parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 12.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint (T0311)F27.CB (T0311)S39.CB 5.9239 9.8732 12.8351 90.5403 Constraint (T0311)F27.CB (T0311)A38.CB 3.3384 5.5640 7.2332 90.5403 Constraint (T0311)F27.CB (T0311)T37.CB 6.0956 10.1594 13.2072 90.5403 Constraint (T0311)L24.CB (T0311)S39.CB 3.5866 5.9776 7.7709 90.5403 Constraint (T0311)L24.CB (T0311)A38.CB 3.0971 5.1618 6.7103 90.5403 Constraint (T0311)L24.CB (T0311)T37.CB 5.8761 9.7935 12.7316 90.5403 Constraint (T0311)L24.CB (T0311)I33.CB 5.9166 9.8609 12.8192 90.5403 Constraint (T0311)S23.CB (T0311)A38.CB 5.8233 9.7056 12.6172 90.5403 Constraint (T0311)L24.CB (T0311)R40.CB 6.2987 10.4978 13.6472 88.4470 Constraint (T0311)E26.CB (T0311)A38.CB 5.7776 9.6293 12.5181 87.8820 Constraint (T0311)R25.CB (T0311)S39.CB 6.0167 10.0278 13.0362 87.8820 Constraint (T0311)R25.CB (T0311)A38.CB 4.9868 8.3113 10.8047 87.8820 Constraint (T0311)L24.CB (T0311)S36.CB 5.5102 9.1836 11.9387 87.7474 Constraint (T0311)L24.CB (T0311)P35.CB 3.2458 5.4097 7.0326 87.7474 Constraint (T0311)L24.CB (T0311)A34.CB 5.9589 9.9315 12.9110 87.7474 Constraint (T0311)S23.CB (T0311)P35.CB 5.3546 8.9243 11.6016 87.7474 Constraint (T0311)F27.CB (T0311)L41.CB 5.7969 9.6615 12.5600 87.6284 Constraint (T0311)A28.CB (T0311)S39.CB 5.1937 8.6561 11.2530 87.5403 Constraint (T0311)A28.CB (T0311)A38.CB 2.8086 4.6810 6.0853 87.5403 Constraint (T0311)A28.CB (T0311)T37.CB 4.2218 7.0364 9.1473 87.5403 Constraint (T0311)M31.CB (T0311)L41.CB 5.8517 9.7528 12.6786 86.6829 Constraint (T0311)L24.CB (T0311)L42.CB 4.4686 7.4476 9.6819 85.5352 Constraint (T0311)L24.CB (T0311)L41.CB 5.9116 9.8527 12.8085 85.5352 Constraint (T0311)E26.CB (T0311)P35.CB 5.7320 9.5533 12.4193 85.0891 Constraint (T0311)R25.CB (T0311)P35.CB 3.2009 5.3348 6.9352 85.0891 Constraint (T0311)R25.CB (T0311)A34.CB 5.8094 9.6823 12.5870 85.0891 Constraint (T0311)R29.CB (T0311)A38.CB 5.7993 9.6655 12.5651 84.8820 Constraint (T0311)A28.CB (T0311)L41.CB 6.0445 10.0741 13.0964 84.6284 Constraint (T0311)A28.CB (T0311)R40.CB 6.5745 10.9574 14.2447 84.5403 Constraint (T0311)F27.CB (T0311)L42.CB 5.3923 8.9872 11.6834 82.9643 Constraint (T0311)R25.CB (T0311)S36.CB 6.3463 10.5772 13.7504 82.2524 Constraint (T0311)V22.CB (T0311)A38.CB 6.1763 10.2939 13.3821 81.6748 Constraint (T0311)A28.CB (T0311)L42.CB 6.4212 10.7020 13.9126 79.9643 Constraint (T0311)S23.CB (T0311)S39.CB 6.5397 10.8996 14.1694 78.5997 Constraint (T0311)A38.CB (T0311)L56.CB 4.8115 8.0192 10.4250 78.3386 Constraint (T0311)F27.CB (T0311)L56.CB 4.4614 7.4357 9.6664 78.3386 Constraint (T0311)L24.CB (T0311)T43.CB 6.3305 10.5509 13.7162 77.1665 Constraint (T0311)L41.CB (T0311)A53.CB 5.1028 8.5047 11.0561 76.9691 Constraint (T0311)L17.CB (T0311)F27.CB 3.6828 6.1379 7.9793 76.5309 Constraint (T0311)L41.CB (T0311)L56.CB 4.5224 7.5374 9.7986 76.4248 Constraint (T0311)M31.CB (T0311)L56.CB 3.6518 6.0863 7.9122 75.6058 Constraint (T0311)I33.CB (T0311)L56.CB 5.0301 8.3834 10.8985 74.5512 Constraint (T0311)M31.CB (T0311)K55.CB 3.1264 5.2107 6.7739 73.5126 Constraint (T0311)L17.CB (T0311)E26.CB 5.2664 8.7773 11.4105 72.9769 Constraint (T0311)I33.CB (T0311)K55.CB 4.8464 8.0773 10.5005 72.4580 Constraint (T0311)M31.CB (T0311)A53.CB 6.0642 10.1071 13.1392 72.3310 Constraint (T0311)A30.CB (T0311)L56.CB 5.4119 9.0199 11.7259 71.7999 Constraint (T0311)L42.CB (T0311)L56.CB 5.8757 9.7929 12.7307 71.6333 Constraint (T0311)M31.CB (T0311)V58.CB 5.2489 8.7481 11.3725 71.5279 Constraint (T0311)M31.CB (T0311)I54.CB 5.9348 9.8913 12.8587 71.4972 Constraint (T0311)F27.CB (T0311)K55.CB 5.8859 9.8098 12.7527 71.4582 Constraint (T0311)I13.CB (T0311)F27.CB 4.9889 8.3149 10.8094 71.4434 Constraint (T0311)S16.CB (T0311)F27.CB 5.3158 8.8596 11.5175 71.3017 Constraint (T0311)F27.CB (T0311)V59.CB 3.8227 6.3711 8.2825 71.1401 Constraint (T0311)M31.CB (T0311)S57.CB 5.9297 9.8828 12.8477 70.9416 Constraint (T0311)Q14.CB (T0311)L42.CB 3.7057 6.1761 8.0290 70.9301 Constraint (T0311)I13.CB (T0311)A38.CB 5.0963 8.4938 11.0419 70.8477 Constraint (T0311)Q14.CB (T0311)F27.CB 5.9954 9.9923 12.9900 70.5405 Constraint (T0311)M31.CB (T0311)V59.CB 3.5065 5.8442 7.5975 70.1945 Constraint (T0311)E32.CB (T0311)K55.CB 4.4213 7.3689 9.5796 69.6212 Constraint (T0311)A30.CB (T0311)K55.CB 4.9676 8.2794 10.7632 68.8000 Constraint (T0311)A28.CB (T0311)L56.CB 5.6861 9.4769 12.3200 68.5594 Constraint (T0311)I13.CB (T0311)L42.CB 3.6463 6.0771 7.9003 68.5316 Constraint (T0311)I13.CB (T0311)L41.CB 4.1430 6.9050 8.9765 68.5316 Constraint (T0311)A30.CB (T0311)V59.CB 3.1111 5.1852 6.7407 68.4818 Constraint (T0311)L17.CB (T0311)L42.CB 4.7997 7.9995 10.3993 68.3592 Constraint (T0311)S23.CB (T0311)L42.CB 6.8805 11.4676 14.9079 68.2234 Constraint (T0311)I13.CB (T0311)S39.CB 6.3555 10.5926 13.7703 67.8478 Constraint (T0311)A30.CB (T0311)V58.CB 5.4691 9.1151 11.8497 67.8151 Constraint (T0311)A28.CB (T0311)V59.CB 5.7223 9.5372 12.3984 67.4733 Constraint (T0311)V22.CB (T0311)V59.CB 5.1040 8.5067 11.0587 67.2436 Constraint (T0311)I13.CB (T0311)L24.CB 5.8406 9.7344 12.6547 66.8314 Constraint (T0311)I33.CB (T0311)L42.CB 6.8430 11.4050 14.8265 66.7296 Constraint (T0311)A38.CB (T0311)V59.CB 6.0815 10.1358 13.1765 66.6629 Constraint (T0311)L17.CB (T0311)A38.CB 5.2230 8.7050 11.3165 66.6450 Constraint (T0311)Q14.CB (T0311)L24.CB 5.6704 9.4507 12.2859 66.3677 Constraint (T0311)V22.CB (T0311)L42.CB 6.7540 11.2566 14.6336 66.2794 Constraint (T0311)T37.CB (T0311)M52.CB 4.9053 8.1755 10.6281 65.8731 Constraint (T0311)S36.CB (T0311)K45.CB 6.0719 10.1198 13.1557 65.8294 Constraint (T0311)T37.CB (T0311)L56.CB 5.8288 9.7146 12.6290 65.8108 Constraint (T0311)I13.CB (T0311)V22.CB 5.9613 9.9355 12.9161 65.4859 Constraint (T0311)L41.CB (T0311)M52.CB 4.7365 7.8942 10.2625 65.4738 Constraint (T0311)M31.CB (T0311)M52.CB 4.3886 7.3144 9.5087 64.9276 Constraint (T0311)E26.CB (T0311)V59.CB 5.3091 8.8485 11.5030 64.8151 Constraint (T0311)I13.CB (T0311)L56.CB 4.2342 7.0571 9.1742 64.5052 Constraint (T0311)I13.CB (T0311)S57.CB 5.8456 9.7427 12.6656 64.2052 Constraint (T0311)I33.CB (T0311)M52.CB 4.4055 7.3426 9.5453 63.8729 Constraint (T0311)R25.CB (T0311)T37.CB 6.7695 11.2825 14.6673 63.8077 Constraint (T0311)L17.CB (T0311)A28.CB 6.2392 10.3986 13.5182 63.7892 Constraint (T0311)S16.CB (T0311)L56.CB 5.5646 9.2743 12.0566 63.6402 Constraint (T0311)A38.CB (T0311)L48.CB 5.8422 9.7370 12.6581 63.3022 Constraint (T0311)T37.CB (T0311)L48.CB 5.2327 8.7212 11.3375 63.3022 Constraint (T0311)F27.CB (T0311)I60.CB 4.5025 7.5042 9.7555 63.1823 Constraint (T0311)Q14.CB (T0311)A38.CB 5.9013 9.8355 12.7861 62.8803 Constraint (T0311)I12.CB (T0311)L42.CB 5.8570 9.7617 12.6902 62.5373 Constraint (T0311)A38.CB (T0311)K55.CB 6.2338 10.3897 13.5066 62.3443 Constraint (T0311)R29.CB (T0311)V59.CB 5.4802 9.1336 11.8737 62.2442 Constraint (T0311)D18.CB (T0311)F27.CB 6.1832 10.3053 13.3969 61.6037 Constraint (T0311)V22.CB (T0311)I60.CB 4.8947 8.1578 10.6051 61.2411 Constraint (T0311)L17.CB (T0311)V59.CB 5.6478 9.4130 12.2368 61.0845 Constraint (T0311)L17.CB (T0311)I60.CB 4.4358 7.3930 9.6109 60.7107 Constraint (T0311)Q14.CB (T0311)S39.CB 6.1577 10.2628 13.3416 60.6363 Constraint (T0311)A28.CB (T0311)K55.CB 6.2045 10.3408 13.4431 60.4690 Constraint (T0311)E32.CB (T0311)M52.CB 5.6347 9.3912 12.2085 60.4654 Constraint (T0311)S16.CB (T0311)S57.CB 5.7442 9.5737 12.4458 60.3555 Constraint (T0311)S16.CB (T0311)L42.CB 6.2899 10.4832 13.6281 60.3063 Constraint (T0311)A38.CB (T0311)M52.CB 5.4833 9.1389 11.8806 60.1841 Constraint (T0311)L17.CB (T0311)L56.CB 5.4390 9.0650 11.7845 60.0123 Constraint (T0311)I13.CB (T0311)V59.CB 6.2106 10.3510 13.4563 59.8799 Constraint (T0311)I33.CB (T0311)V59.CB 5.6003 9.3338 12.1339 59.4926 Constraint (T0311)T37.CB (T0311)A46.CB 4.6319 7.7198 10.0357 59.4235 Constraint (T0311)M31.CB (T0311)L48.CB 6.3210 10.5350 13.6955 59.3566 Constraint (T0311)I13.CB (T0311)I60.CB 4.4899 7.4831 9.7281 59.2132 Constraint (T0311)Q14.CB (T0311)L41.CB 5.3734 8.9556 11.6423 58.8890 Constraint (T0311)S16.CB (T0311)V59.CB 5.9058 9.8430 12.7959 58.4263 Constraint (T0311)I13.CB (T0311)A53.CB 5.5874 9.3124 12.1061 57.7440 Constraint (T0311)L48.CB (T0311)S57.CB 6.3085 10.5141 13.6683 57.0831 Constraint (T0311)A38.CB (T0311)I60.CB 6.4167 10.6945 13.9028 56.9560 Constraint (T0311)Q14.CB (T0311)T43.CB 5.5678 9.2797 12.0636 56.8724 Constraint (T0311)E32.CB (T0311)V59.CB 5.2500 8.7501 11.3751 56.5023 Constraint (T0311)I13.CB (T0311)T43.CB 6.0893 10.1488 13.1934 55.9542 Constraint (T0311)M31.CB (T0311)E51.CB 5.9990 9.9983 12.9978 55.9509 Constraint (T0311)F27.CB (T0311)V58.CB 6.3963 10.6605 13.8586 55.5804 Constraint (T0311)I12.CB (T0311)S57.CB 6.2101 10.3502 13.4553 55.5290 Constraint (T0311)L20.CB (T0311)V59.CB 5.3953 8.9921 11.6898 55.5145 Constraint (T0311)E32.CB (T0311)L56.CB 5.9197 9.8661 12.8260 55.4869 Constraint (T0311)S16.CB (T0311)S62.CB 4.2153 7.0255 9.1332 55.3635 Constraint (T0311)S16.CB (T0311)I60.CB 3.4245 5.7076 7.4198 55.3635 Constraint (T0311)I33.CB (T0311)L48.CB 5.8003 9.6672 12.5673 55.3116 Constraint (T0311)L17.CB (T0311)L41.CB 6.0575 10.0958 13.1245 55.2814 Constraint (T0311)Q14.CB (T0311)I60.CB 6.4047 10.6746 13.8770 55.1397 Constraint (T0311)I13.CB (T0311)S62.CB 5.6777 9.4628 12.3017 55.1099 Constraint (T0311)E26.CB (T0311)I60.CB 6.4545 10.7575 13.9848 54.9531 Constraint (T0311)F27.CB (T0311)S57.CB 6.4367 10.7278 13.9462 54.8962 Constraint (T0311)I33.CB (T0311)E51.CB 6.4582 10.7636 13.9927 54.8839 Constraint (T0311)A53.CB (T0311)S62.CB 6.3060 10.5101 13.6631 54.5142 Constraint (T0311)I13.CB (T0311)M31.CB 6.0619 10.1032 13.1341 54.4515 Constraint (T0311)A53.CB (T0311)S63.CB 6.4578 10.7630 13.9919 54.4260 Constraint (T0311)L17.CB (T0311)M31.CB 6.1830 10.3049 13.3964 54.3401 Constraint (T0311)E15.CB (T0311)I60.CB 6.2564 10.4274 13.5556 54.2900 Constraint (T0311)D11.CB (T0311)L42.CB 5.2079 8.6798 11.2838 54.2609 Constraint (T0311)L17.CB (T0311)S39.CB 6.5709 10.9515 14.2369 54.0244 Constraint (T0311)T37.CB (T0311)K55.CB 6.2273 10.3789 13.4925 53.9441 Constraint (T0311)V22.CB (T0311)L56.CB 6.3192 10.5320 13.6916 53.8480 Constraint (T0311)L17.CB (T0311)A30.CB 5.9835 9.9726 12.9644 53.7751 Constraint (T0311)E15.CB (T0311)L42.CB 6.0819 10.1366 13.1775 53.5530 Constraint (T0311)S36.CB (T0311)A46.CB 6.0444 10.0740 13.0962 53.4480 Constraint (T0311)V22.CB (T0311)M31.CB 6.1410 10.2350 13.3055 53.3517 Constraint (T0311)I12.CB (T0311)L41.CB 5.9357 9.8929 12.8607 53.1771 Constraint (T0311)I12.CB (T0311)L56.CB 6.0326 10.0543 13.0706 53.0612 Constraint (T0311)I33.CB (T0311)A53.CB 6.5213 10.8689 14.1296 52.9886 Constraint (T0311)E32.CB (T0311)E51.CB 6.3256 10.5427 13.7055 52.7032 Constraint (T0311)I13.CB (T0311)R40.CB 6.5434 10.9056 14.1773 52.5871 Constraint (T0311)I12.CB (T0311)I60.CB 5.5501 9.2502 12.0253 52.4508 Constraint (T0311)L24.CB (T0311)L56.CB 6.3882 10.6470 13.8410 52.4458 Constraint (T0311)D18.CB (T0311)L42.CB 6.0317 10.0528 13.0686 52.3157 Constraint (T0311)M31.CB (T0311)I60.CB 5.1970 8.6617 11.2602 52.2015 Constraint (T0311)L41.CB (T0311)K55.CB 6.2575 10.4292 13.5580 52.0900 Constraint (T0311)L20.CB (T0311)I60.CB 4.2728 7.1214 9.2578 51.8559 Constraint (T0311)E19.CB (T0311)I60.CB 5.8635 9.7724 12.7042 51.8559 Constraint (T0311)R40.CB (T0311)M52.CB 6.1330 10.2217 13.2882 51.7885 Constraint (T0311)I54.CB (T0311)P64.CB 4.0191 6.6985 8.7080 51.3014 Constraint (T0311)A28.CB (T0311)M52.CB 6.3203 10.5339 13.6941 50.8842 Constraint (T0311)I54.CB (T0311)S63.CB 6.0242 10.0404 13.0525 50.7283 Constraint (T0311)I12.CB (T0311)A53.CB 6.3807 10.6346 13.8249 50.6740 Constraint (T0311)A53.CB (T0311)Q65.CB 6.1891 10.3151 13.4096 49.9190 Constraint (T0311)L17.CB (T0311)S62.CB 6.2501 10.4168 13.5419 49.7153 Constraint (T0311)A30.CB (T0311)I60.CB 5.0777 8.4628 11.0016 49.5433 Constraint (T0311)A53.CB (T0311)P64.CB 3.6788 6.1314 7.9708 49.5142 Constraint (T0311)E15.CB (T0311)S62.CB 6.4136 10.6894 13.8962 49.2850 Constraint (T0311)I12.CB (T0311)S62.CB 5.1132 8.5221 11.0787 48.9432 Constraint (T0311)L20.CB (T0311)A30.CB 5.8862 9.8104 12.7535 48.8558 Constraint (T0311)I33.CB (T0311)A46.CB 6.3642 10.6070 13.7891 48.5061 Constraint (T0311)I13.CB (T0311)T37.CB 6.7011 11.1686 14.5191 47.5523 Constraint (T0311)D11.CB (T0311)L41.CB 6.3354 10.5590 13.7267 47.4891 Constraint (T0311)A30.CB (T0311)S57.CB 6.7336 11.2226 14.5894 46.8287 Constraint (T0311)L20.CB (T0311)S62.CB 5.6878 9.4796 12.3235 46.2850 Constraint (T0311)Q14.CB (T0311)S23.CB 6.5217 10.8695 14.1304 46.0677 Constraint (T0311)D18.CB (T0311)I60.CB 6.6443 11.0738 14.3959 45.8656 Constraint (T0311)T37.CB (T0311)A47.CB 6.3766 10.6276 13.8159 45.4110 Constraint (T0311)T37.CB (T0311)T49.CB 5.9567 9.9279 12.9062 45.3228 Constraint (T0311)E32.CB (T0311)V58.CB 6.0832 10.1387 13.1803 44.5132 Constraint (T0311)Q14.CB (T0311)L56.CB 6.5714 10.9523 14.2380 44.3859 Constraint (T0311)K55.CB (T0311)P64.CB 5.9837 9.9729 12.9647 43.9412 Constraint (T0311)I54.CB (T0311)Q65.CB 6.7245 11.2075 14.5698 43.9412 Constraint (T0311)L24.CB (T0311)V59.CB 6.6395 11.0659 14.3857 43.9226 Constraint (T0311)D11.CB (T0311)T43.CB 6.0700 10.1167 13.1517 43.4517 Constraint (T0311)L20.CB (T0311)L56.CB 6.8380 11.3967 14.8157 43.3897 Constraint (T0311)I33.CB (T0311)T49.CB 6.2320 10.3866 13.5026 43.3226 Constraint (T0311)I13.CB (T0311)L48.CB 5.2044 8.6739 11.2761 43.3025 Constraint (T0311)S16.CB (T0311)S63.CB 6.3033 10.5055 13.6571 43.2065 Constraint (T0311)R29.CB (T0311)K55.CB 6.6348 11.0580 14.3754 43.0491 Constraint (T0311)F27.CB (T0311)M52.CB 6.3343 10.5572 13.7243 42.8382 Constraint (T0311)A34.CB (T0311)M52.CB 6.4509 10.7515 13.9770 42.3523 Constraint (T0311)I13.CB (T0311)A46.CB 6.2512 10.4187 13.5444 42.2838 Constraint (T0311)L41.CB (T0311)I60.CB 6.4981 10.8302 14.0793 41.9561 Constraint (T0311)I12.CB (T0311)S63.CB 6.3648 10.6080 13.7904 40.0183 Constraint (T0311)V22.CB (T0311)P35.CB 6.8941 11.4902 14.9373 39.6126 Constraint (T0311)I13.CB (T0311)I33.CB 6.5646 10.9411 14.2234 38.5468 Constraint (T0311)I12.CB (T0311)P64.CB 6.6758 11.1263 14.4642 38.3702 Constraint (T0311)T37.CB (T0311)A53.CB 6.4216 10.7026 13.9134 38.1498 Constraint (T0311)I12.CB (T0311)Q65.CB 6.6027 11.0045 14.3058 38.1065 Constraint (T0311)A34.CB (T0311)A46.CB 6.6817 11.1361 14.4770 38.0481 Constraint (T0311)S16.CB (T0311)A38.CB 6.5997 10.9996 14.2995 37.7775 Constraint (T0311)R29.CB (T0311)L56.CB 6.7781 11.2969 14.6860 37.2577 Constraint (T0311)S16.CB (T0311)L41.CB 6.7634 11.2724 14.6541 36.7842 Constraint (T0311)I13.CB (T0311)A28.CB 6.6056 11.0093 14.3121 36.5180 Constraint (T0311)S23.CB (T0311)V59.CB 6.7937 11.3229 14.7198 36.0246 Constraint (T0311)M31.CB (T0311)T49.CB 6.5345 10.8908 14.1580 35.3908 Constraint (T0311)L56.CB (T0311)W67.CB 4.7506 7.9177 10.2930 35.0892 Constraint (T0311)A38.CB (T0311)A53.CB 6.4123 10.6871 13.8932 35.0647 Constraint (T0311)M31.CB (T0311)L42.CB 6.8958 11.4930 14.9410 34.8906 Constraint (T0311)E19.CB (T0311)S62.CB 5.8141 9.6902 12.5973 34.7216 Constraint (T0311)A46.CB (T0311)L56.CB 6.6366 11.0610 14.3793 34.7036 Constraint (T0311)S57.CB (T0311)M66.CB 4.5785 7.6308 9.9200 34.6249 Constraint (T0311)I13.CB (T0311)M52.CB 6.0086 10.0143 13.0186 34.6113 Constraint (T0311)M52.CB (T0311)P64.CB 6.2859 10.4764 13.6194 34.1966 Constraint (T0311)E51.CB (T0311)P64.CB 6.4264 10.7106 13.9238 34.1966 Constraint (T0311)P50.CB (T0311)P64.CB 5.0015 8.3358 10.8366 34.1966 Constraint (T0311)I13.CB (T0311)K55.CB 6.7946 11.3244 14.7217 33.2318 Constraint (T0311)L41.CB (T0311)S57.CB 5.6260 9.3767 12.1897 32.9586 Constraint (T0311)I12.CB (T0311)M66.CB 4.8383 8.0639 10.4830 32.5316 Constraint (T0311)L17.CB (T0311)S57.CB 6.6681 11.1134 14.4474 32.4841 Constraint (T0311)A53.CB (T0311)W67.CB 4.0454 6.7423 8.7649 31.6818 Constraint (T0311)I33.CB (T0311)I60.CB 6.7241 11.2068 14.5688 31.3104 Constraint (T0311)S57.CB (T0311)W67.CB 3.4085 5.6808 7.3851 31.2770 Constraint (T0311)I13.CB (T0311)W67.CB 4.6668 7.7780 10.1114 31.1751 Constraint (T0311)I13.CB (T0311)P64.CB 6.7811 11.3019 14.6924 30.9509 Constraint (T0311)A28.CB (T0311)I60.CB 6.7256 11.2094 14.5722 30.8836 Constraint (T0311)E26.CB (T0311)L56.CB 6.6492 11.0820 14.4066 30.8308 Constraint (T0311)S39.CB (T0311)L48.CB 6.5017 10.8362 14.0871 30.4943 Constraint (T0311)I54.CB (T0311)W67.CB 5.5764 9.2940 12.0822 30.2607 Constraint (T0311)A53.CB (T0311)M66.CB 6.2233 10.3722 13.4839 29.9364 Constraint (T0311)S16.CB (T0311)M66.CB 5.4941 9.1567 11.9038 29.8734 Constraint (T0311)E32.CB (T0311)I54.CB 6.5445 10.9074 14.1797 29.8456 Constraint (T0311)L56.CB (T0311)M66.CB 6.4482 10.7470 13.9711 29.8044 Constraint (T0311)L42.CB (T0311)I60.CB 6.0176 10.0293 13.0381 29.6630 Constraint (T0311)R25.CB (T0311)V59.CB 6.8642 11.4403 14.8724 29.3614 Constraint (T0311)V58.CB (T0311)W67.CB 6.2498 10.4163 13.5412 29.2802 Constraint (T0311)L48.CB (T0311)P64.CB 6.1834 10.3057 13.3975 28.7889 Constraint (T0311)A30.CB (T0311)M52.CB 6.4348 10.7246 13.9420 28.3040 Constraint (T0311)I13.CB (T0311)M66.CB 5.9861 9.9768 12.9699 27.9093 Constraint (T0311)S16.CB (T0311)A30.CB 5.3667 8.9446 11.6279 27.8020 Constraint (T0311)S16.CB (T0311)P64.CB 6.8931 11.4885 14.9351 27.5126 Constraint (T0311)S16.CB (T0311)M31.CB 5.7350 9.5584 12.4259 26.5903 Constraint (T0311)L42.CB (T0311)M52.CB 6.5572 10.9287 14.2073 26.3877 Constraint (T0311)K55.CB (T0311)W67.CB 6.6248 11.0413 14.3537 26.2802 Constraint (T0311)S39.CB (T0311)L56.CB 5.8499 9.7498 12.6747 25.9626 Constraint (T0311)F27.CB (T0311)S36.CB 7.0711 11.7851 15.3206 25.9106 Constraint (T0311)L17.CB (T0311)P35.CB 6.9500 11.5833 15.0583 25.7931 Constraint (T0311)I12.CB (T0311)L48.CB 6.2330 10.3884 13.5049 25.7404 Constraint (T0311)I12.CB (T0311)W67.CB 3.6134 6.0223 7.8290 25.6021 Constraint (T0311)L41.CB (T0311)E51.CB 6.7366 11.2277 14.5960 25.5546 Constraint (T0311)L41.CB (T0311)W67.CB 6.1206 10.2009 13.2612 25.3384 Constraint (T0311)I33.CB (T0311)V58.CB 6.6217 11.0361 14.3470 25.0534 Constraint (T0311)A53.CB (T0311)L68.CB 4.8078 8.0130 10.4169 24.8061 Constraint (T0311)S57.CB (T0311)L68.CB 5.5265 9.2108 11.9740 24.7013 Constraint (T0311)I54.CB (T0311)L68.CB 6.5795 10.9659 14.2557 24.7013 Constraint (T0311)R40.CB (T0311)T49.CB 6.1827 10.3046 13.3960 24.6484 Constraint (T0311)R40.CB (T0311)A53.CB 5.8022 9.6704 12.5715 24.5270 Constraint (T0311)S16.CB (T0311)V58.CB 6.9872 11.6453 15.1389 24.4629 Constraint (T0311)I13.CB (T0311)A47.CB 6.5385 10.8975 14.1667 24.4581 Constraint (T0311)I33.CB (T0311)I54.CB 6.7049 11.1749 14.5273 23.9573 Constraint (T0311)R40.CB (T0311)L56.CB 5.7380 9.5634 12.4324 23.8166 Constraint (T0311)N21.CB (T0311)I60.CB 6.9659 11.6099 15.0929 23.3966 Constraint (T0311)L42.CB (T0311)A53.CB 6.1012 10.1687 13.2193 22.8797 Constraint (T0311)A34.CB (T0311)L56.CB 6.6455 11.0758 14.3985 22.8015 Constraint (T0311)D11.CB (T0311)W67.CB 6.3261 10.5435 13.7066 22.4896 Constraint (T0311)Q14.CB (T0311)W67.CB 6.5705 10.9508 14.2360 22.4841 Constraint (T0311)F27.CB (T0311)S62.CB 6.8655 11.4424 14.8752 22.3058 Constraint (T0311)A34.CB (T0311)K55.CB 6.9015 11.5026 14.9533 22.1586 Constraint (T0311)L42.CB (T0311)S57.CB 5.8925 9.8209 12.7671 22.1356 Constraint (T0311)L17.CB (T0311)W67.CB 6.4313 10.7189 13.9345 21.8259 Constraint (T0311)P35.CB (T0311)L56.CB 6.6818 11.1364 14.4773 21.8096 Constraint (T0311)S16.CB (T0311)W67.CB 4.6954 7.8257 10.1734 21.7294 Constraint (T0311)E15.CB (T0311)W67.CB 6.1848 10.3081 13.4005 21.7294 Constraint (T0311)S16.CB (T0311)E26.CB 5.6916 9.4859 12.3317 21.6389 Constraint (T0311)T37.CB (T0311)E51.CB 6.6237 11.0396 14.3515 21.5240 Constraint (T0311)I33.CB (T0311)S57.CB 6.7385 11.2308 14.6000 21.0380 Constraint (T0311)L20.CB (T0311)S57.CB 7.0005 11.6675 15.1677 20.9789 Constraint (T0311)Q14.CB (T0311)R40.CB 7.0311 11.7185 15.2340 20.8202 Constraint (T0311)L17.CB (T0311)I33.CB 6.9460 11.5766 15.0496 20.6520 Constraint (T0311)L48.CB (T0311)W67.CB 5.5915 9.3191 12.1148 20.6209 Constraint (T0311)A28.CB (T0311)L48.CB 6.8144 11.3573 14.7645 20.2620 Constraint (T0311)L41.CB (T0311)V59.CB 6.0140 10.0234 13.0304 19.9359 Constraint (T0311)I12.CB (T0311)F27.CB 5.7646 9.6077 12.4900 19.7074 Constraint (T0311)L41.CB (T0311)I54.CB 5.5418 9.2363 12.0072 19.6973 Constraint (T0311)L24.CB (T0311)I60.CB 6.3999 10.6665 13.8665 19.2274 Constraint (T0311)I13.CB (T0311)K45.CB 6.5877 10.9796 14.2734 19.0956 Constraint (T0311)L41.CB (T0311)P50.CB 6.0055 10.0091 13.0119 18.9934 Constraint (T0311)E15.CB (T0311)F27.CB 6.1761 10.2935 13.3815 18.8102 Constraint (T0311)T49.CB (T0311)P64.CB 6.6646 11.1076 14.4399 18.7889 Constraint (T0311)P50.CB (T0311)L68.CB 6.0511 10.0851 13.1107 18.6241 Constraint (T0311)V22.CB (T0311)I33.CB 7.0508 11.7514 15.2768 18.1639 Constraint (T0311)M31.CB (T0311)R40.CB 7.0323 11.7205 15.2366 17.9850 Constraint (T0311)I13.CB (T0311)A30.CB 6.3903 10.6505 13.8457 17.8025 Constraint (T0311)I13.CB (T0311)E26.CB 6.5732 10.9554 14.2420 17.6379 Constraint (T0311)L20.CB (T0311)V58.CB 6.9963 11.6605 15.1586 17.5633 Constraint (T0311)I12.CB (T0311)L68.CB 5.2762 8.7936 11.4317 17.4948 Constraint (T0311)L42.CB (T0311)V59.CB 6.6538 11.0897 14.4166 17.4157 Constraint (T0311)L56.CB (T0311)L68.CB 6.4919 10.8199 14.0658 17.1446 Constraint (T0311)S16.CB (T0311)A53.CB 6.4866 10.8111 14.0544 17.1286 Constraint (T0311)L20.CB (T0311)M31.CB 6.6191 11.0318 14.3414 16.9804 Constraint (T0311)F27.CB (T0311)A53.CB 6.8216 11.3693 14.7801 16.8560 Constraint (T0311)F27.CB (T0311)L48.CB 6.4874 10.8123 14.0559 16.3218 Constraint (T0311)N21.CB (T0311)A30.CB 6.9052 11.5086 14.9612 16.2815 Constraint (T0311)I13.CB (T0311)S23.CB 6.3458 10.5764 13.7493 16.1806 Constraint (T0311)A38.CB (T0311)S57.CB 6.0166 10.0277 13.0361 16.0314 Constraint (T0311)I13.CB (T0311)L68.CB 6.5969 10.9949 14.2933 15.8283 Constraint (T0311)I12.CB (T0311)N69.CB 5.9093 9.8488 12.8034 15.7432 Constraint (T0311)P50.CB (T0311)W67.CB 6.1532 10.2553 13.3319 15.6241 Constraint (T0311)L48.CB (T0311)L68.CB 6.3683 10.6138 13.7979 15.6241 Constraint (T0311)R40.CB (T0311)S57.CB 6.2978 10.4964 13.6453 15.3489 Constraint (T0311)T37.CB (T0311)V59.CB 6.5864 10.9773 14.2704 14.9516 Constraint (T0311)M52.CB (T0311)W67.CB 6.2762 10.4603 13.5984 14.7841 Constraint (T0311)A47.CB (T0311)L68.CB 6.0848 10.1413 13.1837 14.2311 Constraint (T0311)A34.CB (T0311)L48.CB 6.3531 10.5885 13.7650 14.2164 Constraint (T0311)I60.CB (T0311)L70.CB 5.9737 9.9562 12.9431 14.1450 Constraint (T0311)L41.CB (T0311)V58.CB 6.0110 10.0183 13.0238 13.9359 Constraint (T0311)F27.CB (T0311)R40.CB 7.0353 11.7256 15.2432 13.9312 Constraint (T0311)L42.CB (T0311)W67.CB 6.6645 11.1076 14.4398 13.7674 Constraint (T0311)V22.CB (T0311)S62.CB 6.7069 11.1781 14.5316 13.7348 Constraint (T0311)S57.CB (T0311)L70.CB 5.3214 8.8690 11.5297 13.0432 Constraint (T0311)E15.CB (T0311)M66.CB 6.4335 10.7226 13.9393 12.8947 Constraint (T0311)I13.CB (T0311)L70.CB 5.2591 8.7652 11.3948 12.6242 Constraint (T0311)I12.CB (T0311)L70.CB 4.8898 8.1497 10.5946 12.6242 Constraint (T0311)T43.CB (T0311)A53.CB 6.2420 10.4034 13.5244 12.3605 Constraint (T0311)A38.CB (T0311)V58.CB 6.8659 11.4432 14.8761 12.1488 Constraint (T0311)S16.CB (T0311)R29.CB 6.3766 10.6277 13.8160 12.0027 Constraint (T0311)T37.CB (T0311)S57.CB 6.6896 11.1493 14.4941 11.8111 Constraint (T0311)A47.CB (T0311)W67.CB 6.3011 10.5018 13.6524 11.7706 Constraint (T0311)T43.CB (T0311)L56.CB 6.7466 11.2443 14.6176 11.7367 Constraint (T0311)L41.CB (T0311)A79.CB 6.6266 11.0444 14.3577 11.7275 Constraint (T0311)L17.CB (T0311)T43.CB 6.8465 11.4108 14.8341 11.5591 Constraint (T0311)T37.CB (T0311)I54.CB 6.9266 11.5443 15.0077 11.5367 Constraint (T0311)L48.CB (T0311)I60.CB 6.7651 11.2751 14.6576 11.4849 Constraint (T0311)S36.CB (T0311)M52.CB 6.7066 11.1776 14.5309 11.4651 Constraint (T0311)S57.CB (T0311)E80.CB 4.9782 8.2971 10.7862 11.4221 Constraint (T0311)S36.CB (T0311)L56.CB 6.6351 11.0586 14.3761 11.3405 Constraint (T0311)S57.CB (T0311)Q71.CB 6.3168 10.5281 13.6865 11.2228 Constraint (T0311)S36.CB (T0311)L48.CB 5.7098 9.5163 12.3712 11.2165 Constraint (T0311)E26.CB (T0311)K55.CB 6.8638 11.4397 14.8716 10.9807 Constraint (T0311)I54.CB (T0311)E80.CB 6.1431 10.2384 13.3100 10.9528 Constraint (T0311)Q14.CB (T0311)L48.CB 6.3907 10.6512 13.8465 10.9038 Constraint (T0311)M31.CB (T0311)S62.CB 6.7543 11.2572 14.6343 10.8960 Constraint (T0311)P9.CB (T0311)A53.CB 4.7829 7.9715 10.3630 10.8517 Constraint (T0311)P9.CB (T0311)A47.CB 5.0228 8.3713 10.8827 10.8517 Constraint (T0311)P9.CB (T0311)T43.CB 6.8116 11.3527 14.7585 10.8517 Constraint (T0311)P9.CB (T0311)L42.CB 5.5476 9.2459 12.0197 10.8517 Constraint (T0311)P9.CB (T0311)L41.CB 4.4409 7.4015 9.6219 10.8517 Constraint (T0311)D11.CB (T0311)L48.CB 6.7533 11.2555 14.6321 10.8287 Constraint (T0311)I12.CB (T0311)A38.CB 5.4055 9.0092 11.7120 10.8052 Constraint (T0311)I12.CB (T0311)I33.CB 5.4940 9.1567 11.9037 10.8052 Constraint (T0311)I12.CB (T0311)M31.CB 3.8955 6.4925 8.4403 10.8052 Constraint (T0311)Q14.CB (T0311)S62.CB 6.9231 11.5384 15.0000 10.7558 Constraint (T0311)S62.CB (T0311)Q71.CB 6.8911 11.4851 14.9307 10.6663 Constraint (T0311)A38.CB (T0311)T49.CB 6.2287 10.3812 13.4956 10.4851 Constraint (T0311)I13.CB (T0311)S63.CB 6.4241 10.7069 13.9190 10.3829 Constraint (T0311)D11.CB (T0311)M66.CB 6.8240 11.3733 14.7853 10.2281 Constraint (T0311)S16.CB (T0311)A28.CB 5.8879 9.8131 12.7571 10.2095 Constraint (T0311)S57.CB (T0311)N69.CB 5.9879 9.9799 12.9739 10.2065 Constraint (T0311)Q14.CB (T0311)K45.CB 5.5947 9.3245 12.1219 10.1972 Constraint (T0311)A53.CB (T0311)Q71.CB 4.5396 7.5660 9.8358 9.9942 Constraint (T0311)S16.CB (T0311)Q65.CB 7.0236 11.7060 15.2177 9.9890 Constraint (T0311)M52.CB (T0311)A79.CB 6.1368 10.2281 13.2965 9.9605 Constraint (T0311)A47.CB (T0311)L56.CB 6.4948 10.8246 14.0720 9.9281 Constraint (T0311)E32.CB (T0311)T49.CB 6.0779 10.1298 13.1688 9.8956 Constraint (T0311)P9.CB (T0311)W67.CB 3.8497 6.4161 8.3410 9.8353 Constraint (T0311)P9.CB (T0311)P64.CB 6.4860 10.8099 14.0529 9.8353 Constraint (T0311)P9.CB (T0311)I60.CB 6.9525 11.5876 15.0638 9.8353 Constraint (T0311)P9.CB (T0311)S57.CB 6.5058 10.8430 14.0959 9.8353 Constraint (T0311)P9.CB (T0311)L56.CB 5.7173 9.5288 12.3875 9.8353 Constraint (T0311)P9.CB (T0311)A46.CB 5.8575 9.7626 12.6913 9.8353 Constraint (T0311)P9.CB (T0311)K45.CB 6.7256 11.2093 14.5720 9.8353 Constraint (T0311)I12.CB (T0311)V22.CB 6.2320 10.3866 13.5026 9.7964 Constraint (T0311)E15.CB (T0311)M31.CB 6.3896 10.6494 13.8442 9.7889 Constraint (T0311)I12.CB (T0311)A30.CB 5.2028 8.6713 11.2727 9.7889 Constraint (T0311)I54.CB (T0311)A79.CB 5.4593 9.0989 11.8285 9.7468 Constraint (T0311)L56.CB (T0311)A79.CB 5.0451 8.4084 10.9310 9.4452 Constraint (T0311)K55.CB (T0311)A79.CB 6.1998 10.3330 13.4328 9.4452 Constraint (T0311)S57.CB (T0311)A79.CB 5.0160 8.3600 10.8680 9.4289 Constraint (T0311)E19.CB (T0311)V59.CB 6.8912 11.4853 14.9309 9.2294 Constraint (T0311)Q14.CB (T0311)A46.CB 6.2568 10.4280 13.5564 8.9890 Constraint (T0311)D11.CB (T0311)A46.CB 6.0158 10.0263 13.0342 8.9890 Constraint (T0311)L20.CB (T0311)R29.CB 6.6377 11.0629 14.3817 8.9804 Constraint (T0311)R25.CB (T0311)L42.CB 7.0482 11.7470 15.2710 8.9649 Constraint (T0311)A53.CB (T0311)E80.CB 5.7311 9.5519 12.4175 8.9365 Constraint (T0311)I12.CB (T0311)A47.CB 6.6333 11.0556 14.3723 8.9118 Constraint (T0311)I12.CB (T0311)A46.CB 6.1165 10.1942 13.2525 8.9009 Constraint (T0311)S16.CB (T0311)I33.CB 6.4977 10.8295 14.0783 8.8932 Constraint (T0311)P9.CB (T0311)L48.CB 4.2137 7.0228 9.1297 8.8530 Constraint (T0311)A53.CB (T0311)L70.CB 4.2157 7.0262 9.1341 8.8146 Constraint (T0311)M31.CB (T0311)W67.CB 6.8058 11.3430 14.7459 8.7687 Constraint (T0311)R40.CB (T0311)K55.CB 6.1110 10.1850 13.2405 8.7438 Constraint (T0311)L42.CB (T0311)E80.CB 4.8251 8.0418 10.4544 8.7057 Constraint (T0311)R40.CB (T0311)P50.CB 5.6776 9.4626 12.3014 8.6756 Constraint (T0311)K45.CB (T0311)L56.CB 5.8522 9.7537 12.6798 8.6573 Constraint (T0311)S23.CB (T0311)I33.CB 7.1236 11.8726 15.4344 8.6216 Constraint (T0311)E15.CB (T0311)L41.CB 6.8079 11.3466 14.7505 8.6088 Constraint (T0311)L48.CB (T0311)Q71.CB 4.7553 7.9256 10.3032 8.5730 Constraint (T0311)I54.CB (T0311)M66.CB 6.7722 11.2870 14.6731 8.5730 Constraint (T0311)E32.CB (T0311)L48.CB 6.6689 11.1149 14.4493 8.5730 Constraint (T0311)A47.CB (T0311)N69.CB 6.2327 10.3878 13.5042 8.5730 Constraint (T0311)M31.CB (T0311)A46.CB 7.1537 11.9228 15.4996 8.5624 Constraint (T0311)V22.CB (T0311)S39.CB 6.9486 11.5810 15.0553 8.5617 Constraint (T0311)Q65.CB (T0311)E80.CB 4.2509 7.0849 9.2104 8.5613 Constraint (T0311)N21.CB (T0311)V59.CB 6.3744 10.6240 13.8111 8.5613 Constraint (T0311)F27.CB (T0311)T43.CB 6.9615 11.6024 15.0832 8.5500 Constraint (T0311)A30.CB (T0311)I54.CB 6.7093 11.1822 14.5369 8.4849 Constraint (T0311)A28.CB (T0311)A46.CB 7.0783 11.7972 15.3364 8.4098 Constraint (T0311)S39.CB (T0311)M52.CB 6.6427 11.0711 14.3925 8.4076 Constraint (T0311)S36.CB (T0311)A47.CB 5.7395 9.5658 12.4356 8.2627 Constraint (T0311)L56.CB (T0311)L70.CB 4.7036 7.8393 10.1911 8.2228 Constraint (T0311)I13.CB (T0311)N69.CB 6.3084 10.5141 13.6683 8.1209 Constraint (T0311)Q65.CB (T0311)V83.CB 5.9512 9.9187 12.8943 8.0066 Constraint (T0311)S63.CB (T0311)E80.CB 5.0540 8.4233 10.9503 8.0066 Constraint (T0311)A53.CB (T0311)A79.CB 4.5174 7.5290 9.7877 7.9596 Constraint (T0311)A53.CB (T0311)E78.CB 5.8769 9.7949 12.7334 7.9596 Constraint (T0311)D18.CB (T0311)A38.CB 7.0350 11.7250 15.2425 7.9412 Constraint (T0311)L56.CB (T0311)Q71.CB 6.2586 10.4310 13.5603 7.9228 Constraint (T0311)S16.CB (T0311)L48.CB 6.4222 10.7036 13.9147 7.9038 Constraint (T0311)I13.CB (T0311)T49.CB 6.6226 11.0377 14.3491 7.9038 Constraint (T0311)I33.CB (T0311)A47.CB 6.8267 11.3778 14.7912 7.8954 Constraint (T0311)I12.CB (T0311)A28.CB 5.9727 9.9545 12.9409 7.8949 Constraint (T0311)R29.CB (T0311)I60.CB 7.0170 11.6950 15.2035 7.8614 Constraint (T0311)S39.CB (T0311)I60.CB 6.6784 11.1306 14.4698 7.8495 Constraint (T0311)P9.CB (T0311)L68.CB 4.5992 7.6653 9.9649 7.8367 Constraint (T0311)P9.CB (T0311)M52.CB 6.4462 10.7437 13.9667 7.8367 Constraint (T0311)R40.CB (T0311)I54.CB 5.3048 8.8414 11.4938 7.7994 Constraint (T0311)S63.CB (T0311)A79.CB 6.2074 10.3457 13.4494 7.7939 Constraint (T0311)S63.CB (T0311)A77.CB 5.9727 9.9545 12.9409 7.7775 Constraint (T0311)L56.CB (T0311)V83.CB 6.6022 11.0037 14.3048 7.7650 Constraint (T0311)S57.CB (T0311)V83.CB 6.2095 10.3492 13.4540 7.7621 Constraint (T0311)A30.CB (T0311)T82.CB 3.9814 6.6357 8.6264 7.7282 Constraint (T0311)A30.CB (T0311)K81.CB 6.0204 10.0340 13.0442 7.7282 Constraint (T0311)F27.CB (T0311)T82.CB 5.3483 8.9138 11.5880 7.7282 Constraint (T0311)E26.CB (T0311)T82.CB 5.6838 9.4730 12.3149 7.7282 Constraint (T0311)S23.CB (T0311)I60.CB 6.4935 10.8226 14.0693 7.6543 Constraint (T0311)L56.CB (T0311)E80.CB 5.0224 8.3707 10.8818 7.4318 Constraint (T0311)L42.CB (T0311)S62.CB 6.0770 10.1283 13.1668 7.3602 Constraint (T0311)P64.CB (T0311)E80.CB 4.0453 6.7421 8.7647 7.3505 Constraint (T0311)S16.CB (T0311)L68.CB 6.5063 10.8439 14.0970 7.3334 Constraint (T0311)A53.CB (T0311)N69.CB 5.5073 9.1789 11.9325 7.3113 Constraint (T0311)P35.CB (T0311)V59.CB 7.0373 11.7289 15.2475 7.2627 Constraint (T0311)E19.CB (T0311)A30.CB 5.9210 9.8683 12.8288 7.2153 Constraint (T0311)S16.CB (T0311)R25.CB 6.6638 11.1063 14.4382 7.2153 Constraint (T0311)D11.CB (T0311)I60.CB 6.6065 11.0108 14.3140 7.1818 Constraint (T0311)I12.CB (T0311)E32.CB 5.8806 9.8010 12.7413 7.1743 Constraint (T0311)F27.CB (T0311)E80.CB 3.9894 6.6490 8.6438 7.1452 Constraint (T0311)S16.CB (T0311)L70.CB 4.5969 7.6614 9.9598 7.0512 Constraint (T0311)E15.CB (T0311)L70.CB 5.1227 8.5378 11.0991 7.0512 Constraint (T0311)Q14.CB (T0311)L70.CB 6.8051 11.3419 14.7444 7.0512 Constraint (T0311)P64.CB (T0311)V83.CB 4.3965 7.3275 9.5257 7.0048 Constraint (T0311)P9.CB (T0311)M66.CB 6.1669 10.2782 13.3616 6.9986 Constraint (T0311)E19.CB (T0311)W67.CB 6.9536 11.5893 15.0661 6.9913 Constraint (T0311)E15.CB (T0311)S57.CB 6.8602 11.4337 14.8638 6.9898 Constraint (T0311)S39.CB (T0311)E80.CB 6.5974 10.9956 14.2943 6.9186 Constraint (T0311)M31.CB (T0311)T82.CB 5.8368 9.7281 12.6465 6.9186 Constraint (T0311)M31.CB (T0311)K81.CB 6.3863 10.6439 13.8370 6.9186 Constraint (T0311)F27.CB (T0311)K81.CB 5.7198 9.5329 12.3928 6.9186 Constraint (T0311)L24.CB (T0311)V83.CB 6.3794 10.6323 13.8220 6.9186 Constraint (T0311)L24.CB (T0311)E80.CB 5.9868 9.9780 12.9715 6.9186 Constraint (T0311)K55.CB (T0311)L70.CB 6.3050 10.5084 13.6609 6.9065 Constraint (T0311)I54.CB (T0311)L70.CB 5.6720 9.4533 12.2893 6.9065 Constraint (T0311)P9.CB (T0311)T49.CB 6.5122 10.8537 14.1098 6.8531 Constraint (T0311)R8.CB (T0311)L41.CB 6.4731 10.7886 14.0252 6.8531 Constraint (T0311)E15.CB (T0311)E26.CB 6.5097 10.8495 14.1043 6.7962 Constraint (T0311)E15.CB (T0311)A30.CB 5.7167 9.5279 12.3862 6.7947 Constraint (T0311)S62.CB (T0311)E80.CB 6.1537 10.2561 13.3329 6.7939 Constraint (T0311)E51.CB (T0311)W67.CB 6.5361 10.8935 14.1616 6.7875 Constraint (T0311)T49.CB (T0311)W67.CB 7.0140 11.6900 15.1971 6.7875 Constraint (T0311)L48.CB (T0311)M66.CB 6.5266 10.8777 14.1410 6.7875 Constraint (T0311)K45.CB (T0311)L70.CB 6.7099 11.1831 14.5381 6.7875 Constraint (T0311)L42.CB (T0311)L70.CB 4.7468 7.9114 10.2848 6.7875 Constraint (T0311)L42.CB (T0311)M66.CB 6.3529 10.5881 13.7645 6.7875 Constraint (T0311)L41.CB (T0311)L70.CB 3.9868 6.6447 8.6381 6.7875 Constraint (T0311)L41.CB (T0311)N69.CB 6.3779 10.6299 13.8188 6.7875 Constraint (T0311)A38.CB (T0311)L70.CB 5.9238 9.8730 12.8349 6.7875 Constraint (T0311)M31.CB (T0311)L70.CB 6.4565 10.7608 13.9890 6.7875 Constraint (T0311)F27.CB (T0311)L70.CB 6.6049 11.0081 14.3105 6.7875 Constraint (T0311)E15.CB (T0311)L56.CB 6.2278 10.3797 13.4936 6.7792 Constraint (T0311)P64.CB (T0311)T82.CB 5.9664 9.9440 12.9272 6.7775 Constraint (T0311)P64.CB (T0311)K81.CB 5.6417 9.4028 12.2237 6.7775 Constraint (T0311)P64.CB (T0311)A79.CB 3.7990 6.3317 8.2312 6.7775 Constraint (T0311)P64.CB (T0311)E78.CB 5.0312 8.3854 10.9010 6.7775 Constraint (T0311)P64.CB (T0311)A77.CB 4.6078 7.6796 9.9835 6.7775 Constraint (T0311)A30.CB (T0311)E80.CB 5.4848 9.1413 11.8837 6.7404 Constraint (T0311)E26.CB (T0311)E80.CB 5.9788 9.9647 12.9541 6.7404 Constraint (T0311)S23.CB (T0311)E80.CB 6.9767 11.6279 15.1162 6.7404 Constraint (T0311)S57.CB (T0311)T82.CB 6.0940 10.1567 13.2037 6.7365 Constraint (T0311)L56.CB (T0311)T82.CB 6.5257 10.8762 14.1391 6.7365 Constraint (T0311)L42.CB (T0311)A79.CB 5.8117 9.6862 12.5921 6.7288 Constraint (T0311)A53.CB (T0311)A77.CB 6.1950 10.3250 13.4224 6.6417 Constraint (T0311)P50.CB (T0311)Q65.CB 6.2110 10.3516 13.4571 6.6221 Constraint (T0311)M52.CB (T0311)Q71.CB 5.5859 9.3098 12.1027 6.5894 Constraint (T0311)A47.CB (T0311)Q71.CB 3.8762 6.4603 8.3984 6.5894 Constraint (T0311)A46.CB (T0311)Q71.CB 6.1683 10.2806 13.3647 6.5894 Constraint (T0311)I12.CB (T0311)V59.CB 6.3141 10.5235 13.6805 6.5861 Constraint (T0311)Q14.CB (T0311)M31.CB 6.3033 10.5055 13.6572 6.5786 Constraint (T0311)Q65.CB (T0311)K81.CB 5.1521 8.5868 11.1628 6.5614 Constraint (T0311)Q14.CB (T0311)A30.CB 6.8499 11.4165 14.8414 6.4962 Constraint (T0311)V59.CB (T0311)T82.CB 5.2617 8.7695 11.4003 6.4350 Constraint (T0311)Q65.CB (T0311)E78.CB 5.5829 9.3048 12.0962 6.3932 Constraint (T0311)E15.CB (T0311)L24.CB 6.7121 11.1868 14.5429 6.3785 Constraint (T0311)D11.CB (T0311)L70.CB 5.9380 9.8967 12.8657 6.2416 Constraint (T0311)P9.CB (T0311)R40.CB 6.6059 11.0098 14.3127 6.0150 Constraint (T0311)S63.CB (T0311)V83.CB 5.7513 9.5855 12.4612 6.0067 Constraint (T0311)E32.CB (T0311)I60.CB 6.7442 11.2403 14.6125 5.9999 Constraint (T0311)E19.CB (T0311)M66.CB 6.9208 11.5347 14.9951 5.9999 Constraint (T0311)D18.CB (T0311)L41.CB 6.7460 11.2434 14.6164 5.9942 Constraint (T0311)I54.CB (T0311)V83.CB 4.5890 7.6483 9.9427 5.9904 Constraint (T0311)P50.CB (T0311)V83.CB 3.7540 6.2566 8.1336 5.9904 Constraint (T0311)P50.CB (T0311)T82.CB 4.0131 6.6885 8.6951 5.9904 Constraint (T0311)T49.CB (T0311)T82.CB 6.0813 10.1355 13.1761 5.9904 Constraint (T0311)D11.CB (T0311)S62.CB 6.5141 10.8568 14.1139 5.9904 Constraint (T0311)L20.CB (T0311)A38.CB 6.5920 10.9866 14.2826 5.9886 Constraint (T0311)Q65.CB (T0311)A79.CB 5.2881 8.8134 11.4574 5.9884 Constraint (T0311)Q65.CB (T0311)A77.CB 3.6149 6.0248 7.8322 5.9884 Constraint (T0311)L17.CB (T0311)K45.CB 6.0257 10.0428 13.0556 5.9828 Constraint (T0311)I12.CB (T0311)R29.CB 6.9692 11.6153 15.0999 5.9828 Constraint (T0311)A34.CB (T0311)K45.CB 6.8035 11.3392 14.7410 5.9768 Constraint (T0311)K55.CB (T0311)K81.CB 6.6245 11.0409 14.3532 5.9657 Constraint (T0311)I33.CB (T0311)K45.CB 6.9954 11.6591 15.1568 5.9527 Constraint (T0311)I54.CB (T0311)K81.CB 6.3314 10.5524 13.7181 5.9340 Constraint (T0311)L41.CB (T0311)E80.CB 4.7405 7.9009 10.2712 5.9308 Constraint (T0311)A38.CB (T0311)V83.CB 6.6664 11.1107 14.4440 5.9308 Constraint (T0311)A38.CB (T0311)E80.CB 4.7998 7.9996 10.3995 5.9308 Constraint (T0311)I33.CB (T0311)E80.CB 6.5581 10.9302 14.2092 5.9308 Constraint (T0311)M31.CB (T0311)V83.CB 5.8295 9.7158 12.6305 5.9308 Constraint (T0311)M31.CB (T0311)E80.CB 5.0123 8.3538 10.8599 5.9308 Constraint (T0311)A30.CB (T0311)V83.CB 3.6295 6.0491 7.8638 5.9308 Constraint (T0311)R29.CB (T0311)V83.CB 5.6969 9.4948 12.3432 5.9308 Constraint (T0311)A28.CB (T0311)V83.CB 6.3566 10.5943 13.7726 5.9308 Constraint (T0311)A28.CB (T0311)E80.CB 6.3315 10.5525 13.7183 5.9308 Constraint (T0311)F27.CB (T0311)V83.CB 3.6807 6.1345 7.9748 5.9308 Constraint (T0311)E26.CB (T0311)V83.CB 3.3901 5.6501 7.3451 5.9308 Constraint (T0311)R25.CB (T0311)V83.CB 6.4165 10.6942 13.9025 5.9308 Constraint (T0311)S23.CB (T0311)V83.CB 5.4059 9.0098 11.7128 5.9308 Constraint (T0311)L17.CB (T0311)R29.CB 6.1322 10.2203 13.2864 5.9117 Constraint (T0311)S62.CB (T0311)L76.CB 6.2316 10.3860 13.5018 5.8804 Constraint (T0311)I12.CB (T0311)T43.CB 7.0795 11.7991 15.3389 5.8730 Constraint (T0311)Q14.CB (T0311)V59.CB 6.2070 10.3450 13.4485 5.8556 Constraint (T0311)E19.CB (T0311)L70.CB 6.3877 10.6461 13.8399 5.8367 Constraint (T0311)R8.CB (T0311)W67.CB 6.0436 10.0726 13.0944 5.8367 Constraint (T0311)R8.CB (T0311)K45.CB 6.9602 11.6004 15.0805 5.8367 Constraint (T0311)R8.CB (T0311)T43.CB 6.2791 10.4652 13.6048 5.8367 Constraint (T0311)R8.CB (T0311)L42.CB 5.8410 9.7351 12.6556 5.8367 Constraint (T0311)L42.CB (T0311)I54.CB 5.5551 9.2584 12.0360 5.8205 Constraint (T0311)A46.CB (T0311)W67.CB 6.8265 11.3775 14.7907 5.7707 Constraint (T0311)T37.CB (T0311)I60.CB 6.8982 11.4969 14.9460 5.7563 Constraint (T0311)L42.CB (T0311)L76.CB 4.8158 8.0264 10.4343 5.7525 Constraint (T0311)R25.CB (T0311)A79.CB 6.6809 11.1348 14.4752 5.7513 Constraint (T0311)L24.CB (T0311)A79.CB 6.0419 10.0699 13.0909 5.7513 Constraint (T0311)S23.CB (T0311)A79.CB 6.5230 10.8716 14.1331 5.7513 Constraint (T0311)M31.CB (T0311)P64.CB 7.0524 11.7540 15.2802 5.7057 Constraint (T0311)L41.CB (T0311)L68.CB 7.0157 11.6928 15.2006 5.6582 Constraint (T0311)S57.CB (T0311)K81.CB 4.1617 6.9362 9.0170 5.6161 Constraint (T0311)T43.CB (T0311)M52.CB 6.2579 10.4299 13.5588 5.5879 Constraint (T0311)V22.CB (T0311)E80.CB 5.3222 8.8704 11.5315 5.5737 Constraint (T0311)I54.CB (T0311)Q71.CB 5.5221 9.2035 11.9646 5.5730 Constraint (T0311)M52.CB (T0311)L70.CB 4.9357 8.2262 10.6941 5.5730 Constraint (T0311)E51.CB (T0311)Q71.CB 6.0491 10.0818 13.1064 5.5730 Constraint (T0311)E51.CB (T0311)L70.CB 6.8761 11.4602 14.8983 5.5730 Constraint (T0311)P50.CB (T0311)Q71.CB 3.4615 5.7691 7.4999 5.5730 Constraint (T0311)P50.CB (T0311)L70.CB 5.5369 9.2282 11.9967 5.5730 Constraint (T0311)T49.CB (T0311)Q71.CB 4.3815 7.3026 9.4934 5.5730 Constraint (T0311)T49.CB (T0311)L70.CB 5.7526 9.5877 12.4640 5.5730 Constraint (T0311)L48.CB (T0311)L70.CB 2.8611 4.7685 6.1990 5.5730 Constraint (T0311)L48.CB (T0311)N69.CB 5.9575 9.9291 12.9078 5.5730 Constraint (T0311)L48.CB (T0311)S62.CB 6.7902 11.3171 14.7122 5.5730 Constraint (T0311)A47.CB (T0311)L70.CB 4.3462 7.2436 9.4167 5.5730 Constraint (T0311)A46.CB (T0311)L70.CB 5.4980 9.1634 11.9124 5.5730 Constraint (T0311)T43.CB (T0311)A73.CB 7.1096 11.8493 15.4041 5.5730 Constraint (T0311)T43.CB (T0311)L70.CB 6.4891 10.8152 14.0598 5.5730 Constraint (T0311)L42.CB (T0311)N69.CB 6.7179 11.1964 14.5554 5.5730 Constraint (T0311)L41.CB (T0311)Q71.CB 5.5386 9.2310 12.0003 5.5730 Constraint (T0311)R40.CB (T0311)L70.CB 6.8323 11.3871 14.8033 5.5730 Constraint (T0311)A38.CB (T0311)A47.CB 6.5634 10.9390 14.2207 5.5730 Constraint (T0311)M31.CB (T0311)P50.CB 6.8494 11.4156 14.8403 5.5730 Constraint (T0311)A30.CB (T0311)E51.CB 5.9618 9.9364 12.9173 5.5730 Constraint (T0311)R29.CB (T0311)M52.CB 6.6324 11.0539 14.3701 5.5730 Constraint (T0311)E26.CB (T0311)S39.CB 6.7673 11.2788 14.6625 5.5730 Constraint (T0311)S23.CB (T0311)L56.CB 6.7517 11.2528 14.6287 5.5344 Constraint (T0311)D18.CB (T0311)A30.CB 6.8742 11.4571 14.8942 5.5256 Constraint (T0311)I13.CB (T0311)I54.CB 6.2386 10.3977 13.5169 5.5077 Constraint (T0311)L24.CB (T0311)M52.CB 6.5972 10.9953 14.2939 5.4828 Constraint (T0311)Q14.CB (T0311)E26.CB 5.8735 9.7891 12.7259 5.4828 Constraint (T0311)Q14.CB (T0311)R25.CB 6.1375 10.2292 13.2980 5.4828 Constraint (T0311)A38.CB (T0311)I54.CB 6.5529 10.9216 14.1981 5.3744 Constraint (T0311)A34.CB (T0311)A47.CB 6.7909 11.3181 14.7136 5.2993 Constraint (T0311)S16.CB (T0311)M52.CB 6.1237 10.2061 13.2679 5.2920 Constraint (T0311)L41.CB (T0311)P64.CB 6.6221 11.0368 14.3479 5.2786 Constraint (T0311)Q14.CB (T0311)S57.CB 6.3341 10.5569 13.7240 5.1895 Constraint (T0311)M31.CB (T0311)A79.CB 3.2895 5.4824 7.1272 5.1683 Constraint (T0311)A30.CB (T0311)A79.CB 2.9383 4.8972 6.3664 5.1683 Constraint (T0311)A28.CB (T0311)A79.CB 5.0595 8.4325 10.9623 5.1683 Constraint (T0311)F27.CB (T0311)A79.CB 2.9858 4.9763 6.4692 5.1683 Constraint (T0311)Q65.CB (T0311)L76.CB 5.5321 9.2202 11.9863 5.0913 Constraint (T0311)K55.CB (T0311)V83.CB 7.0493 11.7489 15.2736 5.0067 Constraint (T0311)L17.CB (T0311)S63.CB 6.3377 10.5628 13.7316 5.0051 Constraint (T0311)A34.CB (T0311)T49.CB 6.8281 11.3801 14.7942 5.0001 Constraint (T0311)E19.CB (T0311)L56.CB 6.1808 10.3013 13.3917 4.9920 Constraint (T0311)S16.CB (T0311)K55.CB 6.0916 10.1527 13.1985 4.9920 Constraint (T0311)Q65.CB (T0311)D84.CB 4.8644 8.1073 10.5394 4.9904 Constraint (T0311)Q65.CB (T0311)T82.CB 6.5304 10.8839 14.1491 4.9904 Constraint (T0311)P64.CB (T0311)D84.CB 5.1370 8.5616 11.1301 4.9904 Constraint (T0311)S63.CB (T0311)D84.CB 6.3690 10.6150 13.7996 4.9904 Constraint (T0311)I54.CB (T0311)R87.CB 6.1811 10.3018 13.3924 4.9904 Constraint (T0311)I54.CB (T0311)S86.CB 6.3948 10.6580 13.8554 4.9904 Constraint (T0311)I54.CB (T0311)D84.CB 6.6403 11.0672 14.3873 4.9904 Constraint (T0311)I54.CB (T0311)T82.CB 6.3207 10.5346 13.6949 4.9904 Constraint (T0311)A53.CB (T0311)V83.CB 4.3295 7.2159 9.3806 4.9904 Constraint (T0311)A53.CB (T0311)T82.CB 5.6442 9.4069 12.2290 4.9904 Constraint (T0311)A53.CB (T0311)K81.CB 6.8328 11.3881 14.8045 4.9904 Constraint (T0311)M52.CB (T0311)V83.CB 6.6812 11.1354 14.4760 4.9904 Constraint (T0311)E51.CB (T0311)S86.CB 6.4925 10.8208 14.0671 4.9904 Constraint (T0311)E51.CB (T0311)V83.CB 5.6327 9.3878 12.2041 4.9904 Constraint (T0311)E51.CB (T0311)T82.CB 6.5664 10.9440 14.2272 4.9904 Constraint (T0311)E51.CB (T0311)A79.CB 5.7911 9.6518 12.5474 4.9904 Constraint (T0311)P50.CB (T0311)R87.CB 5.7426 9.5711 12.4424 4.9904 Constraint (T0311)P50.CB (T0311)S86.CB 4.2096 7.0160 9.1209 4.9904 Constraint (T0311)P50.CB (T0311)V85.CB 6.0052 10.0087 13.0113 4.9904 Constraint (T0311)P50.CB (T0311)D84.CB 5.9980 9.9966 12.9956 4.9904 Constraint (T0311)P50.CB (T0311)K81.CB 6.0053 10.0088 13.0115 4.9904 Constraint (T0311)P50.CB (T0311)E80.CB 5.5215 9.2025 11.9633 4.9904 Constraint (T0311)P50.CB (T0311)A79.CB 3.2510 5.4184 7.0439 4.9904 Constraint (T0311)P50.CB (T0311)E78.CB 5.4842 9.1404 11.8825 4.9904 Constraint (T0311)T49.CB (T0311)S86.CB 6.8333 11.3888 14.8055 4.9904 Constraint (T0311)T49.CB (T0311)V83.CB 5.8506 9.7511 12.6764 4.9904 Constraint (T0311)T49.CB (T0311)A79.CB 4.8658 8.1097 10.5426 4.9904 Constraint (T0311)T49.CB (T0311)E78.CB 6.6701 11.1168 14.4518 4.9904 Constraint (T0311)L48.CB (T0311)V83.CB 6.2374 10.3957 13.5144 4.9904 Constraint (T0311)L48.CB (T0311)T82.CB 6.2766 10.4611 13.5994 4.9904 Constraint (T0311)L48.CB (T0311)A79.CB 4.3488 7.2481 9.4225 4.9904 Constraint (T0311)L48.CB (T0311)E78.CB 5.8546 9.7576 12.6849 4.9904 Constraint (T0311)V22.CB (T0311)A79.CB 6.0428 10.0714 13.0928 4.9862 Constraint (T0311)K55.CB (T0311)E80.CB 5.6622 9.4370 12.2681 4.9779 Constraint (T0311)L41.CB (T0311)S75.CB 6.1064 10.1773 13.2304 4.9654 Constraint (T0311)L42.CB (T0311)A77.CB 6.3088 10.5146 13.6690 4.9532 Constraint (T0311)L56.CB (T0311)K81.CB 5.7831 9.6385 12.5300 4.9494 Constraint (T0311)K55.CB (T0311)T82.CB 6.8987 11.4978 14.9471 4.9494 Constraint (T0311)S23.CB (T0311)D84.CB 6.6615 11.1025 14.4332 4.9462 Constraint (T0311)P35.CB (T0311)A79.CB 6.8106 11.3510 14.7563 4.9416 Constraint (T0311)T37.CB (T0311)E80.CB 7.1635 11.9391 15.5209 4.9384 Constraint (T0311)I12.CB (T0311)R40.CB 6.3343 10.5571 13.7242 4.9063 Constraint (T0311)I12.CB (T0311)T37.CB 5.4549 9.0915 11.8190 4.9063 Constraint (T0311)A30.CB (T0311)S62.CB 6.6858 11.1430 14.4859 4.8980 Constraint (T0311)R40.CB (T0311)V58.CB 5.3268 8.8780 11.5414 4.8967 Constraint (T0311)S39.CB (T0311)S57.CB 5.3103 8.8505 11.5056 4.8967 Constraint (T0311)I54.CB (T0311)L76.CB 5.6367 9.3945 12.2128 4.7881 Constraint (T0311)R29.CB (T0311)T82.CB 6.5112 10.8520 14.1076 4.7744 Constraint (T0311)V22.CB (T0311)T82.CB 5.8495 9.7492 12.6739 4.7744 Constraint (T0311)V22.CB (T0311)V83.CB 4.5521 7.5869 9.8629 4.7641 Constraint (T0311)A30.CB (T0311)E78.CB 4.8708 8.1180 10.5534 4.7635 Constraint (T0311)R29.CB (T0311)A79.CB 5.1867 8.6444 11.2378 4.7635 Constraint (T0311)F27.CB (T0311)E78.CB 5.7904 9.6506 12.5458 4.7635 Constraint (T0311)E26.CB (T0311)A79.CB 4.7044 7.8407 10.1930 4.7635 Constraint (T0311)V59.CB (T0311)K81.CB 4.9403 8.2339 10.7040 4.6478 Constraint (T0311)I54.CB (T0311)E78.CB 4.7955 7.9925 10.3902 4.6360 Constraint (T0311)I12.CB (T0311)I54.CB 6.6434 11.0723 14.3940 4.5938 Constraint (T0311)M66.CB (T0311)E80.CB 6.1246 10.2077 13.2700 4.5860 Constraint (T0311)F27.CB (T0311)L76.CB 5.3849 8.9749 11.6674 4.5660 Constraint (T0311)S39.CB (T0311)I54.CB 5.0111 8.3518 10.8573 4.5224 Constraint (T0311)S57.CB (T0311)E78.CB 3.8683 6.4471 8.3812 4.4385 Constraint (T0311)L56.CB (T0311)E78.CB 5.3828 8.9713 11.6626 4.4385 Constraint (T0311)L24.CB (T0311)L88.CB 5.5576 9.2626 12.0414 4.3664 Constraint (T0311)M31.CB (T0311)E78.CB 4.2919 7.1532 9.2992 4.3587 Constraint (T0311)L42.CB (T0311)P64.CB 6.7677 11.2795 14.6633 4.3581 Constraint (T0311)S39.CB (T0311)K55.CB 6.6503 11.0839 14.4090 4.3581 Constraint (T0311)S16.CB (T0311)N69.CB 5.9568 9.9280 12.9065 4.3335 Constraint (T0311)S39.CB (T0311)A53.CB 7.0225 11.7042 15.2155 4.2933 Constraint (T0311)V59.CB (T0311)V83.CB 4.5898 7.6496 9.9445 4.2330 Constraint (T0311)L17.CB (T0311)L70.CB 6.8844 11.4741 14.9163 4.2144 Constraint (T0311)I13.CB (T0311)Q71.CB 5.3996 8.9994 11.6992 4.2144 Constraint (T0311)I12.CB (T0311)Q71.CB 3.4616 5.7693 7.5001 4.2144 Constraint (T0311)I12.CB (T0311)K45.CB 6.2918 10.4864 13.6323 4.2087 Constraint (T0311)V58.CB (T0311)L70.CB 5.8508 9.7513 12.6767 4.2067 Constraint (T0311)L56.CB (T0311)N69.CB 6.1272 10.2119 13.2755 4.2067 Constraint (T0311)E15.CB (T0311)E80.CB 6.0918 10.1530 13.1989 4.1881 Constraint (T0311)Q14.CB (T0311)E80.CB 5.5331 9.2218 11.9883 4.1881 Constraint (T0311)Q14.CB (T0311)A28.CB 6.8749 11.4581 14.8955 4.1263 Constraint (T0311)Q65.CB (T0311)S75.CB 5.4708 9.1179 11.8533 4.0913 Constraint (T0311)P9.CB (T0311)Q65.CB 6.9498 11.5830 15.0579 3.9986 Constraint (T0311)Q14.CB (T0311)A53.CB 5.7638 9.6063 12.4881 3.9980 Constraint (T0311)L48.CB (T0311)E80.CB 6.6470 11.0783 14.4018 3.9904 Constraint (T0311)A47.CB (T0311)A79.CB 5.9396 9.8993 12.8691 3.9904 Constraint (T0311)A47.CB (T0311)E78.CB 6.8166 11.3611 14.7694 3.9904 Constraint (T0311)E15.CB (T0311)A53.CB 6.6770 11.1284 14.4669 3.9899 Constraint (T0311)M52.CB (T0311)S75.CB 4.5103 7.5172 9.7723 3.9855 Constraint (T0311)T49.CB (T0311)S75.CB 5.7394 9.5656 12.4353 3.9855 Constraint (T0311)T43.CB (T0311)L76.CB 6.3658 10.6097 13.7926 3.9654 Constraint (T0311)L41.CB (T0311)A77.CB 5.3612 8.9354 11.6160 3.9654 Constraint (T0311)L41.CB (T0311)L76.CB 3.4190 5.6983 7.4078 3.9654 Constraint (T0311)R40.CB (T0311)L76.CB 5.6616 9.4360 12.2669 3.9654 Constraint (T0311)T43.CB (T0311)E80.CB 6.6077 11.0128 14.3166 3.9647 Constraint (T0311)L41.CB (T0311)K81.CB 6.8484 11.4141 14.8383 3.9647 Constraint (T0311)V22.CB (T0311)K81.CB 6.6861 11.1436 14.4866 3.9647 Constraint (T0311)L42.CB (T0311)L88.CB 6.6847 11.1411 14.4834 3.9616 Constraint (T0311)S39.CB (T0311)L88.CB 6.4095 10.6826 13.8874 3.9616 Constraint (T0311)K45.CB (T0311)S57.CB 5.7646 9.6077 12.4900 3.9615 Constraint (T0311)K45.CB (T0311)K55.CB 5.8985 9.8308 12.7800 3.9615 Constraint (T0311)K45.CB (T0311)I54.CB 5.2681 8.7802 11.4143 3.9615 Constraint (T0311)M52.CB (T0311)E78.CB 6.3676 10.6127 13.7966 3.9538 Constraint (T0311)L41.CB (T0311)E78.CB 6.3276 10.5461 13.7099 3.9538 Constraint (T0311)A38.CB (T0311)A79.CB 4.5585 7.5975 9.8767 3.9538 Constraint (T0311)A38.CB (T0311)E78.CB 6.8511 11.4185 14.8441 3.9538 Constraint (T0311)T37.CB (T0311)A79.CB 6.2029 10.3382 13.4397 3.9538 Constraint (T0311)I33.CB (T0311)A79.CB 4.5518 7.5864 9.8623 3.9538 Constraint (T0311)I33.CB (T0311)E78.CB 6.3511 10.5851 13.7607 3.9538 Constraint (T0311)E32.CB (T0311)A79.CB 5.0426 8.4043 10.9256 3.9538 Constraint (T0311)E32.CB (T0311)E78.CB 6.1029 10.1716 13.2230 3.9538 Constraint (T0311)A30.CB (T0311)D84.CB 6.6888 11.1480 14.4923 3.9538 Constraint (T0311)F27.CB (T0311)D84.CB 5.9496 9.9160 12.8908 3.9538 Constraint (T0311)E26.CB (T0311)D84.CB 6.0336 10.0560 13.0728 3.9538 Constraint (T0311)I12.CB (T0311)S39.CB 6.5444 10.9074 14.1796 3.8900 Constraint (T0311)I12.CB (T0311)L24.CB 6.2816 10.4693 13.6100 3.8900 Constraint (T0311)I12.CB (T0311)E26.CB 6.9767 11.6279 15.1163 3.8843 Constraint (T0311)L17.CB (T0311)A53.CB 7.0525 11.7541 15.2803 3.8690 Constraint (T0311)L88.CB (T0311)P97.CB 6.0481 10.0802 13.1043 3.8557 Constraint (T0311)P9.CB (T0311)I54.CB 6.9236 11.5394 15.0012 3.8531 Constraint (T0311)P9.CB (T0311)P50.CB 5.4368 9.0613 11.7797 3.8531 Constraint (T0311)R8.CB (T0311)L48.CB 6.6864 11.1440 14.4871 3.8531 Constraint (T0311)S16.CB (T0311)A73.CB 6.7349 11.2248 14.5922 3.8096 Constraint (T0311)I12.CB (T0311)A73.CB 5.6407 9.4011 12.2214 3.8096 Constraint (T0311)S57.CB (T0311)L76.CB 5.2936 8.8227 11.4695 3.8035 Constraint (T0311)S63.CB (T0311)L76.CB 5.0628 8.4380 10.9695 3.7871 Constraint (T0311)Q14.CB (T0311)A79.CB 5.8562 9.7604 12.6885 3.7833 Constraint (T0311)S39.CB (T0311)L76.CB 6.1586 10.2644 13.3437 3.7564 Constraint (T0311)A38.CB (T0311)L76.CB 5.0873 8.4789 11.0225 3.7564 Constraint (T0311)L24.CB (T0311)L76.CB 5.9072 9.8453 12.7989 3.7564 Constraint (T0311)S16.CB (T0311)E80.CB 5.4532 9.0887 11.8153 3.6683 Constraint (T0311)K55.CB (T0311)E78.CB 4.9278 8.2130 10.6769 3.6677 Constraint (T0311)V59.CB (T0311)E80.CB 3.2765 5.4609 7.0992 3.6600 Constraint (T0311)V58.CB (T0311)E80.CB 4.7534 7.9223 10.2990 3.6600 Constraint (T0311)V58.CB (T0311)T82.CB 4.5524 7.5873 9.8635 3.6315 Constraint (T0311)V58.CB (T0311)K81.CB 4.0658 6.7764 8.8093 3.6315 Constraint (T0311)W67.CB (T0311)V83.CB 4.9164 8.1940 10.6522 3.5874 Constraint (T0311)W67.CB (T0311)T82.CB 6.2567 10.4278 13.5561 3.5874 Constraint (T0311)N21.CB (T0311)A79.CB 7.0655 11.7758 15.3085 3.5846 Constraint (T0311)V59.CB (T0311)A79.CB 4.9632 8.2719 10.7535 3.4702 Constraint (T0311)V58.CB (T0311)A79.CB 6.0638 10.1063 13.1382 3.4702 Constraint (T0311)L20.CB (T0311)Q71.CB 6.2524 10.4206 13.5468 3.4267 Constraint (T0311)W67.CB (T0311)A79.CB 5.6471 9.4118 12.2353 3.4160 Constraint (T0311)W67.CB (T0311)L76.CB 6.1268 10.2113 13.2746 3.4096 Constraint (T0311)W67.CB (T0311)A77.CB 6.1131 10.1886 13.2451 3.3900 Constraint (T0311)A46.CB (T0311)P64.CB 6.4931 10.8218 14.0683 3.3806 Constraint (T0311)I60.CB (T0311)E80.CB 6.6462 11.0769 14.4000 3.3765 Constraint (T0311)S23.CB (T0311)L88.CB 5.3873 8.9789 11.6726 3.3740 Constraint (T0311)I60.CB (T0311)T82.CB 4.7741 7.9568 10.3438 3.3479 Constraint (T0311)E19.CB (T0311)L76.CB 6.5816 10.9693 14.2601 3.3345 Constraint (T0311)I12.CB (T0311)P35.CB 7.1300 11.8834 15.4484 3.2942 Constraint (T0311)I12.CB (T0311)M52.CB 6.1860 10.3100 13.4031 3.2918 Constraint (T0311)L17.CB (T0311)P64.CB 4.6761 7.7936 10.1316 3.2847 Constraint (T0311)N21.CB (T0311)E80.CB 5.4150 9.0250 11.7325 3.2635 Constraint (T0311)D11.CB (T0311)K45.CB 6.2316 10.3860 13.5019 3.2416 Constraint (T0311)I60.CB (T0311)A73.CB 6.9135 11.5225 14.9793 3.2392 Constraint (T0311)L70.CB (T0311)A79.CB 5.2526 8.7544 11.3807 3.2307 Constraint (T0311)L17.CB (T0311)M52.CB 7.0208 11.7013 15.2117 3.2118 Constraint (T0311)D18.CB (T0311)A77.CB 6.2692 10.4486 13.5832 3.1876 Constraint (T0311)Q14.CB (T0311)E78.CB 6.9478 11.5797 15.0536 3.1876 Constraint (T0311)Q14.CB (T0311)L76.CB 4.8676 8.1126 10.5464 3.1876 Constraint (T0311)A38.CB (T0311)W67.CB 6.4324 10.7207 13.9369 3.1125 Constraint (T0311)S39.CB (T0311)V58.CB 5.9064 9.8440 12.7972 3.1096 Constraint (T0311)Q65.CB (T0311)W74.CB 6.6118 11.0196 14.3255 3.0932 Constraint (T0311)P64.CB (T0311)A73.CB 5.9211 9.8684 12.8290 3.0932 Constraint (T0311)S63.CB (T0311)A73.CB 6.1435 10.2391 13.3108 3.0932 Constraint (T0311)M66.CB (T0311)L76.CB 5.7160 9.5267 12.3847 3.0932 Constraint (T0311)M66.CB (T0311)A77.CB 6.4256 10.7093 13.9221 3.0900 Constraint (T0311)D11.CB (T0311)M31.CB 6.0039 10.0065 13.0084 3.0886 Constraint (T0311)D11.CB (T0311)F27.CB 7.1127 11.8546 15.4109 3.0886 Constraint (T0311)V59.CB (T0311)L70.CB 4.9721 8.2867 10.7728 3.0352 Constraint (T0311)R40.CB (T0311)E51.CB 5.0334 8.3890 10.9057 3.0352 Constraint (T0311)M66.CB (T0311)V83.CB 5.7550 9.5917 12.4692 3.0144 Constraint (T0311)L17.CB (T0311)E80.CB 4.4369 7.3948 9.6132 3.0016 Constraint (T0311)L17.CB (T0311)A79.CB 4.5603 7.6005 9.8807 3.0016 Constraint (T0311)S16.CB (T0311)A79.CB 5.3602 8.9337 11.6138 3.0016 Constraint (T0311)I13.CB (T0311)A79.CB 5.1415 8.5692 11.1400 3.0016 Constraint (T0311)A53.CB (T0311)L76.CB 4.7330 7.8883 10.2548 3.0009 Constraint (T0311)T49.CB (T0311)W74.CB 6.4152 10.6920 13.8996 3.0009 Constraint (T0311)L20.CB (T0311)W67.CB 7.0633 11.7721 15.3037 3.0000 Constraint (T0311)S16.CB (T0311)Q71.CB 5.7277 9.5462 12.4101 3.0000 Constraint (T0311)E15.CB (T0311)A73.CB 6.4895 10.8158 14.0605 3.0000 Constraint (T0311)E15.CB (T0311)Q71.CB 5.7642 9.6070 12.4891 3.0000 Constraint (T0311)Q14.CB (T0311)Q71.CB 7.0479 11.7465 15.2705 3.0000 Constraint (T0311)I12.CB (T0311)N72.CB 5.5264 9.2107 11.9739 3.0000 Constraint (T0311)D11.CB (T0311)A73.CB 7.1901 11.9835 15.5785 3.0000 Constraint (T0311)D11.CB (T0311)Q71.CB 5.0495 8.4158 10.9405 3.0000 Constraint (T0311)L48.CB (T0311)V59.CB 6.4166 10.6943 13.9026 3.0000 Constraint (T0311)L48.CB (T0311)V58.CB 7.1101 11.8501 15.4051 3.0000 Constraint (T0311)L20.CB (T0311)M66.CB 7.1145 11.8575 15.4147 3.0000 Constraint (T0311)P9.CB (T0311)A38.CB 7.1273 11.8789 15.4425 3.0000 Constraint (T0311)R8.CB (T0311)A47.CB 5.7483 9.5805 12.4547 3.0000 Constraint (T0311)P7.CB (T0311)L68.CB 5.9356 9.8927 12.8605 3.0000 Constraint (T0311)P7.CB (T0311)W67.CB 5.1750 8.6251 11.2126 3.0000 Constraint (T0311)P7.CB (T0311)M66.CB 6.1714 10.2856 13.3713 3.0000 Constraint (T0311)P7.CB (T0311)S16.CB 6.7361 11.2268 14.5948 3.0000 Constraint (T0311)H6.CB (T0311)L68.CB 6.1345 10.2241 13.2913 3.0000 Constraint (T0311)H6.CB (T0311)W67.CB 7.1212 11.8686 15.4292 3.0000 Constraint (T0311)E32.CB (T0311)S57.CB 7.1945 11.9908 15.5881 3.0000 Constraint (T0311)L20.CB (T0311)L42.CB 6.7312 11.2187 14.5843 3.0000 Constraint (T0311)L17.CB (T0311)T37.CB 7.1595 11.9326 15.5123 3.0000 Constraint (T0311)I13.CB (T0311)V58.CB 6.2595 10.4325 13.5622 3.0000 Constraint (T0311)I12.CB (T0311)V58.CB 7.1111 11.8518 15.4073 3.0000 Constraint (T0311)D11.CB (T0311)S57.CB 6.6460 11.0766 14.3996 3.0000 Constraint (T0311)D11.CB (T0311)A53.CB 6.2311 10.3852 13.5008 3.0000 Constraint (T0311)I12.CB (T0311)E80.CB 6.3870 10.6450 13.8385 2.9967 Constraint (T0311)D18.CB (T0311)K45.CB 5.3146 8.8577 11.5150 2.9942 Constraint (T0311)E15.CB (T0311)K45.CB 6.1724 10.2874 13.3736 2.9942 Constraint (T0311)I12.CB (T0311)A34.CB 7.1991 11.9985 15.5980 2.9942 Constraint (T0311)V58.CB (T0311)V83.CB 6.1272 10.2120 13.2755 2.9932 Constraint (T0311)L70.CB (T0311)T82.CB 5.1419 8.5698 11.1407 2.9922 Constraint (T0311)V22.CB (T0311)L41.CB 7.0767 11.7945 15.3329 2.9918 Constraint (T0311)E19.CB (T0311)S57.CB 7.1346 11.8910 15.4583 2.9918 Constraint (T0311)S16.CB (T0311)I54.CB 7.0227 11.7044 15.2158 2.9918 Constraint (T0311)W67.CB (T0311)E80.CB 5.3156 8.8593 11.5170 2.9909 Constraint (T0311)V22.CB (T0311)A46.CB 7.0292 11.7153 15.2299 2.9886 Constraint (T0311)L17.CB (T0311)A46.CB 6.8780 11.4633 14.9023 2.9886 Constraint (T0311)S16.CB (T0311)E32.CB 6.4264 10.7107 13.9239 2.9886 Constraint (T0311)I13.CB (T0311)E32.CB 6.3454 10.5757 13.7483 2.9886 Constraint (T0311)I13.CB (T0311)R29.CB 6.8741 11.4568 14.8939 2.9886 Constraint (T0311)M52.CB (T0311)A77.CB 5.8393 9.7322 12.6518 2.9855 Constraint (T0311)M52.CB (T0311)L76.CB 3.6528 6.0880 7.9145 2.9855 Constraint (T0311)E51.CB (T0311)A77.CB 6.6010 11.0017 14.3022 2.9855 Constraint (T0311)E51.CB (T0311)L76.CB 5.7674 9.6124 12.4961 2.9855 Constraint (T0311)T49.CB (T0311)L76.CB 5.9200 9.8666 12.8266 2.9855 Constraint (T0311)T43.CB (T0311)V92.CB 6.0050 10.0083 13.0107 2.9769 Constraint (T0311)T43.CB (T0311)L88.CB 5.8293 9.7154 12.6301 2.9769 Constraint (T0311)S39.CB (T0311)V92.CB 6.2692 10.4487 13.5833 2.9769 Constraint (T0311)P35.CB (T0311)L48.CB 7.0838 11.8063 15.3482 2.9769 Constraint (T0311)P35.CB (T0311)K45.CB 6.8085 11.3475 14.7518 2.9769 Constraint (T0311)L24.CB (T0311)K45.CB 7.0160 11.6933 15.2013 2.9769 Constraint (T0311)V22.CB (T0311)D84.CB 4.3781 7.2968 9.4858 2.9769 Constraint (T0311)T43.CB (T0311)S86.CB 6.9302 11.5503 15.0154 2.9724 Constraint (T0311)L42.CB (T0311)V85.CB 6.4112 10.6854 13.8910 2.9692 Constraint (T0311)L24.CB (T0311)V85.CB 5.3879 8.9798 11.6738 2.9692 Constraint (T0311)S23.CB (T0311)V85.CB 4.9864 8.3106 10.8038 2.9692 Constraint (T0311)E51.CB (T0311)E78.CB 6.2952 10.4921 13.6397 2.9692 Constraint (T0311)E51.CB (T0311)S75.CB 4.6204 7.7007 10.0109 2.9692 Constraint (T0311)P50.CB (T0311)A77.CB 6.2014 10.3357 13.4364 2.9692 Constraint (T0311)P50.CB (T0311)L76.CB 6.0094 10.0156 13.0203 2.9692 Constraint (T0311)P50.CB (T0311)S75.CB 4.9584 8.2640 10.7432 2.9692 Constraint (T0311)L48.CB (T0311)A77.CB 6.6610 11.1016 14.4321 2.9692 Constraint (T0311)L48.CB (T0311)L76.CB 5.2544 8.7574 11.3846 2.9692 Constraint (T0311)L48.CB (T0311)S75.CB 5.2361 8.7269 11.3449 2.9692 Constraint (T0311)K45.CB (T0311)I60.CB 7.1208 11.8680 15.4284 2.9634 Constraint (T0311)M31.CB (T0311)K45.CB 7.0677 11.7796 15.3134 2.9634 Constraint (T0311)R25.CB (T0311)I60.CB 7.0984 11.8306 15.3798 2.9634 Constraint (T0311)R25.CB (T0311)L56.CB 6.9754 11.6256 15.1133 2.9634 Constraint (T0311)L24.CB (T0311)S57.CB 7.1537 11.9228 15.4997 2.9634 Constraint (T0311)A30.CB (T0311)S63.CB 6.7423 11.2372 14.6083 2.9118 Constraint (T0311)A30.CB (T0311)A53.CB 7.1267 11.8779 15.4413 2.9118 Constraint (T0311)A30.CB (T0311)L48.CB 7.0719 11.7865 15.3225 2.9118 Constraint (T0311)F27.CB (T0311)T49.CB 6.8445 11.4075 14.8297 2.9118 Constraint (T0311)L24.CB (T0311)L48.CB 6.9661 11.6102 15.0932 2.9118 Constraint (T0311)L17.CB (T0311)L48.CB 6.8334 11.3889 14.8056 2.9118 Constraint (T0311)E15.CB (T0311)S63.CB 6.2162 10.3604 13.4685 2.9118 Constraint (T0311)Q14.CB (T0311)P35.CB 6.8915 11.4858 14.9316 2.9118 Constraint (T0311)A38.CB (T0311)E51.CB 6.7308 11.2180 14.5834 2.8709 Constraint (T0311)E26.CB (T0311)V58.CB 7.0976 11.8293 15.3780 2.8367 Constraint (T0311)P9.CB (T0311)L70.CB 5.2332 8.7219 11.3385 2.8367 Constraint (T0311)P9.CB (T0311)N69.CB 6.5076 10.8460 14.0998 2.8367 Constraint (T0311)R8.CB (T0311)L70.CB 5.0400 8.4000 10.9200 2.8367 Constraint (T0311)R8.CB (T0311)N69.CB 6.8401 11.4002 14.8203 2.8367 Constraint (T0311)R8.CB (T0311)L68.CB 6.4641 10.7734 14.0055 2.8367 Constraint (T0311)S62.CB (T0311)V83.CB 5.7609 9.6015 12.4819 2.8035 Constraint (T0311)S62.CB (T0311)A79.CB 4.6353 7.7255 10.0432 2.8035 Constraint (T0311)I60.CB (T0311)V83.CB 6.0585 10.0975 13.1268 2.8035 Constraint (T0311)I60.CB (T0311)A79.CB 4.6943 7.8238 10.1710 2.8035 Constraint (T0311)I60.CB (T0311)L76.CB 6.6515 11.0859 14.4117 2.8035 Constraint (T0311)L56.CB (T0311)L76.CB 5.1539 8.5898 11.1668 2.8035 Constraint (T0311)S36.CB (T0311)I54.CB 6.1170 10.1951 13.2536 2.8035 Constraint (T0311)P64.CB (T0311)L76.CB 2.9645 4.9408 6.4231 2.7872 Constraint (T0311)A30.CB (T0311)L76.CB 5.7789 9.6315 12.5209 2.7788 Constraint (T0311)E26.CB (T0311)L76.CB 6.9850 11.6417 15.1342 2.7788 Constraint (T0311)I60.CB (T0311)K81.CB 5.4318 9.0531 11.7690 2.7750 Constraint (T0311)I60.CB (T0311)N69.CB 6.0151 10.0252 13.0328 2.7352 Constraint (T0311)S39.CB (T0311)P50.CB 6.2729 10.4548 13.5912 2.7352 Constraint (T0311)T37.CB (T0311)P50.CB 5.8218 9.7030 12.6139 2.7352 Constraint (T0311)S36.CB (T0311)P50.CB 6.9770 11.6283 15.1168 2.7352 Constraint (T0311)E15.CB (T0311)A77.CB 5.7351 9.5585 12.4260 2.6629 Constraint (T0311)I12.CB (T0311)A77.CB 6.5916 10.9860 14.2818 2.6629 Constraint (T0311)V22.CB (T0311)L76.CB 5.5550 9.2583 12.0358 2.5968 Constraint (T0311)N21.CB (T0311)L76.CB 5.8210 9.7016 12.6121 2.5968 Constraint (T0311)D18.CB (T0311)L76.CB 6.5811 10.9685 14.2591 2.5968 Constraint (T0311)L17.CB (T0311)L76.CB 4.7779 7.9632 10.3522 2.5968 Constraint (T0311)S16.CB (T0311)L76.CB 5.2496 8.7493 11.3741 2.5968 Constraint (T0311)I13.CB (T0311)L76.CB 6.4945 10.8241 14.0713 2.5968 Constraint (T0311)E15.CB (T0311)L76.CB 6.5075 10.8459 14.0996 2.5919 Constraint (T0311)I12.CB (T0311)L76.CB 5.6465 9.4109 12.2341 2.5919 Constraint (T0311)L70.CB (T0311)V83.CB 5.0557 8.4262 10.9540 2.5874 Constraint (T0311)N69.CB (T0311)V83.CB 6.6836 11.1394 14.4812 2.5874 Constraint (T0311)P50.CB (T0311)S63.CB 6.8560 11.4267 14.8547 2.5709 Constraint (T0311)A46.CB (T0311)K55.CB 6.0139 10.0232 13.0302 2.5709 Constraint (T0311)F27.CB (T0311)I54.CB 6.5830 10.9716 14.2631 2.5709 Constraint (T0311)L24.CB (T0311)K55.CB 5.7447 9.5745 12.4468 2.5709 Constraint (T0311)L24.CB (T0311)A53.CB 6.8721 11.4535 14.8896 2.5709 Constraint (T0311)V22.CB (T0311)V58.CB 6.3576 10.5961 13.7749 2.5709 Constraint (T0311)V22.CB (T0311)S57.CB 6.6655 11.1091 14.4418 2.5709 Constraint (T0311)V22.CB (T0311)K55.CB 6.2891 10.4818 13.6263 2.5709 Constraint (T0311)D18.CB (T0311)V59.CB 6.2935 10.4891 13.6359 2.5709 Constraint (T0311)D18.CB (T0311)L56.CB 6.6325 11.0541 14.3703 2.5709 Constraint (T0311)L17.CB (T0311)V58.CB 6.7015 11.1692 14.5200 2.5709 Constraint (T0311)L17.CB (T0311)K55.CB 6.6989 11.1648 14.5142 2.5709 Constraint (T0311)M52.CB (T0311)L68.CB 6.3084 10.5139 13.6681 2.5479 Constraint (T0311)M31.CB (T0311)L68.CB 5.4585 9.0975 11.8268 2.5479 Constraint (T0311)S57.CB (T0311)A77.CB 5.5360 9.2267 11.9948 2.4539 Constraint (T0311)L68.CB (T0311)A79.CB 6.6990 11.1651 14.5146 2.4192 Constraint (T0311)M66.CB (T0311)A79.CB 5.7675 9.6125 12.4962 2.4179 Constraint (T0311)R25.CB (T0311)L88.CB 6.9018 11.5030 14.9540 2.3894 Constraint (T0311)S23.CB (T0311)R89.CB 7.1030 11.8383 15.3897 2.3894 Constraint (T0311)V22.CB (T0311)L88.CB 6.6157 11.0261 14.3340 2.3894 Constraint (T0311)V22.CB (T0311)V85.CB 5.4791 9.1318 11.8713 2.3894 Constraint (T0311)V83.CB (T0311)V92.CB 6.1802 10.3004 13.3905 2.3315 Constraint (T0311)T82.CB (T0311)V92.CB 6.8219 11.3699 14.7809 2.3315 Constraint (T0311)E80.CB (T0311)R90.CB 5.6531 9.4218 12.2484 2.3315 Constraint (T0311)A79.CB (T0311)V92.CB 4.8986 8.1644 10.6137 2.3315 Constraint (T0311)A79.CB (T0311)L91.CB 6.4947 10.8245 14.0719 2.3315 Constraint (T0311)A79.CB (T0311)R90.CB 4.7986 7.9977 10.3970 2.3315 Constraint (T0311)L76.CB (T0311)V92.CB 6.8252 11.3754 14.7880 2.3315 Constraint (T0311)S75.CB (T0311)V92.CB 6.7127 11.1879 14.5443 2.3315 Constraint (T0311)E32.CB (T0311)A53.CB 6.9893 11.6488 15.1435 2.3223 Constraint (T0311)V59.CB (T0311)N69.CB 6.4167 10.6945 13.9028 2.3144 Constraint (T0311)V59.CB (T0311)L68.CB 6.2710 10.4517 13.5872 2.3144 Constraint (T0311)L41.CB (T0311)Q65.CB 6.6296 11.0493 14.3641 2.2125 Constraint (T0311)I13.CB (T0311)E80.CB 5.5547 9.2578 12.0352 2.1920 Constraint (T0311)I60.CB (T0311)Q71.CB 6.1980 10.3299 13.4289 2.1623 Constraint (T0311)M66.CB (T0311)S75.CB 6.4420 10.7366 13.9576 2.0932 Constraint (T0311)S63.CB (T0311)N72.CB 5.4863 9.1438 11.8869 2.0932 Constraint (T0311)S62.CB (T0311)A73.CB 4.4648 7.4413 9.6736 2.0932 Constraint (T0311)S62.CB (T0311)N72.CB 5.5902 9.3169 12.1120 2.0932 Constraint (T0311)L56.CB (T0311)Q65.CB 6.6430 11.0717 14.3933 2.0932 Constraint (T0311)R40.CB (T0311)S63.CB 6.8715 11.4525 14.8882 2.0932 Constraint (T0311)R40.CB (T0311)I60.CB 6.6202 11.0337 14.3437 2.0932 Constraint (T0311)R40.CB (T0311)V59.CB 6.0861 10.1435 13.1865 2.0932 Constraint (T0311)S39.CB (T0311)Q65.CB 6.6427 11.0712 14.3925 2.0932 Constraint (T0311)S39.CB (T0311)P64.CB 5.5894 9.3156 12.1103 2.0932 Constraint (T0311)S39.CB (T0311)S63.CB 4.5722 7.6204 9.9065 2.0932 Constraint (T0311)S39.CB (T0311)S62.CB 6.8223 11.3705 14.7817 2.0932 Constraint (T0311)S39.CB (T0311)V59.CB 7.0409 11.7348 15.2553 2.0932 Constraint (T0311)A38.CB (T0311)P64.CB 5.8399 9.7331 12.6530 2.0932 Constraint (T0311)A38.CB (T0311)S63.CB 6.3996 10.6659 13.8657 2.0932 Constraint (T0311)T37.CB (T0311)V58.CB 6.0442 10.0736 13.0957 2.0932 Constraint (T0311)S36.CB (T0311)V58.CB 7.1837 11.9728 15.5646 2.0932 Constraint (T0311)S36.CB (T0311)S57.CB 6.2795 10.4658 13.6055 2.0932 Constraint (T0311)P35.CB (T0311)P64.CB 7.0478 11.7463 15.2701 2.0932 Constraint (T0311)P35.CB (T0311)S63.CB 6.9754 11.6257 15.1134 2.0932 Constraint (T0311)P35.CB (T0311)S57.CB 7.0188 11.6979 15.2073 2.0932 Constraint (T0311)F27.CB (T0311)P64.CB 5.4172 9.0287 11.7373 2.0932 Constraint (T0311)L24.CB (T0311)Q65.CB 6.2956 10.4926 13.6404 2.0932 Constraint (T0311)L24.CB (T0311)P64.CB 5.1910 8.6517 11.2472 2.0932 Constraint (T0311)L24.CB (T0311)S63.CB 6.2809 10.4682 13.6087 2.0932 Constraint (T0311)S23.CB (T0311)P64.CB 6.8829 11.4715 14.9130 2.0932 Constraint (T0311)V22.CB (T0311)Q71.CB 6.6244 11.0406 14.3528 2.0932 Constraint (T0311)V22.CB (T0311)Q65.CB 6.6227 11.0378 14.3492 2.0932 Constraint (T0311)V22.CB (T0311)P64.CB 4.8341 8.0569 10.4739 2.0932 Constraint (T0311)N21.CB (T0311)Q71.CB 5.4054 9.0090 11.7117 2.0932 Constraint (T0311)N21.CB (T0311)Q65.CB 5.3714 8.9524 11.6381 2.0932 Constraint (T0311)N21.CB (T0311)P64.CB 5.5005 9.1674 11.9176 2.0932 Constraint (T0311)E19.CB (T0311)S75.CB 7.0150 11.6917 15.1993 2.0932 Constraint (T0311)E19.CB (T0311)W74.CB 6.2072 10.3454 13.4490 2.0932 Constraint (T0311)E19.CB (T0311)Q71.CB 4.6786 7.7977 10.1370 2.0932 Constraint (T0311)E19.CB (T0311)P64.CB 6.9759 11.6265 15.1145 2.0932 Constraint (T0311)D18.CB (T0311)Q71.CB 6.9643 11.6072 15.0894 2.0932 Constraint (T0311)D18.CB (T0311)W67.CB 6.1505 10.2509 13.3261 2.0932 Constraint (T0311)D18.CB (T0311)P64.CB 6.4053 10.6755 13.8782 2.0932 Constraint (T0311)L17.CB (T0311)Q71.CB 6.2055 10.3425 13.4452 2.0932 Constraint (T0311)L17.CB (T0311)Q65.CB 6.6369 11.0614 14.3798 2.0932 Constraint (T0311)Q14.CB (T0311)P64.CB 5.1798 8.6330 11.2230 2.0932 Constraint (T0311)Q14.CB (T0311)S63.CB 7.0515 11.7524 15.2782 2.0932 Constraint (T0311)L42.CB (T0311)K55.CB 4.6643 7.7738 10.1059 2.0872 Constraint (T0311)T43.CB (T0311)S57.CB 4.4155 7.3591 9.5668 2.0189 Constraint (T0311)T43.CB (T0311)K55.CB 6.5202 10.8670 14.1270 2.0189 Constraint (T0311)T43.CB (T0311)I54.CB 3.8548 6.4247 8.3521 2.0189 Constraint (T0311)L56.CB (T0311)S75.CB 6.1942 10.3236 13.4207 2.0163 Constraint (T0311)K55.CB (T0311)S75.CB 6.6825 11.1374 14.4787 2.0163 Constraint (T0311)A53.CB (T0311)A73.CB 6.6566 11.0944 14.4227 2.0163 Constraint (T0311)A47.CB (T0311)S75.CB 6.2483 10.4139 13.5380 2.0163 Constraint (T0311)M52.CB (T0311)W74.CB 5.1750 8.6250 11.2125 2.0009 Constraint (T0311)M52.CB (T0311)A73.CB 3.3235 5.5392 7.2009 2.0009 Constraint (T0311)E51.CB (T0311)A73.CB 4.2503 7.0839 9.2090 2.0009 Constraint (T0311)P50.CB (T0311)A73.CB 5.0398 8.3997 10.9197 2.0009 Constraint (T0311)T49.CB (T0311)A73.CB 4.0712 6.7854 8.8210 2.0009 Constraint (T0311)A47.CB (T0311)A73.CB 5.9716 9.9526 12.9384 2.0009 Constraint (T0311)L20.CB (T0311)K55.CB 7.0852 11.8087 15.3513 2.0002 Constraint (T0311)P9.CB (T0311)S62.CB 6.6765 11.1275 14.4657 1.9999 Constraint (T0311)P64.CB (T0311)L88.CB 5.2159 8.6931 11.3011 1.9981 Constraint (T0311)P64.CB (T0311)R87.CB 4.8793 8.1322 10.5719 1.9981 Constraint (T0311)P64.CB (T0311)V85.CB 6.2942 10.4904 13.6375 1.9981 Constraint (T0311)W74.CB (T0311)V83.CB 6.2165 10.3609 13.4691 1.9980 Constraint (T0311)V83.CB (T0311)T93.CB 5.4748 9.1246 11.8620 1.9962 Constraint (T0311)K45.CB (T0311)E80.CB 6.6479 11.0798 14.4038 1.9962 Constraint (T0311)K45.CB (T0311)A79.CB 6.6476 11.0793 14.4031 1.9962 Constraint (T0311)K45.CB (T0311)E78.CB 5.8063 9.6772 12.5804 1.9962 Constraint (T0311)K45.CB (T0311)A77.CB 3.9502 6.5837 8.5588 1.9962 Constraint (T0311)K45.CB (T0311)L76.CB 3.6863 6.1438 7.9869 1.9962 Constraint (T0311)K45.CB (T0311)S75.CB 4.5003 7.5005 9.7507 1.9962 Constraint (T0311)T43.CB (T0311)S75.CB 5.5115 9.1859 11.9417 1.9962 Constraint (T0311)L42.CB (T0311)S75.CB 6.8549 11.4248 14.8523 1.9962 Constraint (T0311)R40.CB (T0311)S75.CB 6.6622 11.1036 14.4347 1.9962 Constraint (T0311)Q14.CB (T0311)A77.CB 4.1585 6.9309 9.0102 1.9962 Constraint (T0311)Q14.CB (T0311)S75.CB 6.5757 10.9595 14.2473 1.9962 Constraint (T0311)L70.CB (T0311)E80.CB 4.8123 8.0204 10.4265 1.9941 Constraint (T0311)N69.CB (T0311)T82.CB 6.0009 10.0015 13.0020 1.9941 Constraint (T0311)T43.CB (T0311)Q94.CB 7.1533 11.9221 15.4987 1.9846 Constraint (T0311)T43.CB (T0311)T93.CB 5.6300 9.3834 12.1984 1.9846 Constraint (T0311)T43.CB (T0311)R89.CB 4.4580 7.4301 9.6591 1.9846 Constraint (T0311)L42.CB (T0311)R89.CB 5.7275 9.5459 12.4096 1.9846 Constraint (T0311)S39.CB (T0311)T93.CB 6.8167 11.3611 14.7695 1.9846 Constraint (T0311)S39.CB (T0311)R89.CB 5.6675 9.4458 12.2795 1.9846 Constraint (T0311)A34.CB (T0311)A79.CB 7.1575 11.9291 15.5079 1.9846 Constraint (T0311)L24.CB (T0311)V92.CB 6.4701 10.7835 14.0185 1.9846 Constraint (T0311)L24.CB (T0311)R89.CB 6.0149 10.0249 13.0324 1.9846 Constraint (T0311)I54.CB (T0311)S75.CB 4.0881 6.8135 8.8576 1.9846 Constraint (T0311)A53.CB (T0311)S75.CB 3.6191 6.0318 7.8413 1.9846 Constraint (T0311)P50.CB (T0311)W74.CB 4.9444 8.2407 10.7129 1.9846 Constraint (T0311)L48.CB (T0311)W74.CB 5.7884 9.6473 12.5414 1.9846 Constraint (T0311)L48.CB (T0311)A73.CB 5.0845 8.4741 11.0163 1.9846 Constraint (T0311)L41.CB (T0311)W74.CB 6.1397 10.2328 13.3027 1.9827 Constraint (T0311)T43.CB (T0311)D84.CB 6.2096 10.3492 13.4540 1.9801 Constraint (T0311)L42.CB (T0311)D84.CB 6.7744 11.2907 14.6779 1.9801 Constraint (T0311)T43.CB (T0311)R87.CB 5.9070 9.8450 12.7984 1.9769 Constraint (T0311)L42.CB (T0311)R87.CB 5.4279 9.0465 11.7604 1.9769 Constraint (T0311)S39.CB (T0311)R87.CB 5.8633 9.7722 12.7038 1.9769 Constraint (T0311)L24.CB (T0311)R87.CB 4.9416 8.2360 10.7068 1.9769 Constraint (T0311)S23.CB (T0311)R87.CB 5.6819 9.4699 12.3108 1.9769 Constraint (T0311)A38.CB (T0311)A77.CB 5.9190 9.8650 12.8245 1.9692 Constraint (T0311)A38.CB (T0311)S75.CB 5.9453 9.9088 12.8814 1.9692 Constraint (T0311)T37.CB (T0311)A77.CB 7.1750 11.9584 15.5459 1.9692 Constraint (T0311)T37.CB (T0311)L76.CB 4.1300 6.8833 8.9483 1.9692 Constraint (T0311)T37.CB (T0311)S75.CB 5.7765 9.6275 12.5157 1.9692 Constraint (T0311)S36.CB (T0311)L76.CB 6.7565 11.2608 14.6390 1.9692 Constraint (T0311)P35.CB (T0311)L76.CB 6.2628 10.4380 13.5694 1.9692 Constraint (T0311)A34.CB (T0311)L76.CB 6.1564 10.2607 13.3390 1.9692 Constraint (T0311)I33.CB (T0311)A77.CB 6.7483 11.2472 14.6213 1.9692 Constraint (T0311)I33.CB (T0311)L76.CB 3.6671 6.1118 7.9453 1.9692 Constraint (T0311)I33.CB (T0311)S75.CB 4.2500 7.0833 9.2083 1.9692 Constraint (T0311)E32.CB (T0311)L76.CB 5.5616 9.2694 12.0502 1.9692 Constraint (T0311)E32.CB (T0311)S75.CB 3.9932 6.6553 8.6519 1.9692 Constraint (T0311)M31.CB (T0311)A77.CB 5.2313 8.7189 11.3346 1.9692 Constraint (T0311)M31.CB (T0311)L76.CB 2.8541 4.7569 6.1840 1.9692 Constraint (T0311)M31.CB (T0311)S75.CB 2.7814 4.6356 6.0263 1.9692 Constraint (T0311)A30.CB (T0311)A77.CB 6.6532 11.0887 14.4154 1.9692 Constraint (T0311)A30.CB (T0311)S75.CB 5.0798 8.4663 11.0062 1.9692 Constraint (T0311)R29.CB (T0311)L76.CB 6.8384 11.3974 14.8166 1.9692 Constraint (T0311)R29.CB (T0311)S75.CB 6.9414 11.5690 15.0397 1.9692 Constraint (T0311)A28.CB (T0311)L76.CB 4.9776 8.2960 10.7848 1.9692 Constraint (T0311)A28.CB (T0311)S75.CB 6.2885 10.4809 13.6251 1.9692 Constraint (T0311)F27.CB (T0311)A77.CB 5.7224 9.5373 12.3985 1.9692 Constraint (T0311)F27.CB (T0311)S75.CB 5.8664 9.7774 12.7106 1.9692 Constraint (T0311)D18.CB (T0311)R29.CB 7.0268 11.7113 15.2247 1.9412 Constraint (T0311)F27.CB (T0311)W67.CB 6.2862 10.4771 13.6202 1.8981 Constraint (T0311)I13.CB (T0311)Q65.CB 7.1009 11.8348 15.3852 1.8981 Constraint (T0311)E19.CB (T0311)D84.CB 6.5236 10.8727 14.1344 1.8582 Constraint (T0311)E19.CB (T0311)E80.CB 4.9618 8.2697 10.7506 1.8582 Constraint (T0311)Q14.CB (T0311)W74.CB 6.2441 10.4068 13.5288 1.8077 Constraint (T0311)E26.CB (T0311)K81.CB 6.6975 11.1624 14.5112 1.7974 Constraint (T0311)M31.CB (T0311)A73.CB 5.6260 9.3766 12.1896 1.7942 Constraint (T0311)S63.CB (T0311)E78.CB 3.9494 6.5824 8.5571 1.7872 Constraint (T0311)S62.CB (T0311)T82.CB 4.3558 7.2596 9.4375 1.7872 Constraint (T0311)S62.CB (T0311)K81.CB 5.6393 9.3989 12.2186 1.7872 Constraint (T0311)S62.CB (T0311)E78.CB 2.5382 4.2303 5.4994 1.7872 Constraint (T0311)S62.CB (T0311)A77.CB 5.4162 9.0270 11.7351 1.7872 Constraint (T0311)I60.CB (T0311)S86.CB 6.6263 11.0439 14.3571 1.7872 Constraint (T0311)I60.CB (T0311)E78.CB 4.7058 7.8430 10.1959 1.7872 Constraint (T0311)L42.CB (T0311)E78.CB 6.9232 11.5386 15.0002 1.7872 Constraint (T0311)L42.CB (T0311)S63.CB 7.0896 11.8160 15.3609 1.7872 Constraint (T0311)L42.CB (T0311)V58.CB 5.7636 9.6060 12.4878 1.7872 Constraint (T0311)L24.CB (T0311)I54.CB 6.1385 10.2308 13.3001 1.7872 Constraint (T0311)S23.CB (T0311)L76.CB 5.7910 9.6517 12.5473 1.7872 Constraint (T0311)N21.CB (T0311)D84.CB 6.7748 11.2913 14.6786 1.7872 Constraint (T0311)N21.CB (T0311)V83.CB 6.7077 11.1795 14.5333 1.7872 Constraint (T0311)N21.CB (T0311)A77.CB 5.8790 9.7984 12.7379 1.7872 Constraint (T0311)D18.CB (T0311)R87.CB 5.3338 8.8896 11.5565 1.7872 Constraint (T0311)D18.CB (T0311)D84.CB 4.3477 7.2462 9.4200 1.7872 Constraint (T0311)D18.CB (T0311)V83.CB 3.4627 5.7712 7.5026 1.7872 Constraint (T0311)D18.CB (T0311)E80.CB 3.6748 6.1246 7.9620 1.7872 Constraint (T0311)L17.CB (T0311)R87.CB 6.3111 10.5186 13.6741 1.7872 Constraint (T0311)L17.CB (T0311)S86.CB 6.4377 10.7295 13.9484 1.7872 Constraint (T0311)L17.CB (T0311)D84.CB 5.0149 8.3581 10.8656 1.7872 Constraint (T0311)L17.CB (T0311)V83.CB 3.2546 5.4244 7.0517 1.7872 Constraint (T0311)L17.CB (T0311)T82.CB 5.4650 9.1084 11.8409 1.7872 Constraint (T0311)L17.CB (T0311)K81.CB 5.5492 9.2487 12.0234 1.7872 Constraint (T0311)L17.CB (T0311)E78.CB 6.2388 10.3980 13.5174 1.7872 Constraint (T0311)L17.CB (T0311)A77.CB 5.6036 9.3393 12.1410 1.7872 Constraint (T0311)S16.CB (T0311)V83.CB 4.8363 8.0605 10.4787 1.7872 Constraint (T0311)E15.CB (T0311)V83.CB 4.2675 7.1126 9.2463 1.7872 Constraint (T0311)E15.CB (T0311)A79.CB 6.3430 10.5717 13.7432 1.7872 Constraint (T0311)Q14.CB (T0311)R87.CB 5.3357 8.8928 11.5606 1.7872 Constraint (T0311)Q14.CB (T0311)S86.CB 4.8765 8.1274 10.5657 1.7872 Constraint (T0311)Q14.CB (T0311)D84.CB 5.7621 9.6035 12.4846 1.7872 Constraint (T0311)Q14.CB (T0311)V83.CB 2.9086 4.8477 6.3020 1.7872 Constraint (T0311)Q14.CB (T0311)T82.CB 5.2337 8.7228 11.3396 1.7872 Constraint (T0311)I13.CB (T0311)V83.CB 4.4807 7.4678 9.7081 1.7872 Constraint (T0311)I13.CB (T0311)T82.CB 6.2641 10.4401 13.5721 1.7872 Constraint (T0311)I12.CB (T0311)V83.CB 6.0078 10.0130 13.0169 1.7872 Constraint (T0311)T43.CB (T0311)V58.CB 6.0246 10.0410 13.0534 1.7189 Constraint (T0311)I13.CB (T0311)P35.CB 6.9510 11.5850 15.0605 1.7189 Constraint (T0311)V59.CB (T0311)E78.CB 5.7558 9.5930 12.4709 1.6831 Constraint (T0311)V59.CB (T0311)A77.CB 4.9297 8.2162 10.6810 1.6831 Constraint (T0311)L56.CB (T0311)A77.CB 5.6880 9.4800 12.3240 1.6831 Constraint (T0311)K55.CB (T0311)A77.CB 5.2375 8.7291 11.3478 1.6831 Constraint (T0311)I54.CB (T0311)A77.CB 4.6178 7.6964 10.0053 1.6513 Constraint (T0311)V58.CB (T0311)Q71.CB 4.4569 7.4282 9.6567 1.6335 Constraint (T0311)V58.CB (T0311)N69.CB 4.3059 7.1765 9.3294 1.6335 Constraint (T0311)V58.CB (T0311)L68.CB 3.3155 5.5258 7.1835 1.6335 Constraint (T0311)S57.CB (T0311)A73.CB 6.3116 10.5194 13.6752 1.6335 Constraint (T0311)L56.CB (T0311)N72.CB 6.3855 10.6425 13.8353 1.6335 Constraint (T0311)K55.CB (T0311)N69.CB 6.1055 10.1759 13.2286 1.6335 Constraint (T0311)K55.CB (T0311)L68.CB 4.4826 7.4709 9.7122 1.6335 Constraint (T0311)D18.CB (T0311)V85.CB 6.2309 10.3848 13.5002 1.5963 Constraint (T0311)M66.CB (T0311)T82.CB 5.5970 9.3283 12.1267 1.5893 Constraint (T0311)W67.CB (T0311)D84.CB 5.9886 9.9810 12.9753 1.5730 Constraint (T0311)W67.CB (T0311)K81.CB 5.3841 8.9734 11.6654 1.5730 Constraint (T0311)M66.CB (T0311)K81.CB 5.7292 9.5487 12.4132 1.5730 Constraint (T0311)T49.CB (T0311)R87.CB 6.5222 10.8704 14.1315 1.5730 Constraint (T0311)L48.CB (T0311)R87.CB 6.5332 10.8887 14.1554 1.5730 Constraint (T0311)L70.CB (T0311)R87.CB 4.2716 7.1193 9.2551 1.5710 Constraint (T0311)L70.CB (T0311)S86.CB 6.3552 10.5920 13.7696 1.5710 Constraint (T0311)L68.CB (T0311)V83.CB 5.8533 9.7555 12.6822 1.5710 Constraint (T0311)L68.CB (T0311)T82.CB 6.6354 11.0591 14.3768 1.5710 Constraint (T0311)L20.CB (T0311)E80.CB 4.4915 7.4859 9.7317 1.4763 Constraint (T0311)L20.CB (T0311)A79.CB 5.4318 9.0529 11.7688 1.4763 Constraint (T0311)L20.CB (T0311)A77.CB 5.8181 9.6968 12.6058 1.4763 Constraint (T0311)V59.CB (T0311)W74.CB 6.8337 11.3895 14.8063 1.4459 Constraint (T0311)N69.CB (T0311)A79.CB 5.4713 9.1189 11.8546 1.4211 Constraint (T0311)Q71.CB (T0311)T82.CB 4.4379 7.3966 9.6155 1.4029 Constraint (T0311)Q71.CB (T0311)K81.CB 5.8304 9.7173 12.6325 1.4029 Constraint (T0311)Q71.CB (T0311)E80.CB 5.2691 8.7819 11.4164 1.4029 Constraint (T0311)L70.CB (T0311)L88.CB 6.2103 10.3505 13.4557 1.4029 Constraint (T0311)W67.CB (T0311)E78.CB 6.1564 10.2606 13.3388 1.4016 Constraint (T0311)A30.CB (T0311)V85.CB 5.9672 9.9454 12.9290 1.3894 Constraint (T0311)F27.CB (T0311)R87.CB 5.9626 9.9377 12.9190 1.3894 Constraint (T0311)F27.CB (T0311)V85.CB 3.9015 6.5024 8.4532 1.3894 Constraint (T0311)E26.CB (T0311)S86.CB 6.9707 11.6179 15.1033 1.3894 Constraint (T0311)E26.CB (T0311)V85.CB 5.1274 8.5456 11.1093 1.3894 Constraint (T0311)V58.CB (T0311)W74.CB 6.3767 10.6278 13.8162 1.3335 Constraint (T0311)V58.CB (T0311)A73.CB 6.4781 10.7969 14.0359 1.3335 Constraint (T0311)V58.CB (T0311)N72.CB 5.8404 9.7340 12.6542 1.3335 Constraint (T0311)S57.CB (T0311)N72.CB 6.3797 10.6329 13.8227 1.3335 Constraint (T0311)K55.CB (T0311)Q71.CB 6.4236 10.7059 13.9177 1.3335 Constraint (T0311)I54.CB (T0311)N69.CB 6.5472 10.9120 14.1856 1.3335 Constraint (T0311)A30.CB (T0311)L68.CB 5.9995 9.9992 12.9989 1.3335 Constraint (T0311)F27.CB (T0311)L68.CB 6.4918 10.8196 14.0655 1.3335 Constraint (T0311)V22.CB (T0311)L68.CB 6.0250 10.0416 13.0541 1.3335 Constraint (T0311)N21.CB (T0311)N72.CB 7.1466 11.9110 15.4843 1.3335 Constraint (T0311)L20.CB (T0311)N72.CB 4.7203 7.8672 10.2273 1.3335 Constraint (T0311)L20.CB (T0311)N69.CB 5.5530 9.2550 12.0314 1.3335 Constraint (T0311)L20.CB (T0311)L68.CB 4.1327 6.8878 8.9541 1.3335 Constraint (T0311)E19.CB (T0311)A73.CB 6.7618 11.2697 14.6506 1.3335 Constraint (T0311)E19.CB (T0311)N72.CB 4.6388 7.7313 10.0507 1.3335 Constraint (T0311)E19.CB (T0311)N69.CB 4.9032 8.1721 10.6237 1.3335 Constraint (T0311)E19.CB (T0311)L68.CB 5.4265 9.0441 11.7574 1.3335 Constraint (T0311)L17.CB (T0311)L68.CB 6.4435 10.7391 13.9608 1.3335 Constraint (T0311)S16.CB (T0311)N72.CB 5.8340 9.7234 12.6404 1.3335 Constraint (T0311)E15.CB (T0311)N69.CB 6.2163 10.3605 13.4687 1.3335 Constraint (T0311)V59.CB (T0311)Q71.CB 6.1700 10.2834 13.3684 1.3163 Constraint (T0311)L56.CB (T0311)A73.CB 6.2905 10.4842 13.6294 1.3163 Constraint (T0311)S39.CB (T0311)E51.CB 6.4364 10.7273 13.9454 1.3163 Constraint (T0311)V59.CB (T0311)N72.CB 5.8312 9.7187 12.6343 1.2981 Constraint (T0311)L42.CB (T0311)E51.CB 5.7797 9.6328 12.5226 1.2981 Constraint (T0311)Q14.CB (T0311)M52.CB 6.3431 10.5718 13.7433 1.2981 Constraint (T0311)S16.CB (T0311)A77.CB 4.8470 8.0783 10.5018 1.2625 Constraint (T0311)M52.CB (T0311)M66.CB 5.0077 8.3461 10.8500 1.2144 Constraint (T0311)M52.CB (T0311)Q65.CB 4.2426 7.0711 9.1924 1.2144 Constraint (T0311)E51.CB (T0311)L68.CB 6.5559 10.9265 14.2044 1.2144 Constraint (T0311)E51.CB (T0311)M66.CB 5.4465 9.0775 11.8007 1.2144 Constraint (T0311)E51.CB (T0311)Q65.CB 3.2041 5.3402 6.9423 1.2144 Constraint (T0311)P50.CB (T0311)M66.CB 6.7060 11.1767 14.5298 1.2144 Constraint (T0311)T49.CB (T0311)M66.CB 7.1002 11.8337 15.3838 1.2144 Constraint (T0311)T49.CB (T0311)Q65.CB 5.2878 8.8130 11.4569 1.2144 Constraint (T0311)L48.CB (T0311)Q65.CB 5.1720 8.6200 11.2060 1.2144 Constraint (T0311)A46.CB (T0311)M66.CB 6.7071 11.1784 14.5320 1.2144 Constraint (T0311)K45.CB (T0311)W67.CB 4.4565 7.4274 9.6557 1.2144 Constraint (T0311)K45.CB (T0311)M66.CB 5.8731 9.7886 12.7251 1.2144 Constraint (T0311)L41.CB (T0311)M66.CB 3.7264 6.2107 8.0739 1.2144 Constraint (T0311)R40.CB (T0311)M66.CB 6.5469 10.9115 14.1850 1.2144 Constraint (T0311)A38.CB (T0311)N69.CB 6.7943 11.3239 14.7211 1.2144 Constraint (T0311)A38.CB (T0311)M66.CB 4.7447 7.9079 10.2803 1.2144 Constraint (T0311)T37.CB (T0311)M66.CB 5.2763 8.7938 11.4320 1.2144 Constraint (T0311)A34.CB (T0311)M66.CB 7.0307 11.7178 15.2332 1.2144 Constraint (T0311)I33.CB (T0311)L70.CB 6.4712 10.7854 14.0210 1.2144 Constraint (T0311)I33.CB (T0311)N69.CB 6.0119 10.0198 13.0258 1.2144 Constraint (T0311)I33.CB (T0311)W67.CB 6.8471 11.4119 14.8355 1.2144 Constraint (T0311)I33.CB (T0311)M66.CB 3.8776 6.4627 8.4015 1.2144 Constraint (T0311)I33.CB (T0311)Q65.CB 6.0457 10.0761 13.0989 1.2144 Constraint (T0311)E32.CB (T0311)N69.CB 5.3907 8.9845 11.6798 1.2144 Constraint (T0311)E32.CB (T0311)M66.CB 4.8094 8.0157 10.4204 1.2144 Constraint (T0311)E32.CB (T0311)Q65.CB 5.3397 8.8995 11.5693 1.2144 Constraint (T0311)E32.CB (T0311)L41.CB 7.0241 11.7069 15.2190 1.2144 Constraint (T0311)M31.CB (T0311)N69.CB 3.6570 6.0951 7.9236 1.2144 Constraint (T0311)M31.CB (T0311)M66.CB 2.6409 4.4015 5.7220 1.2144 Constraint (T0311)M31.CB (T0311)Q65.CB 4.9438 8.2397 10.7116 1.2144 Constraint (T0311)A30.CB (T0311)N69.CB 6.1008 10.1680 13.2184 1.2144 Constraint (T0311)R29.CB (T0311)M66.CB 7.0179 11.6965 15.2054 1.2144 Constraint (T0311)A28.CB (T0311)L70.CB 6.0553 10.0922 13.1198 1.2144 Constraint (T0311)A28.CB (T0311)N69.CB 6.2102 10.3504 13.4555 1.2144 Constraint (T0311)A28.CB (T0311)M66.CB 4.9386 8.2310 10.7004 1.2144 Constraint (T0311)F27.CB (T0311)N69.CB 5.9309 9.8848 12.8502 1.2144 Constraint (T0311)F27.CB (T0311)M66.CB 6.1217 10.2028 13.2637 1.2144 Constraint (T0311)R25.CB (T0311)L41.CB 7.1102 11.8503 15.4054 1.2144 Constraint (T0311)L24.CB (T0311)L70.CB 7.0391 11.7318 15.2513 1.2144 Constraint (T0311)E19.CB (T0311)R87.CB 6.9251 11.5419 15.0044 1.1914 Constraint (T0311)E19.CB (T0311)V83.CB 5.5783 9.2972 12.0864 1.1914 Constraint (T0311)D18.CB (T0311)L88.CB 6.9051 11.5085 14.9610 1.1914 Constraint (T0311)D18.CB (T0311)S86.CB 5.4235 9.0392 11.7509 1.1914 Constraint (T0311)D18.CB (T0311)T82.CB 5.3195 8.8659 11.5257 1.1914 Constraint (T0311)D18.CB (T0311)K81.CB 5.0427 8.4045 10.9258 1.1914 Constraint (T0311)D18.CB (T0311)A79.CB 4.8458 8.0763 10.4993 1.1914 Constraint (T0311)D18.CB (T0311)E78.CB 6.8824 11.4707 14.9119 1.1914 Constraint (T0311)E15.CB (T0311)R87.CB 4.8167 8.0278 10.4362 1.1914 Constraint (T0311)E15.CB (T0311)S86.CB 5.6142 9.3570 12.1642 1.1914 Constraint (T0311)E15.CB (T0311)D84.CB 5.9057 9.8429 12.7957 1.1914 Constraint (T0311)E15.CB (T0311)T82.CB 6.8328 11.3880 14.8044 1.1914 Constraint (T0311)Q14.CB (T0311)V85.CB 6.5096 10.8493 14.1041 1.1914 Constraint (T0311)Q14.CB (T0311)K81.CB 6.3377 10.5628 13.7317 1.1914 Constraint (T0311)D11.CB (T0311)R87.CB 6.5045 10.8409 14.0931 1.1914 Constraint (T0311)D11.CB (T0311)S86.CB 5.4884 9.1473 11.8915 1.1914 Constraint (T0311)D11.CB (T0311)V83.CB 5.2670 8.7783 11.4118 1.1914 Constraint (T0311)D11.CB (T0311)T82.CB 6.9732 11.6219 15.1085 1.1914 Constraint (T0311)D11.CB (T0311)A79.CB 6.9217 11.5362 14.9971 1.1914 Constraint (T0311)D11.CB (T0311)L56.CB 5.8204 9.7006 12.6108 1.1914 Constraint (T0311)A47.CB (T0311)S86.CB 5.2493 8.7489 11.3735 1.1459 Constraint (T0311)A47.CB (T0311)V85.CB 6.9588 11.5981 15.0775 1.1459 Constraint (T0311)S63.CB (T0311)T82.CB 5.6932 9.4886 12.3352 1.0163 Constraint (T0311)V59.CB (T0311)L76.CB 4.3822 7.3036 9.4947 1.0163 Constraint (T0311)V59.CB (T0311)S75.CB 7.0020 11.6700 15.1710 1.0163 Constraint (T0311)V58.CB (T0311)L76.CB 5.9263 9.8771 12.8403 1.0163 Constraint (T0311)K55.CB (T0311)L76.CB 3.0092 5.0153 6.5198 1.0163 Constraint (T0311)K55.CB (T0311)W74.CB 6.7034 11.1723 14.5240 1.0163 Constraint (T0311)K55.CB (T0311)A73.CB 4.4205 7.3675 9.5777 1.0163 Constraint (T0311)I54.CB (T0311)A73.CB 6.4876 10.8127 14.0565 1.0163 Constraint (T0311)M52.CB (T0311)E80.CB 6.6609 11.1015 14.4319 1.0163 Constraint (T0311)A47.CB (T0311)L76.CB 5.5523 9.2539 12.0301 1.0163 Constraint (T0311)A47.CB (T0311)S57.CB 6.5238 10.8730 14.1349 1.0163 Constraint (T0311)S36.CB (T0311)E51.CB 5.8983 9.8306 12.7797 1.0163 Constraint (T0311)I13.CB (T0311)P50.CB 5.5396 9.2326 12.0024 1.0163 Constraint (T0311)I12.CB (T0311)P50.CB 5.7739 9.6231 12.5101 1.0163 Constraint (T0311)P9.CB (T0311)E51.CB 6.4197 10.6995 13.9093 1.0163 Constraint (T0311)P9.CB (T0311)T37.CB 6.3013 10.5022 13.6529 1.0163 Constraint (T0311)R8.CB (T0311)P50.CB 6.2114 10.3523 13.4580 1.0163 Constraint (T0311)P7.CB (T0311)L41.CB 6.1431 10.2385 13.3100 1.0163 Constraint (T0311)P7.CB (T0311)I33.CB 6.8905 11.4842 14.9295 1.0163 Constraint (T0311)P7.CB (T0311)M31.CB 6.0230 10.0384 13.0499 1.0163 Constraint (T0311)L17.CB (T0311)L88.CB 6.2481 10.4136 13.5376 1.0005 Constraint (T0311)L17.CB (T0311)V85.CB 5.6788 9.4646 12.3040 1.0005 Constraint (T0311)S16.CB (T0311)T82.CB 6.0999 10.1664 13.2164 1.0005 Constraint (T0311)S16.CB (T0311)K81.CB 6.3273 10.5456 13.7093 1.0005 Constraint (T0311)I13.CB (T0311)V85.CB 6.4628 10.7714 14.0028 1.0005 Constraint (T0311)I13.CB (T0311)K81.CB 6.6117 11.0195 14.3254 1.0005 Constraint (T0311)I13.CB (T0311)E78.CB 6.7152 11.1921 14.5497 1.0005 Constraint (T0311)I12.CB (T0311)A79.CB 5.5800 9.3000 12.0900 1.0005 Constraint (T0311)M66.CB (T0311)D84.CB 5.1326 8.5543 11.1206 1.0000 Constraint (T0311)Q65.CB (T0311)L88.CB 5.5479 9.2465 12.0204 1.0000 Constraint (T0311)Q65.CB (T0311)R87.CB 5.4966 9.1610 11.9093 1.0000 Constraint (T0311)Q65.CB (T0311)S86.CB 6.7363 11.2271 14.5952 1.0000 Constraint (T0311)Q65.CB (T0311)V85.CB 4.9806 8.3010 10.7913 1.0000 Constraint (T0311)P64.CB (T0311)S86.CB 5.6799 9.4664 12.3064 1.0000 Constraint (T0311)P64.CB (T0311)S75.CB 3.4513 5.7521 7.4777 1.0000 Constraint (T0311)P64.CB (T0311)W74.CB 5.7755 9.6259 12.5136 1.0000 Constraint (T0311)S63.CB (T0311)L88.CB 6.9542 11.5904 15.0675 1.0000 Constraint (T0311)S63.CB (T0311)R87.CB 6.3556 10.5927 13.7705 1.0000 Constraint (T0311)S63.CB (T0311)K81.CB 6.0571 10.0951 13.1237 1.0000 Constraint (T0311)S63.CB (T0311)S75.CB 6.6093 11.0155 14.3201 1.0000 Constraint (T0311)S62.CB (T0311)D84.CB 6.4374 10.7291 13.9478 1.0000 Constraint (T0311)S57.CB (T0311)R87.CB 5.8476 9.7461 12.6699 1.0000 Constraint (T0311)S57.CB (T0311)D84.CB 5.2413 8.7355 11.3562 1.0000 Constraint (T0311)S57.CB (T0311)S75.CB 5.6249 9.3749 12.1873 1.0000 Constraint (T0311)I54.CB (T0311)L91.CB 6.7536 11.2559 14.6327 1.0000 Constraint (T0311)I54.CB (T0311)R90.CB 6.5152 10.8587 14.1163 1.0000 Constraint (T0311)I54.CB (T0311)L88.CB 6.8625 11.4376 14.8688 1.0000 Constraint (T0311)A53.CB (T0311)R87.CB 4.7386 7.8977 10.2670 1.0000 Constraint (T0311)A53.CB (T0311)S86.CB 5.4098 9.0163 11.7212 1.0000 Constraint (T0311)A53.CB (T0311)V85.CB 6.7677 11.2795 14.6634 1.0000 Constraint (T0311)A53.CB (T0311)D84.CB 4.7919 7.9866 10.3825 1.0000 Constraint (T0311)A53.CB (T0311)W74.CB 5.7816 9.6361 12.5269 1.0000 Constraint (T0311)M52.CB (T0311)R87.CB 7.0889 11.8148 15.3593 1.0000 Constraint (T0311)E51.CB (T0311)R90.CB 6.5540 10.9234 14.2004 1.0000 Constraint (T0311)E51.CB (T0311)R87.CB 5.7107 9.5178 12.3731 1.0000 Constraint (T0311)P50.CB (T0311)L91.CB 6.3844 10.6406 13.8328 1.0000 Constraint (T0311)P50.CB (T0311)R90.CB 4.4345 7.3909 9.6081 1.0000 Constraint (T0311)P50.CB (T0311)R89.CB 5.8941 9.8234 12.7705 1.0000 Constraint (T0311)P50.CB (T0311)L88.CB 6.0966 10.1610 13.2093 1.0000 Constraint (T0311)L48.CB (T0311)S86.CB 6.3156 10.5259 13.6837 1.0000 Constraint (T0311)L48.CB (T0311)D84.CB 6.5959 10.9932 14.2912 1.0000 Constraint (T0311)A47.CB (T0311)V83.CB 5.9185 9.8641 12.8234 1.0000 Constraint (T0311)A47.CB (T0311)T82.CB 6.7122 11.1870 14.5432 1.0000 Constraint (T0311)A47.CB (T0311)W74.CB 6.6739 11.1232 14.4602 1.0000 Constraint (T0311)L41.CB (T0311)V83.CB 7.1257 11.8761 15.4389 1.0000 Constraint (T0311)R87.CB (T0311)T96.CB 5.1030 8.5051 11.0566 0.9981 Constraint (T0311)S86.CB (T0311)T96.CB 6.1559 10.2598 13.3377 0.9981 Constraint (T0311)V85.CB (T0311)P97.CB 4.7985 7.9974 10.3967 0.9981 Constraint (T0311)V85.CB (T0311)T96.CB 4.2996 7.1659 9.3157 0.9981 Constraint (T0311)V85.CB (T0311)Q94.CB 6.8538 11.4230 14.8499 0.9981 Constraint (T0311)V83.CB (T0311)P97.CB 5.7616 9.6027 12.4835 0.9981 Constraint (T0311)V83.CB (T0311)T96.CB 4.4874 7.4790 9.7227 0.9981 Constraint (T0311)V83.CB (T0311)Q94.CB 6.6010 11.0017 14.3022 0.9981 Constraint (T0311)T82.CB (T0311)S95.CB 6.3376 10.5627 13.7315 0.9981 Constraint (T0311)T82.CB (T0311)Q94.CB 6.9638 11.6063 15.0882 0.9981 Constraint (T0311)T82.CB (T0311)T93.CB 4.6118 7.6863 9.9922 0.9981 Constraint (T0311)K81.CB (T0311)T93.CB 6.7987 11.3311 14.7305 0.9981 Constraint (T0311)K81.CB (T0311)R90.CB 6.8177 11.3629 14.7718 0.9981 Constraint (T0311)E80.CB (T0311)P97.CB 6.0446 10.0744 13.0967 0.9981 Constraint (T0311)E80.CB (T0311)T96.CB 6.6447 11.0744 14.3968 0.9981 Constraint (T0311)E80.CB (T0311)T93.CB 5.9069 9.8448 12.7983 0.9981 Constraint (T0311)E80.CB (T0311)L91.CB 6.6857 11.1428 14.4856 0.9981 Constraint (T0311)E80.CB (T0311)R89.CB 7.0912 11.8186 15.3642 0.9981 Constraint (T0311)A79.CB (T0311)S95.CB 6.5497 10.9162 14.1910 0.9981 Constraint (T0311)A79.CB (T0311)Q94.CB 6.0554 10.0923 13.1200 0.9981 Constraint (T0311)A79.CB (T0311)T93.CB 2.7533 4.5889 5.9656 0.9981 Constraint (T0311)E78.CB (T0311)T93.CB 4.9602 8.2670 10.7471 0.9981 Constraint (T0311)E78.CB (T0311)R87.CB 6.5973 10.9954 14.2941 0.9981 Constraint (T0311)A77.CB (T0311)T93.CB 6.7646 11.2744 14.6567 0.9981 Constraint (T0311)A77.CB (T0311)R87.CB 6.0420 10.0700 13.0910 0.9981 Constraint (T0311)L76.CB (T0311)T93.CB 4.8918 8.1530 10.5990 0.9981 Constraint (T0311)L76.CB (T0311)L91.CB 6.3326 10.5543 13.7207 0.9981 Constraint (T0311)L76.CB (T0311)R90.CB 6.5430 10.9050 14.1764 0.9981 Constraint (T0311)L76.CB (T0311)R87.CB 5.8047 9.6746 12.5769 0.9981 Constraint (T0311)S75.CB (T0311)T93.CB 4.0087 6.6812 8.6856 0.9981 Constraint (T0311)S75.CB (T0311)R87.CB 6.7623 11.2704 14.6516 0.9981 Constraint (T0311)W74.CB (T0311)T93.CB 7.0641 11.7735 15.3055 0.9981 Constraint (T0311)W74.CB (T0311)R90.CB 7.0846 11.8077 15.3501 0.9981 Constraint (T0311)W74.CB (T0311)R87.CB 4.7002 7.8336 10.1837 0.9981 Constraint (T0311)W74.CB (T0311)S86.CB 5.9566 9.9276 12.9059 0.9981 Constraint (T0311)A73.CB (T0311)R87.CB 6.1204 10.2006 13.2608 0.9981 Constraint (T0311)A73.CB (T0311)T82.CB 6.5548 10.9246 14.2020 0.9981 Constraint (T0311)N72.CB (T0311)R87.CB 6.4934 10.8224 14.0691 0.9981 Constraint (T0311)N72.CB (T0311)V83.CB 6.4144 10.6906 13.8978 0.9981 Constraint (T0311)N72.CB (T0311)T82.CB 6.4808 10.8014 14.0418 0.9981 Constraint (T0311)Q71.CB (T0311)T96.CB 6.6901 11.1501 14.4951 0.9981 Constraint (T0311)Q71.CB (T0311)L91.CB 6.5145 10.8576 14.1148 0.9981 Constraint (T0311)Q71.CB (T0311)R90.CB 6.9052 11.5087 14.9614 0.9981 Constraint (T0311)Q71.CB (T0311)L88.CB 5.7979 9.6632 12.5622 0.9981 Constraint (T0311)Q71.CB (T0311)R87.CB 3.7025 6.1708 8.0220 0.9981 Constraint (T0311)Q71.CB (T0311)S86.CB 5.8881 9.8135 12.7576 0.9981 Constraint (T0311)Q71.CB (T0311)V85.CB 6.2322 10.3870 13.5031 0.9981 Constraint (T0311)Q71.CB (T0311)V83.CB 3.3389 5.5648 7.2342 0.9981 Constraint (T0311)L70.CB (T0311)T93.CB 6.7001 11.1668 14.5168 0.9981 Constraint (T0311)L70.CB (T0311)L91.CB 4.7582 7.9303 10.3094 0.9981 Constraint (T0311)L70.CB (T0311)R90.CB 5.0536 8.4227 10.9495 0.9981 Constraint (T0311)L70.CB (T0311)R89.CB 7.1684 11.9474 15.5316 0.9981 Constraint (T0311)N69.CB (T0311)L91.CB 6.3315 10.5524 13.7182 0.9981 Constraint (T0311)N69.CB (T0311)R87.CB 5.7568 9.5946 12.4730 0.9981 Constraint (T0311)L68.CB (T0311)T96.CB 6.4659 10.7766 14.0095 0.9981 Constraint (T0311)L68.CB (T0311)T93.CB 6.7604 11.2673 14.6475 0.9981 Constraint (T0311)L68.CB (T0311)L91.CB 6.5565 10.9275 14.2057 0.9981 Constraint (T0311)L68.CB (T0311)L88.CB 6.4428 10.7380 13.9594 0.9981 Constraint (T0311)L68.CB (T0311)R87.CB 5.5269 9.2114 11.9749 0.9981 Constraint (T0311)W67.CB (T0311)P97.CB 7.0488 11.7480 15.2723 0.9981 Constraint (T0311)W67.CB (T0311)T96.CB 4.0424 6.7373 8.7585 0.9981 Constraint (T0311)W67.CB (T0311)S95.CB 6.8049 11.3416 14.7440 0.9981 Constraint (T0311)W67.CB (T0311)T93.CB 3.8640 6.4400 8.3720 0.9981 Constraint (T0311)W67.CB (T0311)V92.CB 6.2667 10.4446 13.5779 0.9981 Constraint (T0311)W67.CB (T0311)L91.CB 3.5414 5.9023 7.6730 0.9981 Constraint (T0311)W67.CB (T0311)R90.CB 5.4149 9.0248 11.7322 0.9981 Constraint (T0311)W67.CB (T0311)R89.CB 6.1396 10.2326 13.3024 0.9981 Constraint (T0311)W67.CB (T0311)L88.CB 3.4895 5.8158 7.5605 0.9981 Constraint (T0311)W67.CB (T0311)R87.CB 3.1009 5.1681 6.7186 0.9981 Constraint (T0311)W67.CB (T0311)S86.CB 5.9922 9.9871 12.9832 0.9981 Constraint (T0311)W67.CB (T0311)V85.CB 5.8328 9.7213 12.6376 0.9981 Constraint (T0311)M66.CB (T0311)T96.CB 6.3546 10.5910 13.7683 0.9981 Constraint (T0311)M66.CB (T0311)T93.CB 4.9689 8.2816 10.7661 0.9981 Constraint (T0311)M66.CB (T0311)V92.CB 6.1811 10.3018 13.3923 0.9981 Constraint (T0311)M66.CB (T0311)L91.CB 3.7954 6.3257 8.2234 0.9981 Constraint (T0311)M66.CB (T0311)R90.CB 6.3482 10.5803 13.7544 0.9981 Constraint (T0311)M66.CB (T0311)L88.CB 5.9477 9.9129 12.8868 0.9981 Constraint (T0311)M66.CB (T0311)R87.CB 5.3240 8.8734 11.5354 0.9981 Constraint (T0311)Q65.CB (T0311)T96.CB 7.1099 11.8499 15.4048 0.9981 Constraint (T0311)Q65.CB (T0311)T93.CB 6.5793 10.9655 14.2551 0.9981 Constraint (T0311)Q65.CB (T0311)L91.CB 6.5794 10.9656 14.2553 0.9981 Constraint (T0311)P64.CB (T0311)P97.CB 6.0818 10.1364 13.1773 0.9981 Constraint (T0311)P64.CB (T0311)T96.CB 3.7492 6.2487 8.1233 0.9981 Constraint (T0311)P64.CB (T0311)S95.CB 5.4893 9.1489 11.8935 0.9981 Constraint (T0311)P64.CB (T0311)T93.CB 4.1585 6.9308 9.0101 0.9981 Constraint (T0311)P64.CB (T0311)L91.CB 5.4335 9.0558 11.7726 0.9981 Constraint (T0311)K45.CB (T0311)W74.CB 3.0570 5.0950 6.6235 0.9981 Constraint (T0311)K45.CB (T0311)Q65.CB 3.0599 5.0998 6.6298 0.9981 Constraint (T0311)T43.CB (T0311)W74.CB 5.5069 9.1782 11.9317 0.9981 Constraint (T0311)T43.CB (T0311)Q65.CB 5.5208 9.2013 11.9616 0.9981 Constraint (T0311)L42.CB (T0311)W74.CB 6.1983 10.3305 13.4296 0.9981 Constraint (T0311)L42.CB (T0311)Q65.CB 6.2051 10.3419 13.4444 0.9981 Constraint (T0311)D18.CB (T0311)I54.CB 6.3377 10.5629 13.7318 0.9981 Constraint (T0311)E15.CB (T0311)I54.CB 5.6070 9.3449 12.1484 0.9981 Constraint (T0311)Q14.CB (T0311)Q65.CB 5.8300 9.7166 12.6316 0.9981 Constraint (T0311)Q14.CB (T0311)K55.CB 7.1022 11.8370 15.3881 0.9981 Constraint (T0311)Q14.CB (T0311)I54.CB 4.1422 6.9037 8.9749 0.9981 Constraint (T0311)Q14.CB (T0311)E51.CB 5.8256 9.7093 12.6221 0.9981 Constraint (T0311)T43.CB (T0311)L91.CB 6.4860 10.8099 14.0529 0.9923 Constraint (T0311)T43.CB (T0311)V85.CB 6.7566 11.2610 14.6393 0.9923 Constraint (T0311)S39.CB (T0311)L91.CB 6.2916 10.4860 13.6318 0.9923 Constraint (T0311)A34.CB (T0311)V59.CB 7.1234 11.8723 15.4340 0.9923 Constraint (T0311)R25.CB (T0311)R87.CB 6.9253 11.5422 15.0049 0.9923 Constraint (T0311)L24.CB (T0311)L91.CB 6.5043 10.8405 14.0926 0.9923 Constraint (T0311)L24.CB (T0311)D84.CB 5.6481 9.4135 12.2375 0.9923 Constraint (T0311)V22.CB (T0311)R87.CB 7.1727 11.9544 15.5408 0.9923 Constraint (T0311)T43.CB (T0311)V83.CB 5.8334 9.7224 12.6391 0.9878 Constraint (T0311)L42.CB (T0311)V83.CB 6.1597 10.2661 13.3459 0.9878 Constraint (T0311)S39.CB (T0311)S86.CB 6.8431 11.4051 14.8267 0.9878 Constraint (T0311)S39.CB (T0311)D84.CB 6.1415 10.2359 13.3066 0.9878 Constraint (T0311)S39.CB (T0311)V83.CB 4.7679 7.9466 10.3305 0.9878 Constraint (T0311)S39.CB (T0311)A79.CB 5.8858 9.8097 12.7526 0.9878 Constraint (T0311)S36.CB (T0311)V83.CB 6.9417 11.5694 15.0403 0.9878 Constraint (T0311)P35.CB (T0311)V83.CB 6.3804 10.6341 13.8243 0.9878 Constraint (T0311)L76.CB (T0311)V85.CB 5.7880 9.6467 12.5407 0.9846 Constraint (T0311)E51.CB (T0311)W74.CB 3.5207 5.8678 7.6281 0.9846 Constraint (T0311)A46.CB (T0311)A73.CB 6.6549 11.0916 14.4190 0.9846 Constraint (T0311)L42.CB (T0311)S86.CB 6.3863 10.6438 13.8370 0.9846 Constraint (T0311)L42.CB (T0311)A73.CB 6.0340 10.0566 13.0736 0.9846 Constraint (T0311)L41.CB (T0311)R87.CB 6.8516 11.4193 14.8452 0.9846 Constraint (T0311)L41.CB (T0311)V85.CB 6.9025 11.5041 14.9554 0.9846 Constraint (T0311)L41.CB (T0311)A73.CB 2.9802 4.9670 6.4571 0.9846 Constraint (T0311)R40.CB (T0311)A73.CB 5.3361 8.8935 11.5615 0.9846 Constraint (T0311)S39.CB (T0311)V85.CB 6.9137 11.5228 14.9796 0.9846 Constraint (T0311)A38.CB (T0311)R87.CB 5.7004 9.5007 12.3509 0.9846 Constraint (T0311)A38.CB (T0311)V85.CB 5.2144 8.6907 11.2979 0.9846 Constraint (T0311)A38.CB (T0311)A73.CB 6.0902 10.1504 13.1955 0.9846 Constraint (T0311)T37.CB (T0311)A73.CB 5.4030 9.0051 11.7066 0.9846 Constraint (T0311)P35.CB (T0311)R87.CB 7.1579 11.9298 15.5088 0.9846 Constraint (T0311)P35.CB (T0311)V85.CB 7.1236 11.8727 15.4346 0.9846 Constraint (T0311)I33.CB (T0311)W74.CB 6.7854 11.3089 14.7016 0.9846 Constraint (T0311)I33.CB (T0311)A73.CB 5.9960 9.9933 12.9913 0.9846 Constraint (T0311)E32.CB (T0311)W74.CB 7.0945 11.8241 15.3713 0.9846 Constraint (T0311)M31.CB (T0311)V85.CB 6.3089 10.5148 13.6692 0.9846 Constraint (T0311)M31.CB (T0311)W74.CB 5.5395 9.2325 12.0022 0.9846 Constraint (T0311)R29.CB (T0311)V85.CB 7.1918 11.9864 15.5823 0.9846 Constraint (T0311)A28.CB (T0311)V85.CB 6.2608 10.4346 13.5650 0.9846 Constraint (T0311)F27.CB (T0311)S86.CB 6.3879 10.6465 13.8405 0.9846 Constraint (T0311)R25.CB (T0311)V85.CB 6.4365 10.7275 13.9458 0.9846 Constraint (T0311)L24.CB (T0311)S86.CB 6.4838 10.8063 14.0482 0.9846 Constraint (T0311)S23.CB (T0311)S86.CB 6.2766 10.4610 13.5993 0.9846 Constraint (T0311)L70.CB (T0311)K81.CB 4.9830 8.3050 10.7965 0.9778 Constraint (T0311)N69.CB (T0311)K81.CB 4.7852 7.9754 10.3680 0.9778 Constraint (T0311)N69.CB (T0311)E80.CB 5.0125 8.3541 10.8603 0.9778 Constraint (T0311)L68.CB (T0311)K81.CB 5.1746 8.6243 11.2116 0.9778 Constraint (T0311)L68.CB (T0311)E80.CB 4.8708 8.1180 10.5534 0.9778 Constraint (T0311)E15.CB (T0311)A38.CB 5.3911 8.9851 11.6806 0.8957 Constraint (T0311)E15.CB (T0311)I33.CB 6.6455 11.0759 14.3987 0.8957 Constraint (T0311)E15.CB (T0311)R29.CB 6.3855 10.6425 13.8353 0.8957 Constraint (T0311)E15.CB (T0311)A28.CB 6.0453 10.0754 13.0980 0.8957 Constraint (T0311)E15.CB (T0311)R25.CB 6.9605 11.6008 15.0810 0.8957 Constraint (T0311)A47.CB (T0311)P64.CB 6.2758 10.4597 13.5976 0.8096 Constraint (T0311)K45.CB (T0311)P64.CB 6.4362 10.7270 13.9451 0.8096 Constraint (T0311)M31.CB (T0311)N72.CB 7.0170 11.6951 15.2036 0.8096 Constraint (T0311)A30.CB (T0311)A73.CB 5.7015 9.5025 12.3533 0.8096 Constraint (T0311)A28.CB (T0311)T82.CB 6.9117 11.5195 14.9753 0.8096 Constraint (T0311)A28.CB (T0311)A73.CB 6.7572 11.2621 14.6407 0.8096 Constraint (T0311)F27.CB (T0311)W74.CB 6.7182 11.1970 14.5561 0.8096 Constraint (T0311)F27.CB (T0311)A73.CB 4.7530 7.9217 10.2982 0.8096 Constraint (T0311)E26.CB (T0311)E78.CB 6.5129 10.8549 14.1114 0.8096 Constraint (T0311)R25.CB (T0311)T82.CB 6.2913 10.4855 13.6312 0.8096 Constraint (T0311)S23.CB (T0311)T82.CB 6.6310 11.0516 14.3671 0.8096 Constraint (T0311)V22.CB (T0311)A73.CB 7.0584 11.7641 15.2933 0.8096 Constraint (T0311)L20.CB (T0311)L76.CB 3.1274 5.2123 6.7759 0.8096 Constraint (T0311)L17.CB (T0311)W74.CB 6.7355 11.2258 14.5935 0.8096 Constraint (T0311)L17.CB (T0311)A73.CB 6.5961 10.9934 14.2915 0.8096 Constraint (T0311)S16.CB (T0311)S75.CB 6.8971 11.4952 14.9437 0.8096 Constraint (T0311)S16.CB (T0311)W74.CB 4.1224 6.8707 8.9319 0.8096 Constraint (T0311)E15.CB (T0311)W74.CB 6.0472 10.0786 13.1022 0.8096 Constraint (T0311)I13.CB (T0311)S75.CB 6.9404 11.5674 15.0376 0.8096 Constraint (T0311)I13.CB (T0311)W74.CB 3.8897 6.4829 8.4278 0.8096 Constraint (T0311)I13.CB (T0311)A73.CB 4.4800 7.4667 9.7067 0.8096 Constraint (T0311)I13.CB (T0311)N72.CB 6.7259 11.2098 14.5728 0.8096 Constraint (T0311)I12.CB (T0311)S75.CB 6.3804 10.6340 13.8243 0.8096 Constraint (T0311)I12.CB (T0311)W74.CB 3.5449 5.9081 7.6806 0.8096 Constraint (T0311)V58.CB (T0311)E78.CB 3.2748 5.4580 7.0954 0.6667 Constraint (T0311)V58.CB (T0311)A77.CB 4.3525 7.2541 9.4303 0.6667 Constraint (T0311)N21.CB (T0311)P97.CB 7.0907 11.8178 15.3632 0.6667 Constraint (T0311)N21.CB (T0311)T96.CB 6.3519 10.5866 13.7625 0.6667 Constraint (T0311)N21.CB (T0311)S95.CB 7.0997 11.8328 15.3826 0.6667 Constraint (T0311)N21.CB (T0311)Q94.CB 7.0498 11.7497 15.2746 0.6667 Constraint (T0311)E19.CB (T0311)K81.CB 6.7572 11.2620 14.6406 0.6667 Constraint (T0311)E19.CB (T0311)A77.CB 4.9716 8.2860 10.7718 0.6667 Constraint (T0311)I13.CB (T0311)A77.CB 7.0424 11.7374 15.2586 0.6667 Constraint (T0311)S16.CB (T0311)S86.CB 6.9672 11.6120 15.0956 0.5957 Constraint (T0311)S16.CB (T0311)D84.CB 5.9403 9.9005 12.8706 0.5957 Constraint (T0311)S16.CB (T0311)E78.CB 6.0002 10.0003 13.0004 0.5957 Constraint (T0311)I13.CB (T0311)R87.CB 5.5483 9.2471 12.0212 0.5957 Constraint (T0311)I13.CB (T0311)S86.CB 4.4629 7.4382 9.6696 0.5957 Constraint (T0311)I13.CB (T0311)D84.CB 5.6688 9.4479 12.2823 0.5957 Constraint (T0311)I12.CB (T0311)K55.CB 5.7361 9.5602 12.4283 0.5957 Constraint (T0311)D11.CB (T0311)R90.CB 7.0848 11.8080 15.3504 0.5957 Constraint (T0311)L70.CB (T0311)D84.CB 5.3379 8.8965 11.5654 0.5730 Constraint (T0311)N69.CB (T0311)D84.CB 6.3799 10.6331 13.8230 0.5730 Constraint (T0311)L68.CB (T0311)D84.CB 6.3063 10.5105 13.6637 0.5730 Constraint (T0311)M52.CB (T0311)L88.CB 7.1222 11.8703 15.4314 0.5730 Constraint (T0311)T49.CB (T0311)L88.CB 6.1219 10.2032 13.2642 0.5730 Constraint (T0311)L48.CB (T0311)L88.CB 6.7232 11.2054 14.5670 0.5730 Constraint (T0311)A47.CB (T0311)P97.CB 5.2933 8.8221 11.4688 0.5730 Constraint (T0311)A47.CB (T0311)T96.CB 6.8689 11.4481 14.8825 0.5730 Constraint (T0311)A47.CB (T0311)L88.CB 4.0421 6.7369 8.7579 0.5730 Constraint (T0311)A47.CB (T0311)R87.CB 2.6599 4.4332 5.7632 0.5730 Constraint (T0311)A46.CB (T0311)L88.CB 6.8657 11.4429 14.8758 0.5730 Constraint (T0311)A46.CB (T0311)R87.CB 4.6813 7.8022 10.1428 0.5730 Constraint (T0311)K45.CB (T0311)R87.CB 6.2148 10.3581 13.4655 0.5730 Constraint (T0311)A79.CB (T0311)L88.CB 4.8567 8.0945 10.5229 0.4048 Constraint (T0311)N69.CB (T0311)E78.CB 3.5351 5.8918 7.6593 0.4048 Constraint (T0311)L68.CB (T0311)E78.CB 3.8105 6.3508 8.2561 0.4048 Constraint (T0311)M66.CB (T0311)E78.CB 6.5342 10.8903 14.1574 0.4048 Constraint (T0311)M31.CB (T0311)L88.CB 6.8667 11.4446 14.8779 0.4048 Constraint (T0311)A30.CB (T0311)L91.CB 3.2277 5.3795 6.9934 0.4048 Constraint (T0311)A30.CB (T0311)R90.CB 5.6370 9.3949 12.2134 0.4048 Constraint (T0311)A30.CB (T0311)R89.CB 6.3493 10.5822 13.7568 0.4048 Constraint (T0311)A30.CB (T0311)L88.CB 3.8435 6.4058 8.3276 0.4048 Constraint (T0311)A30.CB (T0311)R87.CB 4.6677 7.7794 10.1133 0.4048 Constraint (T0311)R29.CB (T0311)L91.CB 4.8275 8.0458 10.4596 0.4048 Constraint (T0311)R29.CB (T0311)L88.CB 6.0878 10.1463 13.1902 0.4048 Constraint (T0311)A28.CB (T0311)L91.CB 6.9050 11.5083 14.9608 0.4048 Constraint (T0311)A28.CB (T0311)L88.CB 6.4403 10.7338 13.9540 0.4048 Constraint (T0311)F27.CB (T0311)L91.CB 5.4716 9.1193 11.8552 0.4048 Constraint (T0311)F27.CB (T0311)R89.CB 6.3565 10.5942 13.7725 0.4048 Constraint (T0311)F27.CB (T0311)L88.CB 3.6418 6.0696 7.8905 0.4048 Constraint (T0311)E26.CB (T0311)S95.CB 6.9409 11.5682 15.0387 0.4048 Constraint (T0311)E26.CB (T0311)L91.CB 3.4166 5.6944 7.4027 0.4048 Constraint (T0311)E26.CB (T0311)R90.CB 6.2783 10.4639 13.6031 0.4048 Constraint (T0311)E26.CB (T0311)R89.CB 5.3706 8.9511 11.6364 0.4048 Constraint (T0311)E26.CB (T0311)L88.CB 3.9630 6.6050 8.5865 0.4048 Constraint (T0311)E26.CB (T0311)R87.CB 6.5062 10.8436 14.0967 0.4048 Constraint (T0311)R25.CB (T0311)L91.CB 6.2808 10.4680 13.6084 0.4048 Constraint (T0311)S23.CB (T0311)L91.CB 6.5961 10.9935 14.2916 0.4048 Constraint (T0311)V22.CB (T0311)L91.CB 6.1474 10.2457 13.3194 0.4048 Constraint (T0311)V22.CB (T0311)R89.CB 4.7135 7.8559 10.2126 0.4048 Constraint (T0311)V22.CB (T0311)S86.CB 7.1888 11.9814 15.5758 0.4048 Constraint (T0311)N21.CB (T0311)R89.CB 6.0361 10.0601 13.0781 0.4048 Constraint (T0311)N21.CB (T0311)L88.CB 7.1234 11.8723 15.4339 0.4048 Constraint (T0311)N21.CB (T0311)V85.CB 6.4744 10.7907 14.0280 0.4048 Constraint (T0311)L20.CB (T0311)R89.CB 4.3156 7.1927 9.3506 0.4048 Constraint (T0311)L20.CB (T0311)L88.CB 4.7110 7.8517 10.2072 0.4048 Constraint (T0311)L20.CB (T0311)S86.CB 5.9450 9.9084 12.8809 0.4048 Constraint (T0311)L20.CB (T0311)V85.CB 3.1340 5.2234 6.7904 0.4048 Constraint (T0311)E19.CB (T0311)V85.CB 5.1516 8.5859 11.1617 0.4048 Constraint (T0311)L17.CB (T0311)R89.CB 6.7163 11.1938 14.5520 0.4048 Constraint (T0311)S16.CB (T0311)R89.CB 7.0398 11.7329 15.2528 0.4048 Constraint (T0311)S16.CB (T0311)L88.CB 5.5026 9.1709 11.9222 0.4048 Constraint (T0311)S16.CB (T0311)V85.CB 4.0484 6.7473 8.7716 0.4048 Constraint (T0311)E15.CB (T0311)V85.CB 7.1756 11.9593 15.5471 0.4048 Constraint (T0311)I13.CB (T0311)L88.CB 6.4679 10.7798 14.0138 0.4048 Constraint (T0311)I12.CB (T0311)K81.CB 6.4092 10.6821 13.8867 0.4048 Constraint (T0311)D11.CB (T0311)W74.CB 6.4564 10.7606 13.9888 0.4048 Constraint (T0311)N5.CB (T0311)I33.CB 6.7696 11.2826 14.6674 0.3388 Constraint (T0311)N5.CB (T0311)E32.CB 6.7494 11.2491 14.6238 0.3388 Constraint (T0311)N5.CB (T0311)M31.CB 6.9810 11.6350 15.1255 0.3388 Constraint (T0311)V59.CB (T0311)A73.CB 5.6753 9.4588 12.2964 0.3000 Constraint (T0311)S57.CB (T0311)W74.CB 6.9003 11.5005 14.9507 0.3000 Constraint (T0311)S16.CB (T0311)T43.CB 6.8878 11.4797 14.9237 0.3000 Constraint (T0311)S16.CB (T0311)S39.CB 5.9588 9.9313 12.9107 0.3000 Constraint (T0311)E15.CB (T0311)M52.CB 6.9833 11.6388 15.1305 0.3000 Constraint (T0311)I13.CB (T0311)E51.CB 5.6456 9.4093 12.2321 0.3000 Constraint (T0311)I12.CB (T0311)E51.CB 5.8646 9.7743 12.7065 0.3000 Constraint (T0311)I12.CB (T0311)S23.CB 6.7523 11.2539 14.6300 0.3000 Constraint (T0311)I12.CB (T0311)R25.CB 7.1875 11.9792 15.5730 0.1000 Constraint (T0311)D11.CB (T0311)M52.CB 5.6617 9.4361 12.2670 0.1000 Constraint (T0311)D11.CB (T0311)A38.CB 5.8828 9.8047 12.7462 0.1000 Constraint (T0311)D11.CB (T0311)I33.CB 6.5098 10.8496 14.1045 0.1000 Constraint (T0311)D11.CB (T0311)A30.CB 5.7745 9.6241 12.5114 0.1000 Constraint (T0311)D11.CB (T0311)V22.CB 6.3882 10.6469 13.8410 0.1000 Constraint (T0311)T96.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: