parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:# Making conformation for sequence T0288 numbered 1 through 93 Created new target T0288 from T0288.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0288 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG # choosing archetypes in rotamer library T0288 17 :IGISIGGGAQYCP 2fneA 1969 :LGFSIVGGYGSPH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 2fneA 1985 :PIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG T0288 17 :IGISIGGGA 2fneA 1969 :LGFSIVGGY T0288 26 :QYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fneA 1981 :HGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLM T0288 86 :NKLQ 2fneA 2043 :SDET Number of specific fragments extracted= 4 number of extra gaps= 0 total=7 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2fneA)M1954 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETSV Number of specific fragments extracted= 2 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)Y27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)L88 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIHYN 1y8tA 290 :GATVALTFQ T0288 90 :YY 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIH 1y8tA 290 :GATVALT T0288 89 :Q 1y8tA 304 :S Number of specific fragments extracted= 8 number of extra gaps= 4 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K78 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P289 Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 80 :EVTIHYNKL 1y8tA 290 :GATVALTFQ T0288 92 :K 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1qauA)N14 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYC 1qauA 15 :VISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 40 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=36 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qauA 90 :ETHVVLI T0288 85 :YNKLQY 1qauA 105 :THLETT Number of specific fragments extracted= 4 number of extra gaps= 0 total=40 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIA T0288 79 :GEVTIHYNKLQYYKV 1qauA 91 :THVVLILRGPEGFTT Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0288 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIHYNKLQYY 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=47 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIH 1i16 107 :DGPVTIV T0288 85 :YNKLQYYK 1i16 115 :RRKSLQSK Number of specific fragments extracted= 5 number of extra gaps= 0 total=52 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDG T0288 81 :VTIHY 1i16 110 :VTIVI T0288 87 :KLQYYK 1i16 115 :RRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=56 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0288 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0288 6 :KVTL 1v5lA 8 :NVVL T0288 12 :DAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 12 :PGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETR Number of specific fragments extracted= 3 number of extra gaps= 0 total=59 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 4 :PGKVTLQ 1v5lA 6 :SGNVVLP T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 13 :GPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLK T0288 87 :KLQYY 1v5lA 87 :AETRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=63 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 10 :QKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 10 :VLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0288 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1tp5A 323 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNKL 1tp5A 390 :AQYK Number of specific fragments extracted= 4 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1tp5A 323 :LGFNIVGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNK 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0288 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 5 number of extra gaps= 1 total=80 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIH 1i92A 85 :AVRLL T0288 85 :YN 1i92A 93 :PE Number of specific fragments extracted= 6 number of extra gaps= 1 total=86 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=90 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0288 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1bfeA 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1bfeA 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1bfeA 323 :LGFNIIGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1bfeA 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=96 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=101 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIH 1fc6A 223 :ADSQVEVV T0288 85 :YNKLQY 1fc6A 237 :PSNTRT Number of specific fragments extracted= 4 number of extra gaps= 0 total=105 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 159 :SVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=108 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t2mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m.gz for input Trying 1t2mA/merged-good-all-a2m Error: Couldn't open file 1t2mA/merged-good-all-a2m or 1t2mA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0288 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=111 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIIT T0288 85 :YNK 1nf3C 249 :ANQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=115 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1nf3C 155 :HRRVRLCKYGTEKPLGFYIRDGSS T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 188 :KVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 2 number of extra gaps= 0 total=117 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0288 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0288 2 :MVPGKVTLQ 1wf7A 4 :GSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=120 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 1 :SMVPGKVTLQ 1wf7A 3 :SGSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMT Number of specific fragments extracted= 3 number of extra gaps= 0 total=123 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 7 :VTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 7 :GSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 2 number of extra gaps= 0 total=125 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=129 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)N86 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIH 2f0aA 331 :PGPIVLT T0288 85 :Y 2f0aA 341 :L Number of specific fragments extracted= 5 number of extra gaps= 1 total=134 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 16 :LIGISIGGGAQ 2f0aA 264 :FLGISIVGQSN T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 3 number of extra gaps= 1 total=137 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0288 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK T0288 87 :KL 1n7eA 756 :AQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 1 number of extra gaps= 0 total=143 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIHYNKLQY 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=147 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9A)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9A)P231 T0288 10 :QKDAQNLIGISIGGG 1ky9A 215 :VNLNGELIGINTAIL T0288 27 :YCP 1ky9A 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIH 1ky9A 334 :GSKLTLG T0288 85 :YNKLQ 1ky9A 343 :RDGKQ Number of specific fragments extracted= 7 number of extra gaps= 1 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1ky9A 281 :KVDAQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEVKGEVTIHYNKLQYY 1ky9A 322 :AALRAQVGTMPVGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0288 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIHYNKLQY 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9B)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9B)P231 Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 11 :KDAQNLIGISIGGG 1ky9B 216 :NLNGELIGINTAIL T0288 27 :YCP 1ky9B 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIH 1ky9B 334 :GSKLTLG T0288 85 :YNKLQYY 1ky9B 342 :LRDGKQV Number of specific fragments extracted= 7 number of extra gaps= 1 total=168 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)I19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0288)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 T0288 16 :LIG 1ky9B 264 :ELG T0288 22 :GGGAQ 1ky9B 270 :TELNS T0288 27 :YCPCLYIVQVFDNTPAALDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKM 1ky9B 321 :FAALRAQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=173 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xz9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m.gz for input Trying 1xz9A/merged-good-all-a2m Error: Couldn't open file 1xz9A/merged-good-all-a2m or 1xz9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0288)Y91 because last residue in template chain is (1mfgA)S1371 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=179 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :Y 1mfgA 1369 :V Number of specific fragments extracted= 6 number of extra gaps= 2 total=185 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1mfgA 1278 :SMEIRVRVEKDPELGFSISGGVG T0288 27 :YCPCLYIVQVFDNTPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 5 number of extra gaps= 2 total=190 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0288 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQYC 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 34 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1b8qA 84 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1b8qA 84 :ETHVVLI T0288 86 :NKLQYY 1b8qA 94 :PEGFTT Number of specific fragments extracted= 4 number of extra gaps= 0 total=197 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1b8qA 8 :NVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEG Number of specific fragments extracted= 2 number of extra gaps= 0 total=199 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0288 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=203 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 4 number of extra gaps= 1 total=207 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 1 total=210 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0288 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQ 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=213 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=216 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKP Number of specific fragments extracted= 2 number of extra gaps= 0 total=218 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=221 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=224 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 2 :MVPGKVTLQKDAQNLIGISIGGG 1r6jA 194 :MDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=227 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0288 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=229 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 78 :QRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=230 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wfvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m.gz for input Trying 1wfvA/merged-good-all-a2m Error: Couldn't open file 1wfvA/merged-good-all-a2m or 1wfvA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0288 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQYC 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1040 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=233 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qavB 1090 :ETHVVLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=236 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0288 81 :VTIHYNKLQY 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=239 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0288 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQYC 1m5zA 34 :EDFGFSVADGLLEK T0288 30 :CLYIVQVFDNTPAALDG 1m5zA 48 :GVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=243 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=247 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 2 :MVPGKVTLQKDAQ 1m5zA 20 :VELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR Number of specific fragments extracted= 4 number of extra gaps= 0 total=251 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0288 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=254 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=257 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1be9A 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=259 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x6dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m.gz for input Trying 1x6dA/merged-good-all-a2m Error: Couldn't open file 1x6dA/merged-good-all-a2m or 1x6dA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0288 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIHYNKLQY 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 8 number of extra gaps= 6 total=267 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 Warning: unaligning (T0288)Y90 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)T343 T0288 8 :TLQK 1te0A 262 :GGRE T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1te0A 328 :GSVIPVV T0288 85 :YNKLQ 1te0A 337 :RDDKQ Number of specific fragments extracted= 10 number of extra gaps= 7 total=277 Number of alignments=74 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEVKGEVTIHYNKLQYYK 1te0A 314 :SALETMDQVAEIRPGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=284 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0288 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=287 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTR Number of specific fragments extracted= 3 number of extra gaps= 1 total=290 Number of alignments=76 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 4 :PGKVTLQKD 2fcfA 1149 :PRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=293 Number of alignments=77 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0288 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0288 13 :AQ 1lcyA 249 :PS T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQE 1lcyA 291 :AEDVYEAVRT T0288 78 :KGEVTIHYNKLQY 1lcyA 301 :QSQLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=298 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 12 :DAQN 1lcyA 248 :EPSF T0288 25 :AQYCPCLYIVQVFDNTPAALDG 1lcyA 252 :PDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIH 1lcyA 302 :SQLAVQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=303 Number of alignments=79 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIHYNKLQY 1lcyA 302 :SQLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=307 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEV 1sotA 315 :ALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)N86 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0288 9 :LQKDAQNLIGISIG 1sotA 205 :LVNSLGELMGINTL T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIK 1sotA 298 :IQVNDLIISVDNKPAI T0288 66 :TKVEVAKMIQEV 1sotA 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV T0288 87 :KLQYYK 1sotA 342 :LTLQVT Number of specific fragments extracted= 6 number of extra gaps= 0 total=317 Number of alignments=82 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)K87 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEVKGEVTIHYN 1sotA 315 :ALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=320 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0288 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f5yA)V95 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 5 number of extra gaps= 1 total=325 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIH 2f5yA 71 :WKCVELAHEIRSCPSEIILL Number of specific fragments extracted= 5 number of extra gaps= 1 total=330 Number of alignments=85 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)P4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 5 :GKVTLQKDAQNLIGISIGGG 2f5yA 16 :YRQITIPRGKDGFGFTICCD T0288 29 :PCLYIVQVFDNTPAALDG 2f5yA 36 :SPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=334 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0288 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=337 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK Number of specific fragments extracted= 3 number of extra gaps= 0 total=340 Number of alignments=88 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1kwaA)F574 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1kwaA 489 :RLVQFQKNTDEPMGITLKMNEL T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 0 total=342 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0288 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYR Number of specific fragments extracted= 2 number of extra gaps= 1 total=344 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0288)Y90 because last residue in template chain is (1kwaB)F574 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK T0288 85 :YNKLQ 1kwaB 569 :PSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=347 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)G24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 1 total=349 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0288 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQYC 1pdr 476 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 488 :GIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 3 number of extra gaps= 0 total=352 Number of alignments=91 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQ 1pdr 476 :LGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIV T0288 85 :YNK 1pdr 545 :YRP Number of specific fragments extracted= 4 number of extra gaps= 0 total=356 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=358 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 86 :NKLQYY 1n99A 191 :RDRPFE Number of specific fragments extracted= 5 number of extra gaps= 1 total=363 Number of alignments=94 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 85 :YNKLQYY 1n99A 193 :RPFERTI Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFGE T0288 81 :VTI 1n99A 186 :ITM T0288 86 :NKLQYYK 1n99A 191 :RDRPFER Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 2 :MVPGKVTLQKDAQN 1g9oA 10 :MLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=377 Number of alignments=97 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 1 :SMVPGKVTLQKDAQN 1g9oA 9 :RMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLL T0288 85 :YNKL 1g9oA 93 :PETD Number of specific fragments extracted= 5 number of extra gaps= 0 total=382 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=385 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=398 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)N86 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV Number of specific fragments extracted= 12 number of extra gaps= 12 total=410 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGGG 1l6oA 269 :IVGQ T0288 27 :Y 1l6oA 277 :G T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=423 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=426 Number of alignments=100 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVK T0288 85 :YNK 1q3oA 684 :VTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=430 Number of alignments=101 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKA T0288 27 :YCPCLYIVQVFDNTPAALDG 1q3oA 624 :FPALQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=433 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=435 Number of alignments=103 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=437 Number of alignments=104 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=438 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=441 Number of alignments=106 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELE Number of specific fragments extracted= 3 number of extra gaps= 1 total=444 Number of alignments=107 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1ihjA 13 :ELIHMVTLDKTGKKSFGICIVRGEV T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 44 :KTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 2 number of extra gaps= 0 total=446 Number of alignments=108 # command:Using radius: 9.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 108 evalue: 0 0.5265, weight 0.1000 evalue: 1 0.5265, weight 0.1000 evalue: 2 0.5265, weight 0.1000 evalue: 3 0.0739, weight 0.8737 evalue: 4 0.0739, weight 0.8737 evalue: 5 0.0739, weight 0.8737 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.3503, weight 0.4012 evalue: 40 0.3503, weight 0.4012 evalue: 41 0.3503, weight 0.4012 evalue: 42 0.1754, weight 0.7001 evalue: 43 0.1754, weight 0.7001 evalue: 44 0.1754, weight 0.7001 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0035, weight 0.9940 evalue: 73 0.0035, weight 0.9940 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0021, weight 0.9965 evalue: 78 0.0021, weight 0.9965 evalue: 79 0.0021, weight 0.9965 evalue: 80 0.3878, weight 0.3370 evalue: 81 0.3878, weight 0.3370 evalue: 82 0.3878, weight 0.3370 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 1.0000 evalue: 89 0.0001, weight 0.9999 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 0.9999 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 1.0000 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 23 RES2ATOM 5 34 RES2ATOM 6 43 RES2ATOM 7 50 RES2ATOM 8 57 RES2ATOM 9 65 RES2ATOM 10 74 RES2ATOM 11 83 RES2ATOM 12 91 RES2ATOM 13 96 RES2ATOM 14 105 RES2ATOM 15 113 RES2ATOM 16 121 RES2ATOM 18 133 RES2ATOM 19 141 RES2ATOM 20 147 RES2ATOM 24 167 RES2ATOM 25 172 RES2ATOM 26 181 RES2ATOM 27 193 RES2ATOM 28 199 RES2ATOM 29 206 RES2ATOM 30 212 RES2ATOM 31 220 RES2ATOM 32 232 RES2ATOM 33 240 RES2ATOM 34 247 RES2ATOM 35 256 RES2ATOM 36 263 RES2ATOM 37 274 RES2ATOM 38 282 RES2ATOM 39 290 RES2ATOM 40 297 RES2ATOM 41 304 RES2ATOM 42 309 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 46 334 RES2ATOM 47 341 RES2ATOM 48 348 RES2ATOM 49 353 RES2ATOM 51 362 RES2ATOM 52 370 RES2ATOM 53 379 RES2ATOM 54 387 RES2ATOM 56 398 RES2ATOM 57 405 RES2ATOM 59 417 RES2ATOM 60 428 RES2ATOM 61 434 RES2ATOM 62 442 RES2ATOM 64 455 RES2ATOM 65 464 RES2ATOM 66 471 RES2ATOM 67 480 RES2ATOM 68 487 RES2ATOM 69 496 RES2ATOM 70 503 RES2ATOM 71 508 RES2ATOM 72 517 RES2ATOM 73 525 RES2ATOM 74 533 RES2ATOM 75 542 RES2ATOM 76 551 RES2ATOM 77 558 RES2ATOM 79 571 RES2ATOM 80 580 RES2ATOM 81 587 RES2ATOM 82 594 RES2ATOM 83 602 RES2ATOM 84 612 RES2ATOM 85 624 RES2ATOM 86 632 RES2ATOM 87 641 RES2ATOM 88 649 RES2ATOM 89 658 RES2ATOM 90 670 RES2ATOM 91 682 RES2ATOM 92 691 Constraint (T0288)V36.CB (T0288)A50.CB 3.7444 6.2407 8.1129 100.2126 Constraint (T0288)V36.CB (T0288)A49.CB 4.2283 7.0472 9.1613 100.2126 Constraint (T0288)I33.CB (T0288)I54.CB 4.0383 6.7306 8.7497 100.2126 Constraint (T0288)I33.CB (T0288)A50.CB 3.4221 5.7035 7.4146 100.2126 Constraint (T0288)I33.CB (T0288)A49.CB 4.2069 7.0114 9.1148 100.2126 Constraint (T0288)Y32.CB (T0288)I54.CB 4.4106 7.3509 9.5562 100.2126 Constraint (T0288)V57.CB (T0288)I74.CB 3.8576 6.4293 8.3581 99.5125 Constraint (T0288)V34.CB (T0288)A50.CB 3.8941 6.4902 8.4373 98.2247 Constraint (T0288)I33.CB (T0288)D52.CB 2.8733 4.7888 6.2254 98.2247 Constraint (T0288)Y32.CB (T0288)E53.CB 3.3719 5.6199 7.3058 98.2247 Constraint (T0288)Y32.CB (T0288)D52.CB 4.1767 6.9611 9.0495 98.2247 Constraint (T0288)V36.CB (T0288)V48.CB 3.5279 5.8799 7.6438 97.5916 Constraint (T0288)I33.CB (T0288)V48.CB 3.6941 6.1569 8.0039 97.5916 Constraint (T0288)V57.CB (T0288)M73.CB 3.1499 5.2499 6.8248 97.2127 Constraint (T0288)I33.CB (T0288)A42.CB 4.7090 7.8484 10.2029 97.2127 Constraint (T0288)V57.CB (T0288)V70.CB 4.2726 7.1210 9.2573 97.2126 Constraint (T0288)N58.CB (T0288)T82.CB 3.2935 5.4892 7.1360 96.9007 Constraint (T0288)N58.CB (T0288)V81.CB 3.6972 6.1620 8.0106 96.9007 Constraint (T0288)V57.CB (T0288)V81.CB 3.9597 6.5995 8.5793 96.9007 Constraint (T0288)V57.CB (T0288)T82.CB 4.4301 7.3835 9.5986 96.2266 Constraint (T0288)Y32.CB (T0288)A50.CB 4.9358 8.2263 10.6942 95.3770 Constraint (T0288)Q35.CB (T0288)A50.CB 3.7416 6.2359 8.1067 95.2247 Constraint (T0288)R60.CB (T0288)M73.CB 3.7567 6.2612 8.1396 94.6022 Constraint (T0288)L31.CB (T0288)V70.CB 3.1404 5.2340 6.8042 94.2126 Constraint (T0288)L31.CB (T0288)I54.CB 2.9331 4.8885 6.3551 94.2126 Constraint (T0288)N58.CB (T0288)I83.CB 4.7773 7.9622 10.3509 93.5125 Constraint (T0288)V57.CB (T0288)I83.CB 3.4609 5.7681 7.4985 93.5125 Constraint (T0288)I33.CB (T0288)E53.CB 4.6702 7.7837 10.1188 92.2247 Constraint (T0288)L31.CB (T0288)I62.CB 3.3128 5.5213 7.1777 92.2247 Constraint (T0288)I54.CB (T0288)V70.CB 4.1548 6.9247 9.0021 91.2128 Constraint (T0288)I21.CB (T0288)A71.CB 4.2609 7.1015 9.2319 90.9203 Constraint (T0288)I21.CB (T0288)I54.CB 4.1369 6.8948 8.9633 90.9203 Constraint (T0288)I21.CB (T0288)V34.CB 3.8070 6.3450 8.2485 90.9203 Constraint (T0288)I21.CB (T0288)I33.CB 3.6511 6.0851 7.9107 90.9203 Constraint (T0288)I21.CB (T0288)Y32.CB 3.9681 6.6135 8.5976 90.9203 Constraint (T0288)S20.CB (T0288)V36.CB 4.7517 7.9196 10.2954 90.9203 Constraint (T0288)S20.CB (T0288)Q35.CB 2.6305 4.3842 5.6995 90.9203 Constraint (T0288)S20.CB (T0288)V34.CB 2.8756 4.7927 6.2305 90.9203 Constraint (T0288)S20.CB (T0288)I33.CB 4.2595 7.0992 9.2289 90.9203 Constraint (T0288)I19.CB (T0288)F37.CB 4.1038 6.8397 8.8916 90.9203 Constraint (T0288)I19.CB (T0288)V36.CB 3.1530 5.2550 6.8315 90.9203 Constraint (T0288)I19.CB (T0288)Q35.CB 4.0104 6.6840 8.6891 90.9203 Constraint (T0288)I19.CB (T0288)V34.CB 4.8079 8.0132 10.4172 90.9203 Constraint (T0288)I19.CB (T0288)I33.CB 3.2217 5.3695 6.9803 90.9203 Constraint (T0288)I17.CB (T0288)I74.CB 4.0678 6.7797 8.8137 90.9203 Constraint (T0288)I54.CB (T0288)I83.CB 3.5194 5.8656 7.6253 90.9007 Constraint (T0288)N58.CB (T0288)V77.CB 3.6865 6.1442 7.9874 90.2912 Constraint (T0288)V57.CB (T0288)H84.CB 4.7184 7.8640 10.2232 90.1757 Constraint (T0288)N58.CB (T0288)M73.CB 4.4295 7.3825 9.5973 90.0092 Constraint (T0288)L31.CB (T0288)K67.CB 3.8984 6.4973 8.4465 90.0091 Constraint (T0288)L31.CB (T0288)E53.CB 4.1418 6.9029 8.9738 89.2248 Constraint (T0288)I17.CB (T0288)P41.CB 3.3610 5.6016 7.2821 88.9994 Constraint (T0288)I17.CB (T0288)A42.CB 3.3938 5.6564 7.3533 88.6205 Constraint (T0288)I19.CB (T0288)V48.CB 3.7648 6.2746 8.1570 88.2993 Constraint (T0288)I62.CB (T0288)M73.CB 4.2542 7.0904 9.2175 88.2250 Constraint (T0288)I17.CB (T0288)V81.CB 3.8117 6.3528 8.2586 88.0468 Constraint (T0288)I21.CB (T0288)V70.CB 3.8014 6.3357 8.2364 87.9204 Constraint (T0288)I19.CB (T0288)A42.CB 2.6955 4.4925 5.8402 87.9203 Constraint (T0288)T55.CB (T0288)H84.CB 2.8818 4.8030 6.2440 87.9009 Constraint (T0288)I54.CB (T0288)H84.CB 4.4134 7.3557 9.5624 87.9009 Constraint (T0288)T55.CB (T0288)I83.CB 5.0035 8.3391 10.8408 87.9007 Constraint (T0288)V57.CB (T0288)V77.CB 4.1928 6.9881 9.0845 86.9133 Constraint (T0288)I17.CB (T0288)T40.CB 4.2618 7.1031 9.2340 85.9995 Constraint (T0288)I21.CB (T0288)L31.CB 3.1659 5.2764 6.8594 84.9203 Constraint (T0288)V48.CB (T0288)I83.CB 4.5414 7.5690 9.8397 84.7530 Constraint (T0288)C30.CB (T0288)I54.CB 4.5698 7.6163 9.9012 84.2017 Constraint (T0288)Q10.CB (T0288)V81.CB 4.3782 7.2970 9.4861 83.2993 Constraint (T0288)T8.CB (T0288)T82.CB 3.2353 5.3922 7.0099 83.2993 Constraint (T0288)I21.CB (T0288)I74.CB 4.5628 7.6046 9.8860 82.2994 Constraint (T0288)L9.CB (T0288)V81.CB 3.1373 5.2288 6.7975 82.2993 Constraint (T0288)I19.CB (T0288)P41.CB 5.0411 8.4019 10.9224 82.2993 Constraint (T0288)L9.CB (T0288)T82.CB 4.4551 7.4252 9.6528 82.2993 Constraint (T0288)I21.CB (T0288)K67.CB 3.9986 6.6644 8.6637 80.9205 Constraint (T0288)V7.CB (T0288)T82.CB 4.2555 7.0925 9.2203 80.2993 Constraint (T0288)L31.CB (T0288)K65.CB 4.0991 6.8319 8.8814 79.5030 Constraint (T0288)I19.CB (T0288)T40.CB 4.2656 7.1094 9.2422 79.2994 Constraint (T0288)T8.CB (T0288)V81.CB 4.3572 7.2621 9.4407 79.2993 Constraint (T0288)S20.CB (T0288)F37.CB 4.6796 7.7993 10.1390 78.9204 Constraint (T0288)I19.CB (T0288)A43.CB 4.9859 8.3099 10.8029 78.9203 Constraint (T0288)Q10.CB (T0288)E80.CB 3.4743 5.7904 7.5276 77.2993 Constraint (T0288)K11.CB (T0288)V81.CB 4.0215 6.7025 8.7133 77.2993 Constraint (T0288)T8.CB (T0288)I83.CB 4.4130 7.3551 9.5616 77.2993 Constraint (T0288)L9.CB (T0288)E80.CB 4.1880 6.9800 9.0740 76.2994 Constraint (T0288)K11.CB (T0288)P41.CB 3.7574 6.2623 8.1410 76.2993 Constraint (T0288)L9.CB (T0288)I83.CB 4.1994 6.9990 9.0987 76.2993 Constraint (T0288)V7.CB (T0288)I83.CB 3.2106 5.3510 6.9563 76.2993 Constraint (T0288)C30.CB (T0288)I62.CB 4.5639 7.6065 9.8885 76.2138 Constraint (T0288)C30.CB (T0288)E53.CB 3.0114 5.0190 6.5247 76.2138 Constraint (T0288)Q10.CB (T0288)P41.CB 3.6483 6.0805 7.9046 75.2994 Constraint (T0288)L9.CB (T0288)D45.CB 3.5916 5.9860 7.7819 74.2993 Constraint (T0288)K11.CB (T0288)E80.CB 4.3606 7.2677 9.4481 74.2993 Constraint (T0288)N58.CB (T0288)E80.CB 4.9525 8.2542 10.7304 74.2889 Constraint (T0288)C30.CB (T0288)K63.CB 4.1314 6.8857 8.9515 74.2136 Constraint (T0288)V7.CB (T0288)H84.CB 4.4554 7.4257 9.6533 73.2995 Constraint (T0288)K6.CB (T0288)H84.CB 3.4547 5.7578 7.4851 73.2995 Constraint (T0288)K6.CB (T0288)I83.CB 4.4438 7.4063 9.6282 73.2993 Constraint (T0288)L31.CB (T0288)T55.CB 4.9192 8.1986 10.6582 73.2128 Constraint (T0288)E53.CB (T0288)Y85.CB 3.8323 6.3871 8.3032 72.2688 Constraint (T0288)D52.CB (T0288)Y85.CB 2.8086 4.6810 6.0853 71.1425 Constraint (T0288)K6.CB (T0288)T82.CB 3.8886 6.4809 8.4252 69.1993 Constraint (T0288)L9.CB (T0288)A42.CB 3.7637 6.2728 8.1546 69.1993 Constraint (T0288)L9.CB (T0288)V48.CB 4.6762 7.7937 10.1318 69.1993 Constraint (T0288)L9.CB (T0288)P41.CB 3.0642 5.1070 6.6391 69.1993 Constraint (T0288)V7.CB (T0288)V48.CB 3.7300 6.2167 8.0818 69.1993 Constraint (T0288)E53.CB (T0288)K87.CB 4.6016 7.6694 9.9702 68.5685 Constraint (T0288)T8.CB (T0288)D45.CB 4.2910 7.1516 9.2971 68.2993 Constraint (T0288)L31.CB (T0288)K63.CB 4.8372 8.0621 10.4807 67.9248 Constraint (T0288)E53.CB (T0288)N86.CB 2.8622 4.7703 6.2014 66.8675 Constraint (T0288)T55.CB (T0288)Y85.CB 4.0835 6.8058 8.8475 66.6000 Constraint (T0288)I54.CB (T0288)Y85.CB 3.5307 5.8844 7.6497 66.4736 Constraint (T0288)I17.CB (T0288)F37.CB 5.1833 8.6388 11.2305 66.3207 Constraint (T0288)C30.CB (T0288)T55.CB 4.4621 7.4368 9.6678 66.2016 Constraint (T0288)I17.CB (T0288)V77.CB 4.7566 7.9276 10.3059 65.9997 Constraint (T0288)D52.CB (T0288)N86.CB 4.0857 6.8095 8.8524 65.9675 Constraint (T0288)T55.CB (T0288)N86.CB 3.4985 5.8308 7.5800 65.7734 Constraint (T0288)I54.CB (T0288)N86.CB 4.9764 8.2940 10.7822 65.7734 Constraint (T0288)T8.CB (T0288)E80.CB 3.6811 6.1352 7.9758 65.1994 Constraint (T0288)V7.CB (T0288)D45.CB 3.5653 5.9422 7.7249 65.1993 Constraint (T0288)I33.CB (T0288)Y85.CB 4.6313 7.7188 10.0345 65.1616 Constraint (T0288)D52.CB (T0288)K87.CB 3.5500 5.9167 7.6917 64.5686 Constraint (T0288)V48.CB (T0288)Y85.CB 4.2276 7.0459 9.1597 64.0201 Constraint (T0288)D12.CB (T0288)P41.CB 3.7396 6.2327 8.1025 61.2994 Constraint (T0288)V7.CB (T0288)V81.CB 5.0969 8.4949 11.0433 61.1993 Constraint (T0288)I19.CB (T0288)A50.CB 5.0393 8.3989 10.9185 59.9207 Constraint (T0288)L16.CB (T0288)P41.CB 4.4513 7.4188 9.6445 59.7995 Constraint (T0288)A49.CB (T0288)K87.CB 4.3910 7.3183 9.5138 59.7604 Constraint (T0288)A49.CB (T0288)Y85.CB 4.8666 8.1110 10.5443 58.8542 Constraint (T0288)I62.CB (T0288)H84.CB 5.0814 8.4691 11.0098 57.9133 Constraint (T0288)I21.CB (T0288)Q35.CB 5.1981 8.6634 11.2625 57.6206 Constraint (T0288)P4.CB (T0288)T55.CB 4.1600 6.9334 9.0134 57.1996 Constraint (T0288)V7.CB (T0288)A42.CB 4.9075 8.1792 10.6329 57.1994 Constraint (T0288)S61.CB (T0288)H84.CB 5.1287 8.5478 11.1122 57.0916 Constraint (T0288)D52.CB (T0288)I83.CB 5.0543 8.4238 10.9509 57.0365 Constraint (T0288)L16.CB (T0288)T40.CB 4.2618 7.1030 9.2339 56.7996 Constraint (T0288)K11.CB (T0288)V77.CB 4.2470 7.0783 9.2018 55.9993 Constraint (T0288)P4.CB (T0288)H84.CB 3.6638 6.1063 7.9382 55.1996 Constraint (T0288)L16.CB (T0288)F37.CB 4.5745 7.6242 9.9115 53.3205 Constraint (T0288)V7.CB (T0288)Y85.CB 3.8965 6.4941 8.4424 53.1998 Constraint (T0288)K6.CB (T0288)Y85.CB 4.4159 7.3598 9.5678 53.1998 Constraint (T0288)I17.CB (T0288)V48.CB 5.1478 8.5797 11.1536 51.9996 Constraint (T0288)I74.CB (T0288)I83.CB 5.0072 8.3453 10.8489 51.7140 Constraint (T0288)A42.CB (T0288)I83.CB 5.0973 8.4955 11.0442 51.6986 Constraint (T0288)N15.CB (T0288)T40.CB 4.2525 7.0874 9.2136 51.2998 Constraint (T0288)P41.CB (T0288)V81.CB 4.9607 8.2679 10.7483 51.2995 Constraint (T0288)E53.CB (T0288)K63.CB 4.9758 8.2930 10.7809 50.9998 Constraint (T0288)I17.CB (T0288)I83.CB 5.0063 8.3439 10.8470 50.9208 Constraint (T0288)Q10.CB (T0288)D45.CB 4.6498 7.7496 10.0745 50.2996 Constraint (T0288)V7.CB (T0288)T47.CB 3.2775 5.4625 7.1013 50.1997 Constraint (T0288)I19.CB (T0288)I74.CB 4.9714 8.2857 10.7714 48.9994 Constraint (T0288)L9.CB (T0288)I19.CB 5.0405 8.4008 10.9211 48.3365 Constraint (T0288)L9.CB (T0288)L44.CB 4.9907 8.3178 10.8131 48.1994 Constraint (T0288)K11.CB (T0288)K78.CB 4.3979 7.3298 9.5288 47.9994 Constraint (T0288)C30.CB (T0288)K65.CB 4.6289 7.7148 10.0292 46.4030 Constraint (T0288)N15.CB (T0288)P41.CB 4.1454 6.9091 8.9818 46.2998 Constraint (T0288)E53.CB (T0288)L88.CB 4.0122 6.6871 8.6932 46.2746 Constraint (T0288)P4.CB (T0288)N86.CB 3.4040 5.6733 7.3753 46.1998 Constraint (T0288)I54.CB (T0288)I74.CB 4.9046 8.1743 10.6266 45.2998 Constraint (T0288)E53.CB (T0288)I62.CB 5.1573 8.5954 11.1740 45.0210 Constraint (T0288)I54.CB (T0288)K63.CB 5.1017 8.5028 11.0536 44.9998 Constraint (T0288)L31.CB (T0288)T66.CB 5.0716 8.4527 10.9885 44.3247 Constraint (T0288)D52.CB (T0288)L88.CB 4.2181 7.0301 9.1391 43.8757 Constraint (T0288)A25.CB (T0288)T66.CB 3.5406 5.9010 7.6713 42.2998 Constraint (T0288)N58.CB (T0288)K78.CB 4.6280 7.7133 10.0273 42.2962 Constraint (T0288)A25.CB (T0288)K67.CB 4.1864 6.9773 9.0705 41.2998 Constraint (T0288)V7.CB (T0288)D52.CB 5.1025 8.5042 11.0554 41.1997 Constraint (T0288)I54.CB (T0288)K65.CB 5.0511 8.4185 10.9441 40.2033 Constraint (T0288)P4.CB (T0288)Y85.CB 4.2640 7.1066 9.2386 40.0997 Constraint (T0288)I19.CB (T0288)D52.CB 5.2493 8.7488 11.3735 39.2997 Constraint (T0288)L9.CB (T0288)T47.CB 4.6507 7.7511 10.0765 38.9998 Constraint (T0288)N58.CB (T0288)I74.CB 4.7709 7.9515 10.3369 38.9989 Constraint (T0288)L9.CB (T0288)T40.CB 5.1282 8.5470 11.1111 38.1995 Constraint (T0288)I62.CB (T0288)I83.CB 5.0496 8.4161 10.9409 37.6130 Constraint (T0288)D12.CB (T0288)T40.CB 4.4015 7.3358 9.5365 37.1996 Constraint (T0288)T8.CB (T0288)T47.CB 4.4826 7.4709 9.7122 36.0998 Constraint (T0288)N58.CB (T0288)E76.CB 4.9265 8.2109 10.6741 35.9998 Constraint (T0288)L31.CB (T0288)A71.CB 4.8911 8.1518 10.5973 35.9247 Constraint (T0288)N15.CB (T0288)F37.CB 4.6555 7.7592 10.0869 35.2999 Constraint (T0288)P4.CB (T0288)K87.CB 4.5055 7.5091 9.7618 35.1998 Constraint (T0288)N15.CB (T0288)Q75.CB 4.3108 7.1847 9.3401 35.1994 Constraint (T0288)L16.CB (T0288)A42.CB 5.2158 8.6930 11.3009 33.7000 Constraint (T0288)L31.CB (T0288)E69.CB 4.9368 8.2281 10.6965 32.9140 Constraint (T0288)V3.CB (T0288)N86.CB 4.1643 6.9405 9.0226 32.2998 Constraint (T0288)P29.CB (T0288)K63.CB 3.8321 6.3869 8.3029 32.0904 Constraint (T0288)I62.CB (T0288)I74.CB 5.0608 8.4346 10.9650 31.5033 Constraint (T0288)D45.CB (T0288)I83.CB 5.0123 8.3538 10.8600 31.4655 Constraint (T0288)V3.CB (T0288)K87.CB 4.0135 6.6892 8.6959 31.2998 Constraint (T0288)I17.CB (T0288)Q75.CB 4.9577 8.2628 10.7417 31.2997 Constraint (T0288)T47.CB (T0288)Y85.CB 4.9053 8.1755 10.6282 31.1999 Constraint (T0288)Q10.CB (T0288)L44.CB 4.8482 8.0804 10.5045 31.0996 Constraint (T0288)C28.CB (T0288)K63.CB 4.4338 7.3896 9.6065 30.9998 Constraint (T0288)Q26.CB (T0288)T66.CB 3.8282 6.3803 8.2944 30.1999 Constraint (T0288)S20.CB (T0288)A50.CB 5.1064 8.5107 11.0639 29.9999 Constraint (T0288)L31.CB (T0288)V57.CB 5.1501 8.5835 11.1586 29.9987 Constraint (T0288)L16.CB (T0288)I74.CB 4.8128 8.0214 10.4278 29.7208 Constraint (T0288)I19.CB (T0288)I54.CB 4.9965 8.3275 10.8257 29.6209 Constraint (T0288)V36.CB (T0288)D52.CB 5.1072 8.5121 11.0657 29.5036 Constraint (T0288)A13.CB (T0288)P41.CB 4.5416 7.5693 9.8401 29.1000 Constraint (T0288)A13.CB (T0288)K78.CB 4.6093 7.6822 9.9868 28.9997 Constraint (T0288)C30.CB (T0288)N86.CB 4.8119 8.0199 10.4258 28.1616 Constraint (T0288)R60.CB (T0288)E69.CB 5.0468 8.4114 10.9348 28.0776 Constraint (T0288)T47.CB (T0288)I83.CB 5.0600 8.4333 10.9632 27.9998 Constraint (T0288)Y32.CB (T0288)L88.CB 4.6638 7.7730 10.1049 26.9998 Constraint (T0288)Y27.CB (T0288)T66.CB 4.6543 7.7572 10.0844 26.1000 Constraint (T0288)D12.CB (T0288)E80.CB 4.5733 7.6222 9.9088 25.1000 Constraint (T0288)M2.CB (T0288)N86.CB 3.9939 6.6564 8.6534 24.1999 Constraint (T0288)I19.CB (T0288)I83.CB 5.0343 8.3905 10.9076 23.9999 Constraint (T0288)V57.CB (T0288)E76.CB 5.1721 8.6202 11.2062 23.6210 Constraint (T0288)Q14.CB (T0288)T40.CB 4.3258 7.2097 9.3726 23.2000 Constraint (T0288)M2.CB (T0288)K87.CB 3.7402 6.2336 8.1037 23.1998 Constraint (T0288)R60.CB (T0288)V70.CB 4.6179 7.6965 10.0054 22.9878 Constraint (T0288)P29.CB (T0288)K65.CB 4.7834 7.9723 10.3640 21.9999 Constraint (T0288)L31.CB (T0288)I74.CB 4.9910 8.3184 10.8139 21.3000 Constraint (T0288)A25.CB (T0288)K65.CB 4.0055 6.6758 8.6785 21.3000 Constraint (T0288)R60.CB (T0288)V77.CB 4.9530 8.2550 10.7315 21.2999 Constraint (T0288)A49.CB (T0288)L88.CB 4.2265 7.0441 9.1573 21.1997 Constraint (T0288)I33.CB (T0288)I83.CB 5.2124 8.6873 11.2935 20.9999 Constraint (T0288)L9.CB (T0288)V77.CB 5.0505 8.4176 10.9428 20.9998 Constraint (T0288)D12.CB (T0288)K78.CB 4.4401 7.4002 9.6202 20.9998 Constraint (T0288)V57.CB (T0288)E69.CB 5.0004 8.3340 10.8342 20.9144 Constraint (T0288)C30.CB (T0288)V70.CB 4.4306 7.3843 9.5995 20.7212 Constraint (T0288)Q14.CB (T0288)P41.CB 4.0332 6.7219 8.7385 20.2000 Constraint (T0288)Q26.CB (T0288)K67.CB 4.0654 6.7756 8.8083 19.2000 Constraint (T0288)P29.CB (T0288)K67.CB 4.9695 8.2825 10.7673 19.1999 Constraint (T0288)K6.CB (T0288)T47.CB 4.7708 7.9514 10.3368 19.1000 Constraint (T0288)K11.CB (T0288)T40.CB 4.7990 7.9983 10.3978 19.0000 Constraint (T0288)Y27.CB (T0288)K63.CB 4.6026 7.6711 9.9724 18.9999 Constraint (T0288)A25.CB (T0288)E69.CB 5.0053 8.3422 10.8449 18.3000 Constraint (T0288)I17.CB (T0288)D45.CB 5.2895 8.8158 11.4605 17.9999 Constraint (T0288)I21.CB (T0288)I62.CB 4.7289 7.8814 10.2458 17.9996 Constraint (T0288)P29.CB (T0288)T66.CB 4.5513 7.5855 9.8612 17.9878 Constraint (T0288)I54.CB (T0288)M73.CB 5.2652 8.7753 11.4079 17.6209 Constraint (T0288)N15.CB (T0288)I74.CB 4.5822 7.6370 9.9281 16.1998 Constraint (T0288)C30.CB (T0288)K67.CB 4.0982 6.8304 8.8795 15.7213 Constraint (T0288)Y27.CB (T0288)K67.CB 3.8264 6.3774 8.2906 15.1000 Constraint (T0288)D12.CB (T0288)V81.CB 4.2546 7.0911 9.2184 15.1000 Constraint (T0288)Q10.CB (T0288)T82.CB 4.3201 7.2002 9.3603 15.0999 Constraint (T0288)N15.CB (T0288)V77.CB 4.0070 6.6783 8.6818 14.9999 Constraint (T0288)Y32.CB (T0288)Y85.CB 5.0543 8.4238 10.9510 14.9998 Constraint (T0288)N15.CB (T0288)A42.CB 5.3024 8.8373 11.4885 14.2000 Constraint (T0288)K6.CB (T0288)K87.CB 4.5817 7.6361 9.9270 14.0999 Constraint (T0288)T8.CB (T0288)Y85.CB 3.9650 6.6083 8.5908 14.0999 Constraint (T0288)L16.CB (T0288)Q75.CB 4.5324 7.5539 9.8201 14.0997 Constraint (T0288)P29.CB (T0288)I62.CB 4.4733 7.4556 9.6922 13.6895 Constraint (T0288)C30.CB (T0288)L88.CB 4.6555 7.7592 10.0869 13.2748 Constraint (T0288)V36.CB (T0288)D45.CB 4.8687 8.1145 10.5489 13.2035 Constraint (T0288)Q14.CB (T0288)F37.CB 4.8731 8.1219 10.5584 13.2000 Constraint (T0288)Q10.CB (T0288)I83.CB 4.1970 6.9951 9.0936 13.0999 Constraint (T0288)Q10.CB (T0288)A42.CB 4.1262 6.8769 8.9400 13.0999 Constraint (T0288)P29.CB (T0288)T55.CB 4.1419 6.9031 8.9741 13.0786 Constraint (T0288)K11.CB (T0288)A42.CB 4.7029 7.8381 10.1896 13.0000 Constraint (T0288)Y27.CB (T0288)K65.CB 4.3178 7.1964 9.3553 13.0000 Constraint (T0288)C28.CB (T0288)K65.CB 4.7217 7.8695 10.2304 12.9999 Constraint (T0288)A50.CB (T0288)L88.CB 4.5748 7.6246 9.9120 12.9997 Constraint (T0288)V48.CB (T0288)K87.CB 5.0227 8.3711 10.8824 12.6010 Constraint (T0288)K11.CB (T0288)D45.CB 4.7869 7.9781 10.3716 12.1000 Constraint (T0288)T8.CB (T0288)V48.CB 3.7938 6.3229 8.2198 12.1000 Constraint (T0288)K6.CB (T0288)N86.CB 4.3163 7.1938 9.3520 12.1000 Constraint (T0288)T8.CB (T0288)H84.CB 4.5361 7.5602 9.8283 12.0999 Constraint (T0288)P29.CB (T0288)E53.CB 4.1724 6.9539 9.0401 12.0907 Constraint (T0288)M73.CB (T0288)I83.CB 5.1498 8.5830 11.1579 12.0115 Constraint (T0288)Q26.CB (T0288)V68.CB 4.6122 7.6870 9.9930 12.0000 Constraint (T0288)A42.CB (T0288)V81.CB 5.2715 8.7858 11.4216 12.0000 Constraint (T0288)K11.CB (T0288)L44.CB 5.0429 8.4048 10.9263 12.0000 Constraint (T0288)R60.CB (T0288)E76.CB 5.0525 8.4208 10.9470 12.0000 Constraint (T0288)A42.CB (T0288)D52.CB 5.2530 8.7550 11.3814 11.9999 Constraint (T0288)A25.CB (T0288)V68.CB 4.3467 7.2445 9.4179 11.9999 Constraint (T0288)C30.CB (T0288)T66.CB 4.2329 7.0548 9.1713 11.9998 Constraint (T0288)S20.CB (T0288)A71.CB 4.6135 7.6891 9.9959 11.9996 Constraint (T0288)C28.CB (T0288)E53.CB 4.3746 7.2910 9.4783 11.1012 Constraint (T0288)Q10.CB (T0288)V48.CB 4.6723 7.7872 10.1233 11.1000 Constraint (T0288)M2.CB (T0288)L88.CB 3.7855 6.3092 8.2019 11.0999 Constraint (T0288)D12.CB (T0288)V77.CB 4.5568 7.5947 9.8731 11.0000 Constraint (T0288)L16.CB (T0288)V77.CB 4.5764 7.6274 9.9156 11.0000 Constraint (T0288)Q10.CB (T0288)T47.CB 4.8828 8.1381 10.5795 10.9999 Constraint (T0288)A13.CB (T0288)E80.CB 4.2018 7.0029 9.1038 10.9999 Constraint (T0288)E53.CB (T0288)Q89.CB 4.5530 7.5884 9.8649 10.4010 Constraint (T0288)T8.CB (T0288)A42.CB 4.8583 8.0971 10.5262 10.1000 Constraint (T0288)N15.CB (T0288)N39.CB 4.5202 7.5336 9.7937 10.1000 Constraint (T0288)L16.CB (T0288)V81.CB 5.3081 8.8468 11.5009 10.1000 Constraint (T0288)P29.CB (T0288)S61.CB 4.7067 7.8445 10.1979 10.0786 Constraint (T0288)Q14.CB (T0288)K78.CB 4.6812 7.8020 10.1426 10.0000 Constraint (T0288)V3.CB (T0288)Y85.CB 4.8342 8.0570 10.4742 10.0000 Constraint (T0288)T8.CB (T0288)P41.CB 5.1254 8.5424 11.1051 10.0000 Constraint (T0288)I33.CB (T0288)L88.CB 5.1019 8.5031 11.0540 9.9998 Constraint (T0288)V70.CB (T0288)I83.CB 5.0539 8.4232 10.9501 9.9394 Constraint (T0288)I17.CB (T0288)V57.CB 4.8935 8.1559 10.6026 9.7000 Constraint (T0288)C28.CB (T0288)T55.CB 4.4664 7.4439 9.6771 9.3785 Constraint (T0288)T47.CB (T0288)K87.CB 4.6654 7.7757 10.1084 9.2000 Constraint (T0288)V3.CB (T0288)L88.CB 4.6256 7.7093 10.0221 9.1999 Constraint (T0288)K6.CB (T0288)D52.CB 4.9147 8.1911 10.6485 9.1000 Constraint (T0288)A13.CB (T0288)T40.CB 4.7263 7.8772 10.2403 9.1000 Constraint (T0288)A25.CB (T0288)K63.CB 4.3003 7.1672 9.3174 9.0000 Constraint (T0288)P41.CB (T0288)E80.CB 5.2747 8.7911 11.4285 9.0000 Constraint (T0288)S20.CB (T0288)Y32.CB 5.2477 8.7462 11.3701 9.0000 Constraint (T0288)P4.CB (T0288)E53.CB 5.0935 8.4891 11.0358 9.0000 Constraint (T0288)A25.CB (T0288)I62.CB 4.3361 7.2268 9.3949 9.0000 Constraint (T0288)I19.CB (T0288)A49.CB 5.1296 8.5493 11.1142 8.9999 Constraint (T0288)Q10.CB (T0288)K78.CB 4.6582 7.7637 10.0928 8.9999 Constraint (T0288)I21.CB (T0288)E53.CB 5.3269 8.8782 11.5417 8.9999 Constraint (T0288)R60.CB (T0288)I74.CB 3.9540 6.5900 8.5670 8.9999 Constraint (T0288)I21.CB (T0288)V57.CB 4.9294 8.2156 10.6803 8.9996 Constraint (T0288)K11.CB (T0288)I74.CB 4.8843 8.1404 10.5826 8.9996 Constraint (T0288)Y32.CB (T0288)K67.CB 4.6529 7.7548 10.0813 8.7325 Constraint (T0288)E53.CB (T0288)H84.CB 5.2675 8.7791 11.4129 8.6741 Constraint (T0288)C30.CB (T0288)E69.CB 4.9158 8.1930 10.6509 8.6210 Constraint (T0288)C30.CB (T0288)S61.CB 5.0112 8.3520 10.8576 8.2813 Constraint (T0288)D52.CB (T0288)Q89.CB 4.8471 8.0785 10.5021 8.1011 Constraint (T0288)M2.CB (T0288)Q89.CB 4.5443 7.5738 9.8459 8.1000 Constraint (T0288)Q10.CB (T0288)T40.CB 4.5411 7.5685 9.8391 8.1000 Constraint (T0288)K6.CB (T0288)T55.CB 5.2765 8.7941 11.4324 8.0000 Constraint (T0288)Q26.CB (T0288)E69.CB 5.2048 8.6746 11.2770 8.0000 Constraint (T0288)A13.CB (T0288)V77.CB 4.4822 7.4704 9.7115 8.0000 Constraint (T0288)N15.CB (T0288)K78.CB 4.7259 7.8766 10.2395 8.0000 Constraint (T0288)A13.CB (T0288)V81.CB 4.0772 6.7954 8.8340 8.0000 Constraint (T0288)V7.CB (T0288)A49.CB 5.0059 8.3431 10.8461 8.0000 Constraint (T0288)A25.CB (T0288)V70.CB 4.8916 8.1527 10.5985 8.0000 Constraint (T0288)Y32.CB (T0288)N86.CB 5.1551 8.5918 11.1693 7.9997 Constraint (T0288)N58.CB (T0288)H84.CB 4.5182 7.5304 9.7895 7.4035 Constraint (T0288)Q14.CB (T0288)N39.CB 4.1280 6.8799 8.9439 7.2000 Constraint (T0288)V3.CB (T0288)Q89.CB 3.8269 6.3781 8.2915 7.1999 Constraint (T0288)M2.CB (T0288)E53.CB 4.6576 7.7627 10.0915 7.1999 Constraint (T0288)C28.CB (T0288)T66.CB 4.1518 6.9197 8.9955 6.9999 Constraint (T0288)L9.CB (T0288)I74.CB 5.3689 8.9482 11.6327 6.9999 Constraint (T0288)K6.CB (T0288)D45.CB 5.2142 8.6904 11.2975 6.9999 Constraint (T0288)L16.CB (T0288)A71.CB 4.8034 8.0057 10.4074 6.9998 Constraint (T0288)Q14.CB (T0288)Q75.CB 4.6396 7.7327 10.0525 6.9998 Constraint (T0288)D12.CB (T0288)L44.CB 4.9667 8.2779 10.7612 6.2000 Constraint (T0288)T8.CB (T0288)D52.CB 5.1249 8.5414 11.1039 6.1000 Constraint (T0288)Y27.CB (T0288)E53.CB 4.0398 6.7330 8.7529 6.0907 Constraint (T0288)D12.CB (T0288)A42.CB 5.1569 8.5948 11.1733 6.0000 Constraint (T0288)S20.CB (T0288)A42.CB 5.3713 8.9521 11.6377 6.0000 Constraint (T0288)N15.CB (T0288)V81.CB 5.0488 8.4146 10.9390 6.0000 Constraint (T0288)Q10.CB (T0288)I19.CB 4.9901 8.3168 10.8118 6.0000 Constraint (T0288)C30.CB (T0288)A71.CB 5.1208 8.5346 11.0950 6.0000 Constraint (T0288)C30.CB (T0288)V68.CB 5.1636 8.6061 11.1879 6.0000 Constraint (T0288)R60.CB (T0288)K72.CB 4.9004 8.1674 10.6176 6.0000 Constraint (T0288)R60.CB (T0288)I83.CB 5.2810 8.8016 11.4421 5.9999 Constraint (T0288)I62.CB (T0288)A71.CB 4.9448 8.2413 10.7137 5.9999 Constraint (T0288)S61.CB (T0288)V70.CB 4.6043 7.6738 9.9760 5.9999 Constraint (T0288)R60.CB (T0288)A71.CB 4.7761 7.9602 10.3483 5.9999 Constraint (T0288)L9.CB (T0288)N58.CB 4.5933 7.6556 9.9522 5.9999 Constraint (T0288)V7.CB (T0288)I54.CB 4.9510 8.2516 10.7271 5.9998 Constraint (T0288)Q26.CB (T0288)K63.CB 3.4953 5.8254 7.5731 5.9998 Constraint (T0288)D45.CB (T0288)V81.CB 5.0775 8.4625 11.0013 5.9893 Constraint (T0288)L31.CB (T0288)V68.CB 4.8789 8.1315 10.5710 5.9249 Constraint (T0288)I54.CB (T0288)E69.CB 5.1365 8.5609 11.1291 5.6105 Constraint (T0288)C30.CB (T0288)Y85.CB 4.7123 7.8538 10.2099 5.5607 Constraint (T0288)K6.CB (T0288)V48.CB 4.9558 8.2596 10.7375 5.1000 Constraint (T0288)A49.CB (T0288)Q89.CB 4.4410 7.4017 9.6222 5.0999 Constraint (T0288)I54.CB (T0288)K67.CB 5.2460 8.7433 11.3663 5.0898 Constraint (T0288)Q14.CB (T0288)L44.CB 5.2861 8.8102 11.4533 5.0000 Constraint (T0288)S1.CB (T0288)K87.CB 4.1607 6.9345 9.0148 5.0000 Constraint (T0288)Q10.CB (T0288)V77.CB 5.1678 8.6129 11.1968 5.0000 Constraint (T0288)P29.CB (T0288)I54.CB 4.0448 6.7414 8.7638 5.0000 Constraint (T0288)P29.CB (T0288)V70.CB 4.9330 8.2217 10.6882 5.0000 Constraint (T0288)A13.CB (T0288)N39.CB 4.3042 7.1737 9.3258 5.0000 Constraint (T0288)C28.CB (T0288)I62.CB 4.7537 7.9228 10.2996 5.0000 Constraint (T0288)M2.CB (T0288)Y85.CB 4.2822 7.1370 9.2781 4.9999 Constraint (T0288)K11.CB (T0288)N58.CB 4.5281 7.5468 9.8109 4.9999 Constraint (T0288)L9.CB (T0288)V57.CB 4.6213 7.7021 10.0128 4.9999 Constraint (T0288)M2.CB (T0288)T55.CB 5.1030 8.5050 11.0565 4.9999 Constraint (T0288)E53.CB (T0288)Y90.CB 4.8727 8.1212 10.5576 4.9998 Constraint (T0288)K11.CB (T0288)Q75.CB 4.7435 7.9058 10.2776 4.9998 Constraint (T0288)C30.CB (T0288)D52.CB 5.1270 8.5449 11.1084 4.7214 Constraint (T0288)T55.CB (T0288)K87.CB 4.3542 7.2570 9.4341 4.2748 Constraint (T0288)A42.CB (T0288)Y85.CB 4.9786 8.2976 10.7869 4.2107 Constraint (T0288)Q35.CB (T0288)A49.CB 5.2829 8.8048 11.4462 4.2035 Constraint (T0288)D12.CB (T0288)N39.CB 5.2047 8.6746 11.2769 4.2000 Constraint (T0288)I62.CB (T0288)Y85.CB 5.2027 8.6712 11.2726 4.1485 Constraint (T0288)C28.CB (T0288)K67.CB 3.8704 6.4507 8.3859 4.1000 Constraint (T0288)V7.CB (T0288)K87.CB 4.1638 6.9397 9.0215 4.1000 Constraint (T0288)P4.CB (T0288)L88.CB 3.8807 6.4679 8.4082 4.1000 Constraint (T0288)V34.CB (T0288)K67.CB 4.7975 7.9958 10.3946 4.0108 Constraint (T0288)P4.CB (T0288)I83.CB 5.2905 8.8174 11.4627 4.0000 Constraint (T0288)Q26.CB (T0288)E53.CB 4.0222 6.7036 8.7147 4.0000 Constraint (T0288)Q14.CB (T0288)V77.CB 4.7110 7.8517 10.2072 4.0000 Constraint (T0288)C28.CB (T0288)V70.CB 5.0020 8.3366 10.8376 4.0000 Constraint (T0288)K11.CB (T0288)T82.CB 4.7367 7.8946 10.2629 4.0000 Constraint (T0288)S1.CB (T0288)L88.CB 4.4402 7.4004 9.6205 4.0000 Constraint (T0288)A50.CB (T0288)Y85.CB 4.4713 7.4521 9.6877 3.9999 Constraint (T0288)A50.CB (T0288)K87.CB 4.3810 7.3016 9.4921 3.9998 Constraint (T0288)Q26.CB (T0288)K65.CB 4.6527 7.7545 10.0809 3.9998 Constraint (T0288)Y32.CB (T0288)K87.CB 4.6833 7.8056 10.1472 3.9997 Constraint (T0288)A25.CB (T0288)L88.CB 4.4111 7.3519 9.5574 3.9930 Constraint (T0288)Q26.CB (T0288)N86.CB 5.1559 8.5931 11.1710 3.9930 Constraint (T0288)Y27.CB (T0288)T55.CB 4.3217 7.2028 9.3636 3.6896 Constraint (T0288)D45.CB (T0288)T82.CB 5.3456 8.9093 11.5820 3.3369 Constraint (T0288)I17.CB (T0288)A71.CB 5.3494 8.9157 11.5904 3.3212 Constraint (T0288)I17.CB (T0288)V70.CB 4.5057 7.5096 9.7625 3.3212 Constraint (T0288)I17.CB (T0288)I54.CB 5.3578 8.9297 11.6086 3.3212 Constraint (T0288)T55.CB (T0288)L88.CB 3.3267 5.5444 7.2078 3.2748 Constraint (T0288)I54.CB (T0288)K87.CB 3.9531 6.5885 8.5650 3.2748 Constraint (T0288)I33.CB (T0288)K87.CB 4.8788 8.1313 10.5707 3.2748 Constraint (T0288)D45.CB (T0288)Y85.CB 5.0743 8.4572 10.9943 3.1394 Constraint (T0288)I33.CB (T0288)K67.CB 5.1572 8.5953 11.1738 3.1115 Constraint (T0288)P4.CB (T0288)Q89.CB 3.6755 6.1259 7.9637 3.1000 Constraint (T0288)V36.CB (T0288)T47.CB 4.8804 8.1340 10.5742 3.0000 Constraint (T0288)L31.CB (T0288)M73.CB 5.3779 8.9631 11.6520 3.0000 Constraint (T0288)S1.CB (T0288)N86.CB 4.6937 7.8228 10.1697 3.0000 Constraint (T0288)M2.CB (T0288)Y90.CB 4.0301 6.7169 8.7319 3.0000 Constraint (T0288)Y27.CB (T0288)E69.CB 5.3288 8.8813 11.5457 3.0000 Constraint (T0288)Q26.CB (T0288)I62.CB 4.6664 7.7773 10.1104 3.0000 Constraint (T0288)I17.CB (T0288)T47.CB 5.3715 8.9526 11.6383 3.0000 Constraint (T0288)P41.CB (T0288)I83.CB 5.3614 8.9357 11.6165 3.0000 Constraint (T0288)I19.CB (T0288)A71.CB 5.1084 8.5140 11.0682 3.0000 Constraint (T0288)I17.CB (T0288)V36.CB 5.3185 8.8642 11.5235 3.0000 Constraint (T0288)L16.CB (T0288)N39.CB 5.1613 8.6022 11.1829 3.0000 Constraint (T0288)K11.CB (T0288)V48.CB 4.7769 7.9614 10.3499 3.0000 Constraint (T0288)I17.CB (T0288)K78.CB 3.4214 5.7023 7.4130 3.0000 Constraint (T0288)L16.CB (T0288)K78.CB 4.9715 8.2858 10.7715 3.0000 Constraint (T0288)F37.CB (T0288)V48.CB 4.7810 7.9683 10.3587 3.0000 Constraint (T0288)I19.CB (T0288)V81.CB 5.1058 8.5096 11.0625 3.0000 Constraint (T0288)I19.CB (T0288)D45.CB 4.8561 8.0935 10.5215 3.0000 Constraint (T0288)Q14.CB (T0288)E80.CB 5.1908 8.6513 11.2467 3.0000 Constraint (T0288)E53.CB (T0288)Y91.CB 4.2029 7.0048 9.1063 3.0000 Constraint (T0288)P29.CB (T0288)E69.CB 5.3577 8.9295 11.6083 3.0000 Constraint (T0288)I17.CB (T0288)E80.CB 5.2571 8.7619 11.3904 3.0000 Constraint (T0288)P29.CB (T0288)N86.CB 4.4773 7.4622 9.7008 3.0000 Constraint (T0288)C28.CB (T0288)N86.CB 4.2377 7.0629 9.1817 3.0000 Constraint (T0288)L9.CB (T0288)Y85.CB 3.6926 6.1544 8.0007 3.0000 Constraint (T0288)K11.CB (T0288)I83.CB 4.2182 7.0303 9.1394 3.0000 Constraint (T0288)S61.CB (T0288)M73.CB 5.1019 8.5032 11.0542 3.0000 Constraint (T0288)V57.CB (T0288)A71.CB 5.1637 8.6062 11.1880 3.0000 Constraint (T0288)A49.CB (T0288)I83.CB 5.3425 8.9041 11.5753 3.0000 Constraint (T0288)Y32.CB (T0288)I62.CB 5.1393 8.5655 11.1351 3.0000 Constraint (T0288)I21.CB (T0288)R60.CB 5.2163 8.6938 11.3019 3.0000 Constraint (T0288)I17.CB (T0288)N58.CB 4.4121 7.3535 9.5596 3.0000 Constraint (T0288)T8.CB (T0288)L44.CB 4.7275 7.8792 10.2430 3.0000 Constraint (T0288)V3.CB (T0288)Y91.CB 4.1335 6.8891 8.9559 2.9999 Constraint (T0288)N58.CB (T0288)V70.CB 5.0787 8.4646 11.0039 2.9999 Constraint (T0288)A42.CB (T0288)I54.CB 4.9647 8.2745 10.7568 2.9999 Constraint (T0288)Y32.CB (T0288)T55.CB 5.0985 8.4975 11.0468 2.9999 Constraint (T0288)L31.CB (T0288)S61.CB 5.2164 8.6939 11.3021 2.9999 Constraint (T0288)I19.CB (T0288)N39.CB 5.1431 8.5718 11.1433 2.9999 Constraint (T0288)I19.CB (T0288)D38.CB 5.0115 8.3526 10.8584 2.9999 Constraint (T0288)I17.CB (T0288)D38.CB 5.2274 8.7124 11.3261 2.9999 Constraint (T0288)L16.CB (T0288)D38.CB 3.5772 5.9621 7.7507 2.9999 Constraint (T0288)D12.CB (T0288)D38.CB 4.0713 6.7856 8.8212 2.9999 Constraint (T0288)D12.CB (T0288)F37.CB 5.1788 8.6313 11.2207 2.9999 Constraint (T0288)V7.CB (T0288)V57.CB 4.7243 7.8738 10.2360 2.9999 Constraint (T0288)V7.CB (T0288)E53.CB 5.3146 8.8576 11.5149 2.9999 Constraint (T0288)K63.CB (T0288)N86.CB 5.0380 8.3966 10.9156 2.9999 Constraint (T0288)M2.CB (T0288)D52.CB 5.0366 8.3943 10.9126 2.9999 Constraint (T0288)I21.CB (T0288)M73.CB 5.1313 8.5521 11.1177 2.9998 Constraint (T0288)I21.CB (T0288)K65.CB 4.8215 8.0358 10.4466 2.9998 Constraint (T0288)S20.CB (T0288)V70.CB 5.3130 8.8550 11.5115 2.9998 Constraint (T0288)S20.CB (T0288)K67.CB 4.9039 8.1731 10.6251 2.9998 Constraint (T0288)V70.CB (T0288)V81.CB 4.7902 7.9836 10.3787 2.9894 Constraint (T0288)V57.CB (T0288)K72.CB 5.3076 8.8460 11.4998 2.9894 Constraint (T0288)A25.CB (T0288)E53.CB 3.1404 5.2340 6.8042 2.9894 Constraint (T0288)A25.CB (T0288)D52.CB 5.2095 8.6825 11.2873 2.9894 Constraint (T0288)C28.CB (T0288)S61.CB 4.8905 8.1509 10.5962 2.9879 Constraint (T0288)T55.CB (T0288)Q89.CB 4.7771 7.9618 10.3503 2.8676 Constraint (T0288)I62.CB (T0288)K72.CB 5.3830 8.9717 11.6632 2.6210 Constraint (T0288)I21.CB (T0288)V68.CB 5.2050 8.6750 11.2775 2.6210 Constraint (T0288)I21.CB (T0288)C30.CB 5.3165 8.8609 11.5192 2.6210 Constraint (T0288)I19.CB (T0288)V70.CB 4.8856 8.1427 10.5855 2.6210 Constraint (T0288)I19.CB (T0288)L31.CB 4.9391 8.2318 10.7014 2.6210 Constraint (T0288)I17.CB (T0288)M73.CB 5.3666 8.9443 11.6275 2.6210 Constraint (T0288)N58.CB (T0288)Y85.CB 4.8479 8.0799 10.5038 2.6118 Constraint (T0288)V57.CB (T0288)Y85.CB 3.4744 5.7907 7.5279 2.6118 Constraint (T0288)V48.CB (T0288)Q89.CB 5.0350 8.3917 10.9092 2.4383 Constraint (T0288)V57.CB (T0288)N86.CB 4.7359 7.8932 10.2612 2.2748 Constraint (T0288)I54.CB (T0288)L88.CB 4.6423 7.7372 10.0583 2.2748 Constraint (T0288)F37.CB (T0288)A50.CB 4.1301 6.8835 8.9486 2.2146 Constraint (T0288)D52.CB (T0288)Y90.CB 4.3589 7.2648 9.4443 2.1013 Constraint (T0288)A13.CB (T0288)L44.CB 5.3619 8.9365 11.6175 2.1000 Constraint (T0288)A49.CB (T0288)Y91.CB 4.2815 7.1358 9.2766 2.1000 Constraint (T0288)Y27.CB (T0288)V70.CB 5.0699 8.4499 10.9848 2.0000 Constraint (T0288)Q14.CB (T0288)A43.CB 5.3049 8.8415 11.4939 2.0000 Constraint (T0288)Q14.CB (T0288)D38.CB 5.2079 8.6798 11.2837 2.0000 Constraint (T0288)V3.CB (T0288)D52.CB 5.3860 8.9767 11.6697 2.0000 Constraint (T0288)S1.CB (T0288)Q89.CB 4.1122 6.8537 8.9099 2.0000 Constraint (T0288)V3.CB (T0288)T55.CB 4.6611 7.7684 10.0990 2.0000 Constraint (T0288)A49.CB (T0288)Y90.CB 4.7989 7.9981 10.3975 2.0000 Constraint (T0288)L9.CB (T0288)K78.CB 4.8764 8.1273 10.5654 2.0000 Constraint (T0288)D12.CB (T0288)D45.CB 4.6690 7.7816 10.1161 2.0000 Constraint (T0288)C28.CB (T0288)E69.CB 4.7575 7.9291 10.3078 2.0000 Constraint (T0288)C28.CB (T0288)V68.CB 4.7429 7.9049 10.2763 2.0000 Constraint (T0288)K63.CB (T0288)V93.CB 3.6288 6.0480 7.8624 2.0000 Constraint (T0288)T55.CB (T0288)V93.CB 4.6539 7.7565 10.0835 2.0000 Constraint (T0288)T55.CB (T0288)Y91.CB 5.1818 8.6364 11.2273 2.0000 Constraint (T0288)Q14.CB (T0288)I74.CB 5.1989 8.6648 11.2643 2.0000 Constraint (T0288)C28.CB (T0288)I54.CB 4.1099 6.8498 8.9048 2.0000 Constraint (T0288)Y27.CB (T0288)I62.CB 5.2215 8.7025 11.3132 2.0000 Constraint (T0288)K11.CB (T0288)T47.CB 4.6062 7.6770 9.9800 2.0000 Constraint (T0288)Q10.CB (T0288)I74.CB 5.3479 8.9132 11.5872 2.0000 Constraint (T0288)M2.CB (T0288)Y91.CB 4.4562 7.4269 9.6550 2.0000 Constraint (T0288)K6.CB (T0288)A49.CB 4.8171 8.0285 10.4370 2.0000 Constraint (T0288)A43.CB (T0288)E80.CB 5.3503 8.9171 11.5922 2.0000 Constraint (T0288)N15.CB (T0288)A71.CB 4.5150 7.5249 9.7824 2.0000 Constraint (T0288)A13.CB (T0288)F37.CB 3.9661 6.6101 8.5931 2.0000 Constraint (T0288)Q10.CB (T0288)A43.CB 4.3053 7.1754 9.3280 2.0000 Constraint (T0288)T8.CB (T0288)N58.CB 4.2124 7.0207 9.1269 2.0000 Constraint (T0288)T8.CB (T0288)A43.CB 4.9648 8.2746 10.7570 2.0000 Constraint (T0288)V7.CB (T0288)L44.CB 4.6170 7.6951 10.0036 2.0000 Constraint (T0288)V7.CB (T0288)P41.CB 5.0212 8.3687 10.8793 2.0000 Constraint (T0288)V7.CB (T0288)N86.CB 4.1158 6.8597 8.9176 2.0000 Constraint (T0288)L9.CB (T0288)H84.CB 4.6346 7.7244 10.0417 2.0000 Constraint (T0288)P4.CB (T0288)Y91.CB 4.4012 7.3353 9.5359 2.0000 Constraint (T0288)V3.CB (T0288)Y90.CB 3.4970 5.8283 7.5768 2.0000 Constraint (T0288)Y32.CB (T0288)Q89.CB 5.3756 8.9593 11.6471 1.9998 Constraint (T0288)Y27.CB (T0288)N86.CB 3.4494 5.7490 7.4737 1.9930 Constraint (T0288)Q26.CB (T0288)Q89.CB 5.0100 8.3500 10.8550 1.9930 Constraint (T0288)Q26.CB (T0288)L88.CB 5.1879 8.6465 11.2404 1.9930 Constraint (T0288)A25.CB (T0288)Q89.CB 4.7578 7.9296 10.3085 1.9930 Constraint (T0288)A25.CB (T0288)K87.CB 4.4998 7.4996 9.7495 1.9930 Constraint (T0288)A25.CB (T0288)N86.CB 2.6143 4.3572 5.6644 1.9930 Constraint (T0288)Q14.CB (T0288)A25.CB 5.0547 8.4245 10.9519 1.9930 Constraint (T0288)A13.CB (T0288)Q26.CB 4.0378 6.7297 8.7486 1.9930 Constraint (T0288)A13.CB (T0288)A25.CB 5.0569 8.4282 10.9567 1.9930 Constraint (T0288)I17.CB (T0288)Y85.CB 5.0719 8.4532 10.9892 1.8736 Constraint (T0288)A49.CB (T0288)N86.CB 4.4723 7.4539 9.6900 1.8001 Constraint (T0288)I62.CB (T0288)N86.CB 4.9902 8.3171 10.8122 1.6119 Constraint (T0288)C28.CB (T0288)L88.CB 4.3606 7.2677 9.4479 1.4012 Constraint (T0288)Y27.CB (T0288)L88.CB 4.5901 7.6502 9.9453 1.4012 Constraint (T0288)S61.CB (T0288)N86.CB 4.9497 8.2495 10.7244 1.4011 Constraint (T0288)L31.CB (T0288)N86.CB 4.9943 8.3238 10.8210 1.4011 Constraint (T0288)D45.CB (T0288)Q89.CB 4.5956 7.6593 9.9571 1.3370 Constraint (T0288)V70.CB (T0288)Y85.CB 5.2219 8.7032 11.3141 1.2748 Constraint (T0288)T55.CB (T0288)V70.CB 5.3090 8.8483 11.5028 1.2035 Constraint (T0288)V34.CB (T0288)D52.CB 5.3232 8.8720 11.5335 1.2035 Constraint (T0288)I33.CB (T0288)V70.CB 5.0499 8.4165 10.9414 1.2035 Constraint (T0288)I33.CB (T0288)K65.CB 4.7755 7.9591 10.3468 1.2035 Constraint (T0288)Y32.CB (T0288)K65.CB 3.7141 6.1901 8.0471 1.2035 Constraint (T0288)V48.CB (T0288)Y90.CB 4.9919 8.3198 10.8157 1.1013 Constraint (T0288)V3.CB (T0288)E53.CB 5.1884 8.6473 11.2415 1.1000 Constraint (T0288)A50.CB (T0288)Q89.CB 3.5178 5.8630 7.6219 1.0999 Constraint (T0288)T82.CB (T0288)Y91.CB 4.3080 7.1800 9.3340 1.0372 Constraint (T0288)V48.CB (T0288)Y91.CB 4.1850 6.9751 9.0676 1.0372 Constraint (T0288)D45.CB (T0288)Y91.CB 3.3099 5.5165 7.1715 1.0372 Constraint (T0288)A42.CB (T0288)Y91.CB 4.8691 8.1152 10.5498 1.0372 Constraint (T0288)V36.CB (T0288)I54.CB 5.2717 8.7862 11.4221 1.0111 Constraint (T0288)D52.CB (T0288)V93.CB 5.3372 8.8954 11.5640 1.0000 Constraint (T0288)A49.CB (T0288)V93.CB 5.3418 8.9031 11.5740 1.0000 Constraint (T0288)P29.CB (T0288)Y85.CB 5.1021 8.5035 11.0546 1.0000 Constraint (T0288)P29.CB (T0288)D52.CB 5.3546 8.9244 11.6017 1.0000 Constraint (T0288)N15.CB (T0288)L44.CB 5.2323 8.7204 11.3366 1.0000 Constraint (T0288)N15.CB (T0288)A43.CB 5.2495 8.7492 11.3740 1.0000 Constraint (T0288)N15.CB (T0288)D38.CB 5.2173 8.6955 11.3042 1.0000 Constraint (T0288)L9.CB (T0288)D52.CB 4.9232 8.2054 10.6670 1.0000 Constraint (T0288)P4.CB (T0288)V93.CB 4.7749 7.9582 10.3457 1.0000 Constraint (T0288)S1.CB (T0288)Y90.CB 4.8922 8.1536 10.5997 1.0000 Constraint (T0288)S1.CB (T0288)Y85.CB 2.7665 4.6108 5.9940 1.0000 Constraint (T0288)Q26.CB (T0288)V70.CB 4.1861 6.9768 9.0698 1.0000 Constraint (T0288)T8.CB (T0288)T55.CB 5.3464 8.9107 11.5839 1.0000 Constraint (T0288)T8.CB (T0288)K78.CB 4.9792 8.2987 10.7883 1.0000 Constraint (T0288)T8.CB (T0288)I17.CB 3.8699 6.4499 8.3848 1.0000 Constraint (T0288)V7.CB (T0288)E80.CB 4.8129 8.0215 10.4279 1.0000 Constraint (T0288)K6.CB (T0288)V81.CB 4.6831 7.8052 10.1468 1.0000 Constraint (T0288)K6.CB (T0288)A42.CB 5.3493 8.9155 11.5901 1.0000 Constraint (T0288)P4.CB (T0288)D52.CB 4.7576 7.9294 10.3082 1.0000 Constraint (T0288)P4.CB (T0288)V48.CB 5.2026 8.6710 11.2723 1.0000 Constraint (T0288)P4.CB (T0288)T47.CB 4.1099 6.8498 8.9047 1.0000 Constraint (T0288)V3.CB (T0288)H84.CB 3.7585 6.2642 8.1434 1.0000 Constraint (T0288)D52.CB (T0288)Y91.CB 4.9149 8.1914 10.6489 1.0000 Constraint (T0288)Y32.CB (T0288)Y91.CB 5.0531 8.4218 10.9484 1.0000 Constraint (T0288)Y32.CB (T0288)Y90.CB 5.2384 8.7306 11.3498 1.0000 Constraint (T0288)C30.CB (T0288)Y91.CB 4.5453 7.5754 9.8481 1.0000 Constraint (T0288)C30.CB (T0288)Y90.CB 4.6677 7.7795 10.1133 1.0000 Constraint (T0288)D12.CB (T0288)Q75.CB 5.1660 8.6101 11.1931 1.0000 Constraint (T0288)D12.CB (T0288)I74.CB 4.5243 7.5405 9.8026 1.0000 Constraint (T0288)D12.CB (T0288)N58.CB 3.8578 6.4296 8.3585 1.0000 Constraint (T0288)K11.CB (T0288)A43.CB 4.3008 7.1680 9.3184 1.0000 Constraint (T0288)Q10.CB (T0288)N58.CB 3.7912 6.3186 8.2142 1.0000 Constraint (T0288)Q10.CB (T0288)V57.CB 4.8786 8.1310 10.5703 1.0000 Constraint (T0288)L9.CB (T0288)A43.CB 5.0476 8.4127 10.9365 1.0000 Constraint (T0288)T8.CB (T0288)A49.CB 5.3670 8.9450 11.6285 1.0000 Constraint (T0288)K6.CB (T0288)L88.CB 4.4193 7.3655 9.5751 1.0000 Constraint (T0288)K63.CB (T0288)L88.CB 5.0924 8.4873 11.0335 1.0000 Constraint (T0288)L31.CB (T0288)L88.CB 4.8100 8.0166 10.4216 1.0000 Constraint (T0288)P4.CB (T0288)Y90.CB 3.5853 5.9755 7.7681 1.0000 Constraint (T0288)V3.CB (T0288)K92.CB 5.2406 8.7343 11.3545 1.0000 Constraint (T0288)N15.CB (T0288)E80.CB 5.0348 8.3913 10.9087 0.9999 Constraint (T0288)V57.CB (T0288)K78.CB 4.7708 7.9513 10.3367 0.9965 Constraint (T0288)N15.CB (T0288)E53.CB 4.8664 8.1107 10.5440 0.9965 Constraint (T0288)N15.CB (T0288)Y32.CB 4.9462 8.2436 10.7167 0.9965 Constraint (T0288)N15.CB (T0288)Y27.CB 4.6940 7.8234 10.1704 0.9965 Constraint (T0288)N15.CB (T0288)Q26.CB 4.7324 7.8873 10.2535 0.9965 Constraint (T0288)N15.CB (T0288)A25.CB 3.3744 5.6240 7.3112 0.9965 Constraint (T0288)Q14.CB (T0288)L88.CB 4.2279 7.0466 9.1605 0.9965 Constraint (T0288)A13.CB (T0288)L88.CB 5.0905 8.4842 11.0294 0.9965 Constraint (T0288)K11.CB (T0288)K67.CB 3.2048 5.3413 6.9437 0.9940 Constraint (T0288)K11.CB (T0288)T66.CB 3.6048 6.0080 7.8104 0.9940 Constraint (T0288)K11.CB (T0288)Y32.CB 4.5573 7.5955 9.8742 0.9940 Constraint (T0288)K11.CB (T0288)L31.CB 3.5463 5.9105 7.6837 0.9940 Constraint (T0288)K11.CB (T0288)C30.CB 4.2640 7.1066 9.2386 0.9940 Constraint (T0288)K11.CB (T0288)P29.CB 3.7051 6.1751 8.0276 0.9940 Constraint (T0288)Q10.CB (T0288)K67.CB 3.8915 6.4859 8.4316 0.9940 Constraint (T0288)Q10.CB (T0288)I33.CB 5.2227 8.7046 11.3159 0.9940 Constraint (T0288)Q10.CB (T0288)Y32.CB 3.4423 5.7372 7.4584 0.9940 Constraint (T0288)Q10.CB (T0288)L31.CB 4.2718 7.1197 9.2556 0.9940 Constraint (T0288)L9.CB (T0288)K67.CB 3.8822 6.4704 8.4115 0.9940 Constraint (T0288)L9.CB (T0288)I54.CB 4.2727 7.1212 9.2576 0.9940 Constraint (T0288)L9.CB (T0288)A50.CB 5.3670 8.9450 11.6285 0.9940 Constraint (T0288)L9.CB (T0288)V36.CB 5.3986 8.9976 11.6969 0.9940 Constraint (T0288)L9.CB (T0288)I33.CB 2.3985 3.9975 5.1968 0.9940 Constraint (T0288)L9.CB (T0288)Y32.CB 3.2762 5.4603 7.0984 0.9940 Constraint (T0288)L9.CB (T0288)L31.CB 2.7745 4.6242 6.0115 0.9940 Constraint (T0288)T8.CB (T0288)K67.CB 5.3373 8.8955 11.5642 0.9940 Constraint (T0288)T8.CB (T0288)F37.CB 4.8994 8.1657 10.6154 0.9940 Constraint (T0288)T8.CB (T0288)V36.CB 4.8532 8.0887 10.5153 0.9940 Constraint (T0288)T8.CB (T0288)I33.CB 4.3896 7.3160 9.5108 0.9940 Constraint (T0288)I62.CB (T0288)K87.CB 5.1511 8.5851 11.1607 0.8737 Constraint (T0288)E53.CB (T0288)K92.CB 5.0583 8.4306 10.9597 0.8737 Constraint (T0288)L31.CB (T0288)K87.CB 5.1539 8.5899 11.1668 0.8737 Constraint (T0288)L31.CB (T0288)Y85.CB 5.1309 8.5515 11.1169 0.8737 Constraint (T0288)C30.CB (T0288)K87.CB 4.2657 7.1095 9.2423 0.8737 Constraint (T0288)T55.CB (T0288)Y90.CB 5.2715 8.7859 11.4217 0.7001 Constraint (T0288)I74.CB (T0288)Y85.CB 4.8829 8.1381 10.5795 0.4012 Constraint (T0288)N58.CB (T0288)N86.CB 5.2249 8.7082 11.3206 0.4012 Constraint (T0288)V48.CB (T0288)L88.CB 4.7734 7.9557 10.3424 0.4012 Constraint (T0288)D45.CB (T0288)K87.CB 4.8922 8.1536 10.5997 0.4012 Constraint (T0288)Y27.CB (T0288)Y90.CB 4.9316 8.2193 10.6850 0.4012 Constraint (T0288)V81.CB (T0288)K92.CB 4.9476 8.2460 10.7198 0.3370 Constraint (T0288)V81.CB (T0288)Y91.CB 3.6491 6.0819 7.9065 0.3370 Constraint (T0288)V81.CB (T0288)Y90.CB 4.0030 6.6717 8.6732 0.3370 Constraint (T0288)E80.CB (T0288)K92.CB 2.9601 4.9334 6.4135 0.3370 Constraint (T0288)E80.CB (T0288)Y91.CB 3.9684 6.6139 8.5981 0.3370 Constraint (T0288)E80.CB (T0288)Y90.CB 3.1290 5.2150 6.7795 0.3370 Constraint (T0288)K78.CB (T0288)K92.CB 3.8313 6.3854 8.3011 0.3370 Constraint (T0288)D45.CB (T0288)K92.CB 4.4827 7.4711 9.7124 0.3370 Constraint (T0288)D45.CB (T0288)Y90.CB 3.9715 6.6191 8.6048 0.3370 Constraint (T0288)L44.CB (T0288)K92.CB 4.6590 7.7650 10.0945 0.3370 Constraint (T0288)L44.CB (T0288)Y91.CB 4.6648 7.7747 10.1072 0.3370 Constraint (T0288)P41.CB (T0288)K92.CB 3.4212 5.7020 7.4126 0.3370 Constraint (T0288)P41.CB (T0288)Y91.CB 2.9764 4.9607 6.4490 0.3370 Constraint (T0288)P41.CB (T0288)T82.CB 5.3364 8.8940 11.5622 0.3370 Constraint (T0288)L9.CB (T0288)S20.CB 3.3396 5.5660 7.2358 0.3370 Constraint (T0288)A50.CB (T0288)K92.CB 2.8763 4.7938 6.2319 0.1000 Constraint (T0288)A50.CB (T0288)Y91.CB 4.6961 7.8269 10.1750 0.1000 Constraint (T0288)A49.CB (T0288)K92.CB 4.2682 7.1136 9.2477 0.1000 Constraint (T0288)T8.CB (T0288)K87.CB 5.3309 8.8848 11.5502 0.1000 Constraint (T0288)K92.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y91.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y90.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q89.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L88.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K87.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N86.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y85.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)H84.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I83.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T82.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V81.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E80.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K78.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V77.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E76.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q75.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I74.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M73.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K72.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A71.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V70.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E69.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V68.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K67.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T66.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K65.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K63.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I62.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S61.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)R60.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N58.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V57.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T55.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I54.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)E53.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D52.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A50.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A49.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V48.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T47.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D45.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L44.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A43.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A42.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P41.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T40.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N39.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D38.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)F37.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V36.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q35.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V34.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I33.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y32.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L31.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C30.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P29.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)C28.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Y27.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q26.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A25.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I21.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S20.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I19.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)I17.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L16.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)N15.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q14.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)A13.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)D12.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K11.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)Q10.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)L9.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)N86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)T8.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V7.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Y90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)K6.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)P4.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)V3.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)M2.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Y91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)H84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)S61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)R60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)E53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)F37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Y32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)C30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)C28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Y27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)S20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)I17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)N15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)A13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)D12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)Q10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)L9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)T8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)K6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)P4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)V3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0288)S1.CB (T0288)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: