237 535 0.8000 1.0000 1.5000 0.0000 Constraint 237 497 0.8000 1.0000 1.5000 0.0000 Constraint 237 480 0.8000 1.0000 1.5000 0.0000 Constraint 237 473 0.8000 1.0000 1.5000 0.0000 Constraint 237 375 0.8000 1.0000 1.5000 0.0000 Constraint 237 368 0.8000 1.0000 1.5000 0.0000 Constraint 237 355 0.8000 1.0000 1.5000 0.0000 Constraint 237 350 0.8000 1.0000 1.5000 0.0000 Constraint 237 341 0.8000 1.0000 1.5000 0.0000 Constraint 237 330 0.8000 1.0000 1.5000 0.0000 Constraint 237 303 0.8000 1.0000 1.5000 0.0000 Constraint 237 297 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 742 0.8000 1.0000 1.5000 0.0000 Constraint 226 735 0.8000 1.0000 1.5000 0.0000 Constraint 226 729 0.8000 1.0000 1.5000 0.0000 Constraint 226 720 0.8000 1.0000 1.5000 0.0000 Constraint 226 713 0.8000 1.0000 1.5000 0.0000 Constraint 226 706 0.8000 1.0000 1.5000 0.0000 Constraint 226 687 0.8000 1.0000 1.5000 0.0000 Constraint 226 676 0.8000 1.0000 1.5000 0.0000 Constraint 226 651 0.8000 1.0000 1.5000 0.0000 Constraint 226 636 0.8000 1.0000 1.5000 0.0000 Constraint 226 613 0.8000 1.0000 1.5000 0.0000 Constraint 226 585 0.8000 1.0000 1.5000 0.0000 Constraint 226 557 0.8000 1.0000 1.5000 0.0000 Constraint 226 544 0.8000 1.0000 1.5000 0.0000 Constraint 226 535 0.8000 1.0000 1.5000 0.0000 Constraint 226 527 0.8000 1.0000 1.5000 0.0000 Constraint 226 511 0.8000 1.0000 1.5000 0.0000 Constraint 226 497 0.8000 1.0000 1.5000 0.0000 Constraint 226 480 0.8000 1.0000 1.5000 0.0000 Constraint 226 473 0.8000 1.0000 1.5000 0.0000 Constraint 226 467 0.8000 1.0000 1.5000 0.0000 Constraint 226 461 0.8000 1.0000 1.5000 0.0000 Constraint 226 429 0.8000 1.0000 1.5000 0.0000 Constraint 226 404 0.8000 1.0000 1.5000 0.0000 Constraint 226 399 0.8000 1.0000 1.5000 0.0000 Constraint 226 382 0.8000 1.0000 1.5000 0.0000 Constraint 226 375 0.8000 1.0000 1.5000 0.0000 Constraint 226 368 0.8000 1.0000 1.5000 0.0000 Constraint 226 360 0.8000 1.0000 1.5000 0.0000 Constraint 226 355 0.8000 1.0000 1.5000 0.0000 Constraint 226 350 0.8000 1.0000 1.5000 0.0000 Constraint 226 341 0.8000 1.0000 1.5000 0.0000 Constraint 226 330 0.8000 1.0000 1.5000 0.0000 Constraint 226 322 0.8000 1.0000 1.5000 0.0000 Constraint 226 303 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 742 0.8000 1.0000 1.5000 0.0000 Constraint 221 735 0.8000 1.0000 1.5000 0.0000 Constraint 221 729 0.8000 1.0000 1.5000 0.0000 Constraint 221 720 0.8000 1.0000 1.5000 0.0000 Constraint 221 713 0.8000 1.0000 1.5000 0.0000 Constraint 221 706 0.8000 1.0000 1.5000 0.0000 Constraint 221 687 0.8000 1.0000 1.5000 0.0000 Constraint 221 676 0.8000 1.0000 1.5000 0.0000 Constraint 221 651 0.8000 1.0000 1.5000 0.0000 Constraint 221 636 0.8000 1.0000 1.5000 0.0000 Constraint 221 613 0.8000 1.0000 1.5000 0.0000 Constraint 221 557 0.8000 1.0000 1.5000 0.0000 Constraint 221 544 0.8000 1.0000 1.5000 0.0000 Constraint 221 535 0.8000 1.0000 1.5000 0.0000 Constraint 221 511 0.8000 1.0000 1.5000 0.0000 Constraint 221 467 0.8000 1.0000 1.5000 0.0000 Constraint 221 461 0.8000 1.0000 1.5000 0.0000 Constraint 221 404 0.8000 1.0000 1.5000 0.0000 Constraint 221 382 0.8000 1.0000 1.5000 0.0000 Constraint 221 375 0.8000 1.0000 1.5000 0.0000 Constraint 221 355 0.8000 1.0000 1.5000 0.0000 Constraint 221 341 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 742 0.8000 1.0000 1.5000 0.0000 Constraint 210 735 0.8000 1.0000 1.5000 0.0000 Constraint 210 729 0.8000 1.0000 1.5000 0.0000 Constraint 210 720 0.8000 1.0000 1.5000 0.0000 Constraint 210 713 0.8000 1.0000 1.5000 0.0000 Constraint 210 706 0.8000 1.0000 1.5000 0.0000 Constraint 210 544 0.8000 1.0000 1.5000 0.0000 Constraint 210 535 0.8000 1.0000 1.5000 0.0000 Constraint 210 480 0.8000 1.0000 1.5000 0.0000 Constraint 210 375 0.8000 1.0000 1.5000 0.0000 Constraint 210 355 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 735 0.8000 1.0000 1.5000 0.0000 Constraint 201 720 0.8000 1.0000 1.5000 0.0000 Constraint 201 713 0.8000 1.0000 1.5000 0.0000 Constraint 201 706 0.8000 1.0000 1.5000 0.0000 Constraint 201 585 0.8000 1.0000 1.5000 0.0000 Constraint 201 571 0.8000 1.0000 1.5000 0.0000 Constraint 201 557 0.8000 1.0000 1.5000 0.0000 Constraint 201 544 0.8000 1.0000 1.5000 0.0000 Constraint 201 535 0.8000 1.0000 1.5000 0.0000 Constraint 201 527 0.8000 1.0000 1.5000 0.0000 Constraint 201 519 0.8000 1.0000 1.5000 0.0000 Constraint 201 497 0.8000 1.0000 1.5000 0.0000 Constraint 201 489 0.8000 1.0000 1.5000 0.0000 Constraint 201 480 0.8000 1.0000 1.5000 0.0000 Constraint 201 467 0.8000 1.0000 1.5000 0.0000 Constraint 201 461 0.8000 1.0000 1.5000 0.0000 Constraint 201 429 0.8000 1.0000 1.5000 0.0000 Constraint 201 404 0.8000 1.0000 1.5000 0.0000 Constraint 201 399 0.8000 1.0000 1.5000 0.0000 Constraint 201 391 0.8000 1.0000 1.5000 0.0000 Constraint 201 382 0.8000 1.0000 1.5000 0.0000 Constraint 201 375 0.8000 1.0000 1.5000 0.0000 Constraint 201 368 0.8000 1.0000 1.5000 0.0000 Constraint 201 360 0.8000 1.0000 1.5000 0.0000 Constraint 201 355 0.8000 1.0000 1.5000 0.0000 Constraint 201 350 0.8000 1.0000 1.5000 0.0000 Constraint 201 341 0.8000 1.0000 1.5000 0.0000 Constraint 201 330 0.8000 1.0000 1.5000 0.0000 Constraint 201 314 0.8000 1.0000 1.5000 0.0000 Constraint 201 303 0.8000 1.0000 1.5000 0.0000 Constraint 201 279 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 742 0.8000 1.0000 1.5000 0.0000 Constraint 190 735 0.8000 1.0000 1.5000 0.0000 Constraint 190 729 0.8000 1.0000 1.5000 0.0000 Constraint 190 720 0.8000 1.0000 1.5000 0.0000 Constraint 190 713 0.8000 1.0000 1.5000 0.0000 Constraint 190 706 0.8000 1.0000 1.5000 0.0000 Constraint 190 687 0.8000 1.0000 1.5000 0.0000 Constraint 190 676 0.8000 1.0000 1.5000 0.0000 Constraint 190 651 0.8000 1.0000 1.5000 0.0000 Constraint 190 613 0.8000 1.0000 1.5000 0.0000 Constraint 190 590 0.8000 1.0000 1.5000 0.0000 Constraint 190 585 0.8000 1.0000 1.5000 0.0000 Constraint 190 571 0.8000 1.0000 1.5000 0.0000 Constraint 190 557 0.8000 1.0000 1.5000 0.0000 Constraint 190 552 0.8000 1.0000 1.5000 0.0000 Constraint 190 544 0.8000 1.0000 1.5000 0.0000 Constraint 190 535 0.8000 1.0000 1.5000 0.0000 Constraint 190 527 0.8000 1.0000 1.5000 0.0000 Constraint 190 519 0.8000 1.0000 1.5000 0.0000 Constraint 190 511 0.8000 1.0000 1.5000 0.0000 Constraint 190 497 0.8000 1.0000 1.5000 0.0000 Constraint 190 489 0.8000 1.0000 1.5000 0.0000 Constraint 190 480 0.8000 1.0000 1.5000 0.0000 Constraint 190 473 0.8000 1.0000 1.5000 0.0000 Constraint 190 467 0.8000 1.0000 1.5000 0.0000 Constraint 190 461 0.8000 1.0000 1.5000 0.0000 Constraint 190 435 0.8000 1.0000 1.5000 0.0000 Constraint 190 429 0.8000 1.0000 1.5000 0.0000 Constraint 190 404 0.8000 1.0000 1.5000 0.0000 Constraint 190 399 0.8000 1.0000 1.5000 0.0000 Constraint 190 391 0.8000 1.0000 1.5000 0.0000 Constraint 190 382 0.8000 1.0000 1.5000 0.0000 Constraint 190 375 0.8000 1.0000 1.5000 0.0000 Constraint 190 368 0.8000 1.0000 1.5000 0.0000 Constraint 190 360 0.8000 1.0000 1.5000 0.0000 Constraint 190 355 0.8000 1.0000 1.5000 0.0000 Constraint 190 350 0.8000 1.0000 1.5000 0.0000 Constraint 190 341 0.8000 1.0000 1.5000 0.0000 Constraint 190 330 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 742 0.8000 1.0000 1.5000 0.0000 Constraint 182 735 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 720 0.8000 1.0000 1.5000 0.0000 Constraint 182 713 0.8000 1.0000 1.5000 0.0000 Constraint 182 687 0.8000 1.0000 1.5000 0.0000 Constraint 182 622 0.8000 1.0000 1.5000 0.0000 Constraint 182 613 0.8000 1.0000 1.5000 0.0000 Constraint 182 590 0.8000 1.0000 1.5000 0.0000 Constraint 182 585 0.8000 1.0000 1.5000 0.0000 Constraint 182 571 0.8000 1.0000 1.5000 0.0000 Constraint 182 557 0.8000 1.0000 1.5000 0.0000 Constraint 182 552 0.8000 1.0000 1.5000 0.0000 Constraint 182 544 0.8000 1.0000 1.5000 0.0000 Constraint 182 535 0.8000 1.0000 1.5000 0.0000 Constraint 182 519 0.8000 1.0000 1.5000 0.0000 Constraint 182 511 0.8000 1.0000 1.5000 0.0000 Constraint 182 461 0.8000 1.0000 1.5000 0.0000 Constraint 182 435 0.8000 1.0000 1.5000 0.0000 Constraint 182 382 0.8000 1.0000 1.5000 0.0000 Constraint 182 375 0.8000 1.0000 1.5000 0.0000 Constraint 182 368 0.8000 1.0000 1.5000 0.0000 Constraint 182 355 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 742 0.8000 1.0000 1.5000 0.0000 Constraint 176 735 0.8000 1.0000 1.5000 0.0000 Constraint 176 720 0.8000 1.0000 1.5000 0.0000 Constraint 176 713 0.8000 1.0000 1.5000 0.0000 Constraint 176 687 0.8000 1.0000 1.5000 0.0000 Constraint 176 613 0.8000 1.0000 1.5000 0.0000 Constraint 176 590 0.8000 1.0000 1.5000 0.0000 Constraint 176 585 0.8000 1.0000 1.5000 0.0000 Constraint 176 571 0.8000 1.0000 1.5000 0.0000 Constraint 176 557 0.8000 1.0000 1.5000 0.0000 Constraint 176 552 0.8000 1.0000 1.5000 0.0000 Constraint 176 544 0.8000 1.0000 1.5000 0.0000 Constraint 176 535 0.8000 1.0000 1.5000 0.0000 Constraint 176 527 0.8000 1.0000 1.5000 0.0000 Constraint 176 519 0.8000 1.0000 1.5000 0.0000 Constraint 176 511 0.8000 1.0000 1.5000 0.0000 Constraint 176 497 0.8000 1.0000 1.5000 0.0000 Constraint 176 489 0.8000 1.0000 1.5000 0.0000 Constraint 176 480 0.8000 1.0000 1.5000 0.0000 Constraint 176 467 0.8000 1.0000 1.5000 0.0000 Constraint 176 461 0.8000 1.0000 1.5000 0.0000 Constraint 176 435 0.8000 1.0000 1.5000 0.0000 Constraint 176 429 0.8000 1.0000 1.5000 0.0000 Constraint 176 404 0.8000 1.0000 1.5000 0.0000 Constraint 176 399 0.8000 1.0000 1.5000 0.0000 Constraint 176 391 0.8000 1.0000 1.5000 0.0000 Constraint 176 382 0.8000 1.0000 1.5000 0.0000 Constraint 176 375 0.8000 1.0000 1.5000 0.0000 Constraint 176 368 0.8000 1.0000 1.5000 0.0000 Constraint 176 360 0.8000 1.0000 1.5000 0.0000 Constraint 176 355 0.8000 1.0000 1.5000 0.0000 Constraint 176 350 0.8000 1.0000 1.5000 0.0000 Constraint 176 341 0.8000 1.0000 1.5000 0.0000 Constraint 176 330 0.8000 1.0000 1.5000 0.0000 Constraint 176 314 0.8000 1.0000 1.5000 0.0000 Constraint 176 303 0.8000 1.0000 1.5000 0.0000 Constraint 176 285 0.8000 1.0000 1.5000 0.0000 Constraint 176 250 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 742 0.8000 1.0000 1.5000 0.0000 Constraint 169 735 0.8000 1.0000 1.5000 0.0000 Constraint 169 729 0.8000 1.0000 1.5000 0.0000 Constraint 169 720 0.8000 1.0000 1.5000 0.0000 Constraint 169 713 0.8000 1.0000 1.5000 0.0000 Constraint 169 706 0.8000 1.0000 1.5000 0.0000 Constraint 169 571 0.8000 1.0000 1.5000 0.0000 Constraint 169 557 0.8000 1.0000 1.5000 0.0000 Constraint 169 519 0.8000 1.0000 1.5000 0.0000 Constraint 169 489 0.8000 1.0000 1.5000 0.0000 Constraint 169 404 0.8000 1.0000 1.5000 0.0000 Constraint 169 399 0.8000 1.0000 1.5000 0.0000 Constraint 169 391 0.8000 1.0000 1.5000 0.0000 Constraint 169 382 0.8000 1.0000 1.5000 0.0000 Constraint 169 375 0.8000 1.0000 1.5000 0.0000 Constraint 169 368 0.8000 1.0000 1.5000 0.0000 Constraint 169 360 0.8000 1.0000 1.5000 0.0000 Constraint 169 355 0.8000 1.0000 1.5000 0.0000 Constraint 169 341 0.8000 1.0000 1.5000 0.0000 Constraint 169 330 0.8000 1.0000 1.5000 0.0000 Constraint 169 303 0.8000 1.0000 1.5000 0.0000 Constraint 169 285 0.8000 1.0000 1.5000 0.0000 Constraint 169 279 0.8000 1.0000 1.5000 0.0000 Constraint 169 267 0.8000 1.0000 1.5000 0.0000 Constraint 169 250 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 713 0.8000 1.0000 1.5000 0.0000 Constraint 161 706 0.8000 1.0000 1.5000 0.0000 Constraint 161 698 0.8000 1.0000 1.5000 0.0000 Constraint 161 687 0.8000 1.0000 1.5000 0.0000 Constraint 161 657 0.8000 1.0000 1.5000 0.0000 Constraint 161 651 0.8000 1.0000 1.5000 0.0000 Constraint 161 622 0.8000 1.0000 1.5000 0.0000 Constraint 161 590 0.8000 1.0000 1.5000 0.0000 Constraint 161 571 0.8000 1.0000 1.5000 0.0000 Constraint 161 557 0.8000 1.0000 1.5000 0.0000 Constraint 161 552 0.8000 1.0000 1.5000 0.0000 Constraint 161 527 0.8000 1.0000 1.5000 0.0000 Constraint 161 519 0.8000 1.0000 1.5000 0.0000 Constraint 161 489 0.8000 1.0000 1.5000 0.0000 Constraint 161 461 0.8000 1.0000 1.5000 0.0000 Constraint 161 435 0.8000 1.0000 1.5000 0.0000 Constraint 161 429 0.8000 1.0000 1.5000 0.0000 Constraint 161 421 0.8000 1.0000 1.5000 0.0000 Constraint 161 412 0.8000 1.0000 1.5000 0.0000 Constraint 161 404 0.8000 1.0000 1.5000 0.0000 Constraint 161 399 0.8000 1.0000 1.5000 0.0000 Constraint 161 391 0.8000 1.0000 1.5000 0.0000 Constraint 161 382 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 368 0.8000 1.0000 1.5000 0.0000 Constraint 161 360 0.8000 1.0000 1.5000 0.0000 Constraint 161 355 0.8000 1.0000 1.5000 0.0000 Constraint 161 350 0.8000 1.0000 1.5000 0.0000 Constraint 161 341 0.8000 1.0000 1.5000 0.0000 Constraint 161 330 0.8000 1.0000 1.5000 0.0000 Constraint 161 322 0.8000 1.0000 1.5000 0.0000 Constraint 161 314 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 297 0.8000 1.0000 1.5000 0.0000 Constraint 161 292 0.8000 1.0000 1.5000 0.0000 Constraint 161 285 0.8000 1.0000 1.5000 0.0000 Constraint 161 279 0.8000 1.0000 1.5000 0.0000 Constraint 161 272 0.8000 1.0000 1.5000 0.0000 Constraint 161 267 0.8000 1.0000 1.5000 0.0000 Constraint 161 259 0.8000 1.0000 1.5000 0.0000 Constraint 161 250 0.8000 1.0000 1.5000 0.0000 Constraint 161 242 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 742 0.8000 1.0000 1.5000 0.0000 Constraint 153 735 0.8000 1.0000 1.5000 0.0000 Constraint 153 729 0.8000 1.0000 1.5000 0.0000 Constraint 153 720 0.8000 1.0000 1.5000 0.0000 Constraint 153 713 0.8000 1.0000 1.5000 0.0000 Constraint 153 706 0.8000 1.0000 1.5000 0.0000 Constraint 153 480 0.8000 1.0000 1.5000 0.0000 Constraint 153 467 0.8000 1.0000 1.5000 0.0000 Constraint 153 404 0.8000 1.0000 1.5000 0.0000 Constraint 153 399 0.8000 1.0000 1.5000 0.0000 Constraint 153 391 0.8000 1.0000 1.5000 0.0000 Constraint 153 382 0.8000 1.0000 1.5000 0.0000 Constraint 153 375 0.8000 1.0000 1.5000 0.0000 Constraint 153 368 0.8000 1.0000 1.5000 0.0000 Constraint 153 360 0.8000 1.0000 1.5000 0.0000 Constraint 153 355 0.8000 1.0000 1.5000 0.0000 Constraint 153 350 0.8000 1.0000 1.5000 0.0000 Constraint 153 341 0.8000 1.0000 1.5000 0.0000 Constraint 153 330 0.8000 1.0000 1.5000 0.0000 Constraint 153 303 0.8000 1.0000 1.5000 0.0000 Constraint 153 297 0.8000 1.0000 1.5000 0.0000 Constraint 153 285 0.8000 1.0000 1.5000 0.0000 Constraint 153 279 0.8000 1.0000 1.5000 0.0000 Constraint 153 267 0.8000 1.0000 1.5000 0.0000 Constraint 153 259 0.8000 1.0000 1.5000 0.0000 Constraint 153 250 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 742 0.8000 1.0000 1.5000 0.0000 Constraint 144 735 0.8000 1.0000 1.5000 0.0000 Constraint 144 729 0.8000 1.0000 1.5000 0.0000 Constraint 144 720 0.8000 1.0000 1.5000 0.0000 Constraint 144 713 0.8000 1.0000 1.5000 0.0000 Constraint 144 706 0.8000 1.0000 1.5000 0.0000 Constraint 144 698 0.8000 1.0000 1.5000 0.0000 Constraint 144 687 0.8000 1.0000 1.5000 0.0000 Constraint 144 651 0.8000 1.0000 1.5000 0.0000 Constraint 144 622 0.8000 1.0000 1.5000 0.0000 Constraint 144 467 0.8000 1.0000 1.5000 0.0000 Constraint 144 435 0.8000 1.0000 1.5000 0.0000 Constraint 144 412 0.8000 1.0000 1.5000 0.0000 Constraint 144 404 0.8000 1.0000 1.5000 0.0000 Constraint 144 399 0.8000 1.0000 1.5000 0.0000 Constraint 144 391 0.8000 1.0000 1.5000 0.0000 Constraint 144 382 0.8000 1.0000 1.5000 0.0000 Constraint 144 375 0.8000 1.0000 1.5000 0.0000 Constraint 144 368 0.8000 1.0000 1.5000 0.0000 Constraint 144 360 0.8000 1.0000 1.5000 0.0000 Constraint 144 355 0.8000 1.0000 1.5000 0.0000 Constraint 144 350 0.8000 1.0000 1.5000 0.0000 Constraint 144 341 0.8000 1.0000 1.5000 0.0000 Constraint 144 330 0.8000 1.0000 1.5000 0.0000 Constraint 144 314 0.8000 1.0000 1.5000 0.0000 Constraint 144 303 0.8000 1.0000 1.5000 0.0000 Constraint 144 297 0.8000 1.0000 1.5000 0.0000 Constraint 144 292 0.8000 1.0000 1.5000 0.0000 Constraint 144 285 0.8000 1.0000 1.5000 0.0000 Constraint 144 279 0.8000 1.0000 1.5000 0.0000 Constraint 144 272 0.8000 1.0000 1.5000 0.0000 Constraint 144 267 0.8000 1.0000 1.5000 0.0000 Constraint 144 259 0.8000 1.0000 1.5000 0.0000 Constraint 144 250 0.8000 1.0000 1.5000 0.0000 Constraint 144 221 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 742 0.8000 1.0000 1.5000 0.0000 Constraint 136 735 0.8000 1.0000 1.5000 0.0000 Constraint 136 729 0.8000 1.0000 1.5000 0.0000 Constraint 136 720 0.8000 1.0000 1.5000 0.0000 Constraint 136 713 0.8000 1.0000 1.5000 0.0000 Constraint 136 706 0.8000 1.0000 1.5000 0.0000 Constraint 136 698 0.8000 1.0000 1.5000 0.0000 Constraint 136 687 0.8000 1.0000 1.5000 0.0000 Constraint 136 676 0.8000 1.0000 1.5000 0.0000 Constraint 136 571 0.8000 1.0000 1.5000 0.0000 Constraint 136 552 0.8000 1.0000 1.5000 0.0000 Constraint 136 544 0.8000 1.0000 1.5000 0.0000 Constraint 136 519 0.8000 1.0000 1.5000 0.0000 Constraint 136 511 0.8000 1.0000 1.5000 0.0000 Constraint 136 489 0.8000 1.0000 1.5000 0.0000 Constraint 136 467 0.8000 1.0000 1.5000 0.0000 Constraint 136 435 0.8000 1.0000 1.5000 0.0000 Constraint 136 429 0.8000 1.0000 1.5000 0.0000 Constraint 136 412 0.8000 1.0000 1.5000 0.0000 Constraint 136 391 0.8000 1.0000 1.5000 0.0000 Constraint 136 375 0.8000 1.0000 1.5000 0.0000 Constraint 136 368 0.8000 1.0000 1.5000 0.0000 Constraint 136 360 0.8000 1.0000 1.5000 0.0000 Constraint 136 355 0.8000 1.0000 1.5000 0.0000 Constraint 136 350 0.8000 1.0000 1.5000 0.0000 Constraint 136 303 0.8000 1.0000 1.5000 0.0000 Constraint 136 285 0.8000 1.0000 1.5000 0.0000 Constraint 136 279 0.8000 1.0000 1.5000 0.0000 Constraint 136 267 0.8000 1.0000 1.5000 0.0000 Constraint 136 259 0.8000 1.0000 1.5000 0.0000 Constraint 136 250 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 742 0.8000 1.0000 1.5000 0.0000 Constraint 128 735 0.8000 1.0000 1.5000 0.0000 Constraint 128 729 0.8000 1.0000 1.5000 0.0000 Constraint 128 720 0.8000 1.0000 1.5000 0.0000 Constraint 128 713 0.8000 1.0000 1.5000 0.0000 Constraint 128 706 0.8000 1.0000 1.5000 0.0000 Constraint 128 698 0.8000 1.0000 1.5000 0.0000 Constraint 128 687 0.8000 1.0000 1.5000 0.0000 Constraint 128 571 0.8000 1.0000 1.5000 0.0000 Constraint 128 544 0.8000 1.0000 1.5000 0.0000 Constraint 128 382 0.8000 1.0000 1.5000 0.0000 Constraint 128 375 0.8000 1.0000 1.5000 0.0000 Constraint 128 368 0.8000 1.0000 1.5000 0.0000 Constraint 128 355 0.8000 1.0000 1.5000 0.0000 Constraint 128 279 0.8000 1.0000 1.5000 0.0000 Constraint 128 267 0.8000 1.0000 1.5000 0.0000 Constraint 128 250 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 742 0.8000 1.0000 1.5000 0.0000 Constraint 122 735 0.8000 1.0000 1.5000 0.0000 Constraint 122 729 0.8000 1.0000 1.5000 0.0000 Constraint 122 720 0.8000 1.0000 1.5000 0.0000 Constraint 122 713 0.8000 1.0000 1.5000 0.0000 Constraint 122 706 0.8000 1.0000 1.5000 0.0000 Constraint 122 698 0.8000 1.0000 1.5000 0.0000 Constraint 122 687 0.8000 1.0000 1.5000 0.0000 Constraint 122 382 0.8000 1.0000 1.5000 0.0000 Constraint 122 375 0.8000 1.0000 1.5000 0.0000 Constraint 122 368 0.8000 1.0000 1.5000 0.0000 Constraint 122 355 0.8000 1.0000 1.5000 0.0000 Constraint 122 303 0.8000 1.0000 1.5000 0.0000 Constraint 122 285 0.8000 1.0000 1.5000 0.0000 Constraint 122 279 0.8000 1.0000 1.5000 0.0000 Constraint 122 267 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 742 0.8000 1.0000 1.5000 0.0000 Constraint 113 735 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 720 0.8000 1.0000 1.5000 0.0000 Constraint 113 713 0.8000 1.0000 1.5000 0.0000 Constraint 113 706 0.8000 1.0000 1.5000 0.0000 Constraint 113 698 0.8000 1.0000 1.5000 0.0000 Constraint 113 687 0.8000 1.0000 1.5000 0.0000 Constraint 113 676 0.8000 1.0000 1.5000 0.0000 Constraint 113 668 0.8000 1.0000 1.5000 0.0000 Constraint 113 613 0.8000 1.0000 1.5000 0.0000 Constraint 113 590 0.8000 1.0000 1.5000 0.0000 Constraint 113 571 0.8000 1.0000 1.5000 0.0000 Constraint 113 480 0.8000 1.0000 1.5000 0.0000 Constraint 113 435 0.8000 1.0000 1.5000 0.0000 Constraint 113 412 0.8000 1.0000 1.5000 0.0000 Constraint 113 382 0.8000 1.0000 1.5000 0.0000 Constraint 113 375 0.8000 1.0000 1.5000 0.0000 Constraint 113 368 0.8000 1.0000 1.5000 0.0000 Constraint 113 355 0.8000 1.0000 1.5000 0.0000 Constraint 113 350 0.8000 1.0000 1.5000 0.0000 Constraint 113 330 0.8000 1.0000 1.5000 0.0000 Constraint 113 303 0.8000 1.0000 1.5000 0.0000 Constraint 113 285 0.8000 1.0000 1.5000 0.0000 Constraint 113 279 0.8000 1.0000 1.5000 0.0000 Constraint 113 272 0.8000 1.0000 1.5000 0.0000 Constraint 113 267 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 742 0.8000 1.0000 1.5000 0.0000 Constraint 104 735 0.8000 1.0000 1.5000 0.0000 Constraint 104 729 0.8000 1.0000 1.5000 0.0000 Constraint 104 720 0.8000 1.0000 1.5000 0.0000 Constraint 104 713 0.8000 1.0000 1.5000 0.0000 Constraint 104 706 0.8000 1.0000 1.5000 0.0000 Constraint 104 698 0.8000 1.0000 1.5000 0.0000 Constraint 104 676 0.8000 1.0000 1.5000 0.0000 Constraint 104 668 0.8000 1.0000 1.5000 0.0000 Constraint 104 544 0.8000 1.0000 1.5000 0.0000 Constraint 104 519 0.8000 1.0000 1.5000 0.0000 Constraint 104 511 0.8000 1.0000 1.5000 0.0000 Constraint 104 375 0.8000 1.0000 1.5000 0.0000 Constraint 104 368 0.8000 1.0000 1.5000 0.0000 Constraint 104 355 0.8000 1.0000 1.5000 0.0000 Constraint 104 279 0.8000 1.0000 1.5000 0.0000 Constraint 104 267 0.8000 1.0000 1.5000 0.0000 Constraint 104 250 0.8000 1.0000 1.5000 0.0000 Constraint 104 226 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 729 0.8000 1.0000 1.5000 0.0000 Constraint 96 720 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 698 0.8000 1.0000 1.5000 0.0000 Constraint 96 687 0.8000 1.0000 1.5000 0.0000 Constraint 96 676 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 729 0.8000 1.0000 1.5000 0.0000 Constraint 88 720 0.8000 1.0000 1.5000 0.0000 Constraint 88 713 0.8000 1.0000 1.5000 0.0000 Constraint 88 706 0.8000 1.0000 1.5000 0.0000 Constraint 88 698 0.8000 1.0000 1.5000 0.0000 Constraint 88 687 0.8000 1.0000 1.5000 0.0000 Constraint 88 676 0.8000 1.0000 1.5000 0.0000 Constraint 88 668 0.8000 1.0000 1.5000 0.0000 Constraint 88 636 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 676 0.8000 1.0000 1.5000 0.0000 Constraint 80 668 0.8000 1.0000 1.5000 0.0000 Constraint 80 644 0.8000 1.0000 1.5000 0.0000 Constraint 80 636 0.8000 1.0000 1.5000 0.0000 Constraint 80 613 0.8000 1.0000 1.5000 0.0000 Constraint 80 604 0.8000 1.0000 1.5000 0.0000 Constraint 80 590 0.8000 1.0000 1.5000 0.0000 Constraint 80 585 0.8000 1.0000 1.5000 0.0000 Constraint 80 577 0.8000 1.0000 1.5000 0.0000 Constraint 80 571 0.8000 1.0000 1.5000 0.0000 Constraint 80 480 0.8000 1.0000 1.5000 0.0000 Constraint 80 473 0.8000 1.0000 1.5000 0.0000 Constraint 80 467 0.8000 1.0000 1.5000 0.0000 Constraint 80 435 0.8000 1.0000 1.5000 0.0000 Constraint 80 412 0.8000 1.0000 1.5000 0.0000 Constraint 80 404 0.8000 1.0000 1.5000 0.0000 Constraint 80 368 0.8000 1.0000 1.5000 0.0000 Constraint 80 279 0.8000 1.0000 1.5000 0.0000 Constraint 80 272 0.8000 1.0000 1.5000 0.0000 Constraint 80 267 0.8000 1.0000 1.5000 0.0000 Constraint 80 250 0.8000 1.0000 1.5000 0.0000 Constraint 80 226 0.8000 1.0000 1.5000 0.0000 Constraint 80 201 0.8000 1.0000 1.5000 0.0000 Constraint 80 190 0.8000 1.0000 1.5000 0.0000 Constraint 80 176 0.8000 1.0000 1.5000 0.0000 Constraint 80 161 0.8000 1.0000 1.5000 0.0000 Constraint 80 153 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 657 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 636 0.8000 1.0000 1.5000 0.0000 Constraint 69 629 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 604 0.8000 1.0000 1.5000 0.0000 Constraint 69 599 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 585 0.8000 1.0000 1.5000 0.0000 Constraint 69 577 0.8000 1.0000 1.5000 0.0000 Constraint 69 571 0.8000 1.0000 1.5000 0.0000 Constraint 69 557 0.8000 1.0000 1.5000 0.0000 Constraint 69 552 0.8000 1.0000 1.5000 0.0000 Constraint 69 544 0.8000 1.0000 1.5000 0.0000 Constraint 69 535 0.8000 1.0000 1.5000 0.0000 Constraint 69 442 0.8000 1.0000 1.5000 0.0000 Constraint 69 435 0.8000 1.0000 1.5000 0.0000 Constraint 69 297 0.8000 1.0000 1.5000 0.0000 Constraint 69 279 0.8000 1.0000 1.5000 0.0000 Constraint 69 272 0.8000 1.0000 1.5000 0.0000 Constraint 69 267 0.8000 1.0000 1.5000 0.0000 Constraint 69 250 0.8000 1.0000 1.5000 0.0000 Constraint 69 242 0.8000 1.0000 1.5000 0.0000 Constraint 69 237 0.8000 1.0000 1.5000 0.0000 Constraint 69 226 0.8000 1.0000 1.5000 0.0000 Constraint 69 221 0.8000 1.0000 1.5000 0.0000 Constraint 69 201 0.8000 1.0000 1.5000 0.0000 Constraint 69 190 0.8000 1.0000 1.5000 0.0000 Constraint 69 182 0.8000 1.0000 1.5000 0.0000 Constraint 69 176 0.8000 1.0000 1.5000 0.0000 Constraint 69 169 0.8000 1.0000 1.5000 0.0000 Constraint 69 161 0.8000 1.0000 1.5000 0.0000 Constraint 69 153 0.8000 1.0000 1.5000 0.0000 Constraint 69 144 0.8000 1.0000 1.5000 0.0000 Constraint 69 136 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 590 0.8000 1.0000 1.5000 0.0000 Constraint 58 585 0.8000 1.0000 1.5000 0.0000 Constraint 58 577 0.8000 1.0000 1.5000 0.0000 Constraint 58 571 0.8000 1.0000 1.5000 0.0000 Constraint 58 557 0.8000 1.0000 1.5000 0.0000 Constraint 58 552 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 535 0.8000 1.0000 1.5000 0.0000 Constraint 58 489 0.8000 1.0000 1.5000 0.0000 Constraint 58 480 0.8000 1.0000 1.5000 0.0000 Constraint 58 473 0.8000 1.0000 1.5000 0.0000 Constraint 58 467 0.8000 1.0000 1.5000 0.0000 Constraint 58 461 0.8000 1.0000 1.5000 0.0000 Constraint 58 449 0.8000 1.0000 1.5000 0.0000 Constraint 58 442 0.8000 1.0000 1.5000 0.0000 Constraint 58 435 0.8000 1.0000 1.5000 0.0000 Constraint 58 429 0.8000 1.0000 1.5000 0.0000 Constraint 58 421 0.8000 1.0000 1.5000 0.0000 Constraint 58 412 0.8000 1.0000 1.5000 0.0000 Constraint 58 404 0.8000 1.0000 1.5000 0.0000 Constraint 58 391 0.8000 1.0000 1.5000 0.0000 Constraint 58 382 0.8000 1.0000 1.5000 0.0000 Constraint 58 368 0.8000 1.0000 1.5000 0.0000 Constraint 58 303 0.8000 1.0000 1.5000 0.0000 Constraint 58 297 0.8000 1.0000 1.5000 0.0000 Constraint 58 292 0.8000 1.0000 1.5000 0.0000 Constraint 58 285 0.8000 1.0000 1.5000 0.0000 Constraint 58 279 0.8000 1.0000 1.5000 0.0000 Constraint 58 272 0.8000 1.0000 1.5000 0.0000 Constraint 58 267 0.8000 1.0000 1.5000 0.0000 Constraint 58 259 0.8000 1.0000 1.5000 0.0000 Constraint 58 250 0.8000 1.0000 1.5000 0.0000 Constraint 58 242 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 226 0.8000 1.0000 1.5000 0.0000 Constraint 58 221 0.8000 1.0000 1.5000 0.0000 Constraint 58 210 0.8000 1.0000 1.5000 0.0000 Constraint 58 201 0.8000 1.0000 1.5000 0.0000 Constraint 58 190 0.8000 1.0000 1.5000 0.0000 Constraint 58 182 0.8000 1.0000 1.5000 0.0000 Constraint 58 176 0.8000 1.0000 1.5000 0.0000 Constraint 58 169 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 153 0.8000 1.0000 1.5000 0.0000 Constraint 58 144 0.8000 1.0000 1.5000 0.0000 Constraint 58 136 0.8000 1.0000 1.5000 0.0000 Constraint 58 128 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 552 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 473 0.8000 1.0000 1.5000 0.0000 Constraint 51 467 0.8000 1.0000 1.5000 0.0000 Constraint 51 461 0.8000 1.0000 1.5000 0.0000 Constraint 51 449 0.8000 1.0000 1.5000 0.0000 Constraint 51 442 0.8000 1.0000 1.5000 0.0000 Constraint 51 435 0.8000 1.0000 1.5000 0.0000 Constraint 51 429 0.8000 1.0000 1.5000 0.0000 Constraint 51 421 0.8000 1.0000 1.5000 0.0000 Constraint 51 412 0.8000 1.0000 1.5000 0.0000 Constraint 51 404 0.8000 1.0000 1.5000 0.0000 Constraint 51 399 0.8000 1.0000 1.5000 0.0000 Constraint 51 391 0.8000 1.0000 1.5000 0.0000 Constraint 51 382 0.8000 1.0000 1.5000 0.0000 Constraint 51 368 0.8000 1.0000 1.5000 0.0000 Constraint 51 360 0.8000 1.0000 1.5000 0.0000 Constraint 51 355 0.8000 1.0000 1.5000 0.0000 Constraint 51 350 0.8000 1.0000 1.5000 0.0000 Constraint 51 341 0.8000 1.0000 1.5000 0.0000 Constraint 51 330 0.8000 1.0000 1.5000 0.0000 Constraint 51 303 0.8000 1.0000 1.5000 0.0000 Constraint 51 297 0.8000 1.0000 1.5000 0.0000 Constraint 51 292 0.8000 1.0000 1.5000 0.0000 Constraint 51 279 0.8000 1.0000 1.5000 0.0000 Constraint 51 272 0.8000 1.0000 1.5000 0.0000 Constraint 51 267 0.8000 1.0000 1.5000 0.0000 Constraint 51 237 0.8000 1.0000 1.5000 0.0000 Constraint 51 226 0.8000 1.0000 1.5000 0.0000 Constraint 51 221 0.8000 1.0000 1.5000 0.0000 Constraint 51 210 0.8000 1.0000 1.5000 0.0000 Constraint 51 201 0.8000 1.0000 1.5000 0.0000 Constraint 51 190 0.8000 1.0000 1.5000 0.0000 Constraint 51 182 0.8000 1.0000 1.5000 0.0000 Constraint 51 176 0.8000 1.0000 1.5000 0.0000 Constraint 51 169 0.8000 1.0000 1.5000 0.0000 Constraint 51 161 0.8000 1.0000 1.5000 0.0000 Constraint 51 153 0.8000 1.0000 1.5000 0.0000 Constraint 51 144 0.8000 1.0000 1.5000 0.0000 Constraint 51 136 0.8000 1.0000 1.5000 0.0000 Constraint 51 128 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 489 0.8000 1.0000 1.5000 0.0000 Constraint 41 480 0.8000 1.0000 1.5000 0.0000 Constraint 41 473 0.8000 1.0000 1.5000 0.0000 Constraint 41 467 0.8000 1.0000 1.5000 0.0000 Constraint 41 461 0.8000 1.0000 1.5000 0.0000 Constraint 41 449 0.8000 1.0000 1.5000 0.0000 Constraint 41 442 0.8000 1.0000 1.5000 0.0000 Constraint 41 435 0.8000 1.0000 1.5000 0.0000 Constraint 41 429 0.8000 1.0000 1.5000 0.0000 Constraint 41 421 0.8000 1.0000 1.5000 0.0000 Constraint 41 412 0.8000 1.0000 1.5000 0.0000 Constraint 41 404 0.8000 1.0000 1.5000 0.0000 Constraint 41 399 0.8000 1.0000 1.5000 0.0000 Constraint 41 391 0.8000 1.0000 1.5000 0.0000 Constraint 41 382 0.8000 1.0000 1.5000 0.0000 Constraint 41 375 0.8000 1.0000 1.5000 0.0000 Constraint 41 368 0.8000 1.0000 1.5000 0.0000 Constraint 41 360 0.8000 1.0000 1.5000 0.0000 Constraint 41 355 0.8000 1.0000 1.5000 0.0000 Constraint 41 350 0.8000 1.0000 1.5000 0.0000 Constraint 41 341 0.8000 1.0000 1.5000 0.0000 Constraint 41 330 0.8000 1.0000 1.5000 0.0000 Constraint 41 322 0.8000 1.0000 1.5000 0.0000 Constraint 41 314 0.8000 1.0000 1.5000 0.0000 Constraint 41 303 0.8000 1.0000 1.5000 0.0000 Constraint 41 297 0.8000 1.0000 1.5000 0.0000 Constraint 41 292 0.8000 1.0000 1.5000 0.0000 Constraint 41 285 0.8000 1.0000 1.5000 0.0000 Constraint 41 279 0.8000 1.0000 1.5000 0.0000 Constraint 41 272 0.8000 1.0000 1.5000 0.0000 Constraint 41 267 0.8000 1.0000 1.5000 0.0000 Constraint 41 259 0.8000 1.0000 1.5000 0.0000 Constraint 41 250 0.8000 1.0000 1.5000 0.0000 Constraint 41 242 0.8000 1.0000 1.5000 0.0000 Constraint 41 237 0.8000 1.0000 1.5000 0.0000 Constraint 41 226 0.8000 1.0000 1.5000 0.0000 Constraint 41 221 0.8000 1.0000 1.5000 0.0000 Constraint 41 210 0.8000 1.0000 1.5000 0.0000 Constraint 41 201 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 182 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 169 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 153 0.8000 1.0000 1.5000 0.0000 Constraint 41 144 0.8000 1.0000 1.5000 0.0000 Constraint 41 136 0.8000 1.0000 1.5000 0.0000 Constraint 41 128 0.8000 1.0000 1.5000 0.0000 Constraint 41 122 0.8000 1.0000 1.5000 0.0000 Constraint 41 113 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 552 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 511 0.8000 1.0000 1.5000 0.0000 Constraint 33 497 0.8000 1.0000 1.5000 0.0000 Constraint 33 489 0.8000 1.0000 1.5000 0.0000 Constraint 33 480 0.8000 1.0000 1.5000 0.0000 Constraint 33 473 0.8000 1.0000 1.5000 0.0000 Constraint 33 467 0.8000 1.0000 1.5000 0.0000 Constraint 33 461 0.8000 1.0000 1.5000 0.0000 Constraint 33 449 0.8000 1.0000 1.5000 0.0000 Constraint 33 442 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 429 0.8000 1.0000 1.5000 0.0000 Constraint 33 421 0.8000 1.0000 1.5000 0.0000 Constraint 33 412 0.8000 1.0000 1.5000 0.0000 Constraint 33 404 0.8000 1.0000 1.5000 0.0000 Constraint 33 399 0.8000 1.0000 1.5000 0.0000 Constraint 33 391 0.8000 1.0000 1.5000 0.0000 Constraint 33 382 0.8000 1.0000 1.5000 0.0000 Constraint 33 375 0.8000 1.0000 1.5000 0.0000 Constraint 33 368 0.8000 1.0000 1.5000 0.0000 Constraint 33 360 0.8000 1.0000 1.5000 0.0000 Constraint 33 355 0.8000 1.0000 1.5000 0.0000 Constraint 33 350 0.8000 1.0000 1.5000 0.0000 Constraint 33 341 0.8000 1.0000 1.5000 0.0000 Constraint 33 330 0.8000 1.0000 1.5000 0.0000 Constraint 33 322 0.8000 1.0000 1.5000 0.0000 Constraint 33 314 0.8000 1.0000 1.5000 0.0000 Constraint 33 303 0.8000 1.0000 1.5000 0.0000 Constraint 33 297 0.8000 1.0000 1.5000 0.0000 Constraint 33 292 0.8000 1.0000 1.5000 0.0000 Constraint 33 279 0.8000 1.0000 1.5000 0.0000 Constraint 33 272 0.8000 1.0000 1.5000 0.0000 Constraint 33 267 0.8000 1.0000 1.5000 0.0000 Constraint 33 237 0.8000 1.0000 1.5000 0.0000 Constraint 33 226 0.8000 1.0000 1.5000 0.0000 Constraint 33 221 0.8000 1.0000 1.5000 0.0000 Constraint 33 210 0.8000 1.0000 1.5000 0.0000 Constraint 33 201 0.8000 1.0000 1.5000 0.0000 Constraint 33 190 0.8000 1.0000 1.5000 0.0000 Constraint 33 182 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 169 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 153 0.8000 1.0000 1.5000 0.0000 Constraint 33 144 0.8000 1.0000 1.5000 0.0000 Constraint 33 136 0.8000 1.0000 1.5000 0.0000 Constraint 33 128 0.8000 1.0000 1.5000 0.0000 Constraint 33 122 0.8000 1.0000 1.5000 0.0000 Constraint 33 113 0.8000 1.0000 1.5000 0.0000 Constraint 33 104 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: