# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:# Making conformation for sequence T0288 numbered 1 through 93 Created new target T0288 from T0288.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0288/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0288//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0288/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0288 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG # choosing archetypes in rotamer library T0288 17 :IGISIGGGAQYCP 2fneA 1969 :LGFSIVGGYGSPH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 2fneA 1985 :PIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set T0288 2 :MVPGKVTLQKDAQN 2fneA 1955 :PQCKSITLERGPDG T0288 17 :IGISIGGGA 2fneA 1969 :LGFSIVGGY T0288 26 :QYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fneA 1981 :HGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLM T0288 86 :NKLQ 2fneA 2043 :SDET Number of specific fragments extracted= 4 number of extra gaps= 0 total=7 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2fneA)M1954 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETSV Number of specific fragments extracted= 2 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)Y27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)L88 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIHYN 1y8tA 290 :GATVALTFQ T0288 90 :YY 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 78 :KGEVTIH 1y8tA 290 :GATVALT T0288 89 :Q 1y8tA 304 :S Number of specific fragments extracted= 8 number of extra gaps= 4 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0288)A25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0288)Q26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0288)C28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0288)T40 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0288)P41 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0288)L44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0288)G46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0288)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0288)G59 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0288)R60 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0288)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0288)K78 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P289 Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0288)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0288 16 :LIGISIG 1y8tA 230 :SLGVQVT T0288 30 :CLYIVQVFDN 1y8tA 243 :GAKIVEVVAG T0288 42 :AA 1y8tA 255 :AA T0288 49 :AAGDEITGVN 1y8tA 261 :PKGVVVTKVD T0288 62 :IKG 1y8tA 274 :INS T0288 67 :KVEVAKMIQEV 1y8tA 277 :ADALVAAVRSK T0288 80 :EVTIHYNKL 1y8tA 290 :GATVALTFQ T0288 92 :K 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1qauA)N14 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYC 1qauA 15 :VISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 40 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=36 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qauA 90 :ETHVVLI T0288 85 :YNKLQY 1qauA 105 :THLETT Number of specific fragments extracted= 4 number of extra gaps= 0 total=40 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1qauA 15 :VISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIA T0288 79 :GEVTIHYNKLQYYKV 1qauA 91 :THVVLILRGPEGFTT Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0288 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIHYNKLQYY 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=47 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 2 :MVPGKVTLQKDAQN 1i16 28 :ATVCTVTLEKMSAG T0288 17 :IGISIGGGAQYCP 1i16 42 :LGFSLEGGKGSLH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i16 58 :PLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0288 78 :KGEVTIH 1i16 107 :DGPVTIV T0288 85 :YNKLQYYK 1i16 115 :RRKSLQSK Number of specific fragments extracted= 5 number of extra gaps= 0 total=52 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDG T0288 81 :VTIHY 1i16 110 :VTIVI T0288 87 :KLQYYK 1i16 115 :RRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=56 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0288 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0288 6 :KVTL 1v5lA 8 :NVVL T0288 12 :DAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 12 :PGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETR Number of specific fragments extracted= 3 number of extra gaps= 0 total=59 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 4 :PGKVTLQ 1v5lA 6 :SGNVVLP T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 13 :GPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLK T0288 87 :KLQYY 1v5lA 87 :AETRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=63 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0288 10 :QKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1v5lA 10 :VLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAAN T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0288 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1tp5A 323 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNKL 1tp5A 390 :AQYK Number of specific fragments extracted= 4 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 1 :SMVPGKVTLQKDAQN 1tp5A 308 :PREPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1tp5A 323 :LGFNIVGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVT 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0288 85 :YNK 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0288 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 5 number of extra gaps= 1 total=80 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 1 :SMVPGKVTLQKDAQN 1i92A 9 :GMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1i92A 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIH 1i92A 85 :AVRLL T0288 85 :YN 1i92A 93 :PE Number of specific fragments extracted= 6 number of extra gaps= 1 total=86 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0288)K78 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0288)G79 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0288 80 :EVTIHYNKLQYYKV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=90 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0288 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1bfeA 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1bfeA 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 2 :MVPGKVTLQKDAQN 1bfeA 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQY 1bfeA 323 :LGFNIIGGEDG T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1bfeA 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=96 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=101 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 15 :NLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 161 :TGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIH 1fc6A 223 :ADSQVEVV T0288 85 :YNKLQY 1fc6A 237 :PSNTRT Number of specific fragments extracted= 4 number of extra gaps= 0 total=105 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1fc6A 159 :SVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMI 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0288 77 :VKGEVTIHYNKLQY 1fc6A 223 :ADSQVEVVLHAPGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=108 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t2mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1t2mA/merged-good-all-a2m.gz for input Trying 1t2mA/merged-good-all-a2m Error: Couldn't open file 1t2mA/merged-good-all-a2m or 1t2mA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0288 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=111 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0288 2 :MVPGKVTLQK 1nf3C 153 :ETHRRVRLCK T0288 12 :DAQNLIGISIGGGAQYCP 1nf3C 164 :GTEKPLGFYIRDGSSVRV T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nf3C 191 :GIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIIT T0288 85 :YNK 1nf3C 249 :ANQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=115 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1nf3C)N253 T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1nf3C 155 :HRRVRLCKYGTEKPLGFYIRDGSS T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1nf3C 188 :KVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 2 number of extra gaps= 0 total=117 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0288 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0288 2 :MVPGKVTLQ 1wf7A 4 :GSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=120 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 1 :SMVPGKVTLQ 1wf7A 3 :SGSSGSVSLV T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 13 :GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMT Number of specific fragments extracted= 3 number of extra gaps= 0 total=123 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0288 7 :VTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDG 1wf7A 7 :GSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAH T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAA Number of specific fragments extracted= 2 number of extra gaps= 0 total=125 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=129 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)N86 because last residue in template chain is (2f0aA)E342 T0288 4 :PGKVTLQ 2f0aA 252 :IITVTLN T0288 16 :LIGISIGG 2f0aA 264 :FLGISIVG T0288 24 :GAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 274 :NERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIH 2f0aA 331 :PGPIVLT T0288 85 :Y 2f0aA 341 :L Number of specific fragments extracted= 5 number of extra gaps= 1 total=134 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f0aA)E342 T0288 16 :LIGISIGGGAQ 2f0aA 264 :FLGISIVGQSN T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0288 78 :KGEVTIHYNKL 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 3 number of extra gaps= 1 total=137 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0288 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 1 :SMVPGKVTLQKDAQN 1n7eA 667 :GAIIYTVELKRYGGP T0288 17 :IGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7eA 682 :LGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK T0288 87 :KL 1n7eA 756 :AQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 1 number of extra gaps= 0 total=143 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIHYNKLQY 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=147 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9A)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9A)P231 T0288 10 :QKDAQNLIGISIGGG 1ky9A 215 :VNLNGELIGINTAIL T0288 27 :YCP 1ky9A 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9A 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEV 1ky9A 322 :AALRAQVGTM T0288 78 :KGEVTIH 1ky9A 334 :GSKLTLG T0288 85 :YNKLQ 1ky9A 343 :RDGKQ Number of specific fragments extracted= 7 number of extra gaps= 1 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1ky9A 281 :KVDAQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKGK 1ky9A 304 :IKAGDVITSLNGKPISSF T0288 68 :VEVAKMIQEVKGEVTIHYNKLQYY 1ky9A 322 :AALRAQVGTMPVGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0288 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIHYNKLQY 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1ky9B)P231 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1ky9B)P231 Warning: unaligning (T0288)E76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0288 11 :KDAQNLIGISIGGG 1ky9B 216 :NLNGELIGINTAIL T0288 27 :YCP 1ky9B 232 :DGG T0288 30 :CLYIVQVFDNTPAALDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKMIQ 1ky9B 321 :FAALRAQVG T0288 78 :KGEVTIH 1ky9B 334 :GSKLTLG T0288 85 :YNKLQYY 1ky9B 342 :LRDGKQV Number of specific fragments extracted= 7 number of extra gaps= 1 total=168 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0288)I19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0288)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 T0288 16 :LIG 1ky9B 264 :ELG T0288 22 :GGGAQ 1ky9B 270 :TELNS T0288 27 :YCPCLYIVQVFDNTPAALDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0288 48 :VAAGDEITGVNGRSIKG 1ky9B 304 :IKAGDVITSLNGKPISS T0288 67 :KVEVAKM 1ky9B 321 :FAALRAQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=173 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xz9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1xz9A/merged-good-all-a2m.gz for input Trying 1xz9A/merged-good-all-a2m Error: Couldn't open file 1xz9A/merged-good-all-a2m or 1xz9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0288)Y91 because last residue in template chain is (1mfgA)S1371 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=179 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 1 :SMVPGKVTLQKDAQ 1mfgA 1277 :GSMEIRVRVEKDPE T0288 17 :IGISIGGGAQYCP 1mfgA 1291 :LGFSISGGVGGRG T0288 30 :CLYIVQVFDNTPA 1mfgA 1312 :GIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :Y 1mfgA 1369 :V Number of specific fragments extracted= 6 number of extra gaps= 2 total=185 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0288)G79 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0288)E80 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0288)I83 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0288)H84 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1mfgA 1278 :SMEIRVRVEKDPELGFSISGGVG T0288 27 :YCPCLYIVQVFDNTPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0288 45 :DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVK 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0288 81 :VT 1mfgA 1361 :VE T0288 85 :YNKLQY 1mfgA 1365 :IVREVS Number of specific fragments extracted= 5 number of extra gaps= 2 total=190 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0288 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQYC 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 34 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1b8qA 84 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1b8qA 10 :ISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1b8qA 84 :ETHVVLI T0288 86 :NKLQYY 1b8qA 94 :PEGFTT Number of specific fragments extracted= 4 number of extra gaps= 0 total=197 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1b8qA 8 :NVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEG Number of specific fragments extracted= 2 number of extra gaps= 0 total=199 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0288 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=203 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)M2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 1 :S 1nteA 193 :A T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 4 number of extra gaps= 1 total=207 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0288)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0288 4 :PGKVTLQKDAQNLIGISIGGG 1nteA 196 :PRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1nteA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 1 total=210 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0288 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQ 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=213 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 1 :SMVPGKVTLQKDAQN 2fe5A 221 :SMTIMEVNLLKGPKG T0288 17 :IGISIGGGAQYCP 2fe5A 236 :LGFSIAGGIGNQH T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 2fe5A 254 :SIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=216 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKP Number of specific fragments extracted= 2 number of extra gaps= 0 total=218 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=221 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGG 1r6jA 193 :AMDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=224 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0288 2 :MVPGKVTLQKDAQNLIGISIGGG 1r6jA 194 :MDPRTITMHKDSTGHVGFIFKNG T0288 32 :YIVQVFDNTPAALDG 1r6jA 217 :KITSIVKDSSAARNG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=227 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0288 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1qavA 76 :SLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 1 number of extra gaps= 0 total=229 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1qavA 78 :QRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM Number of specific fragments extracted= 1 number of extra gaps= 0 total=230 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wfvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1wfvA/merged-good-all-a2m.gz for input Trying 1wfvA/merged-good-all-a2m Error: Couldn't open file 1wfvA/merged-good-all-a2m or 1wfvA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0288 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQYC 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVSKP T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1040 :PVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIHYNKLQYY 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 3 number of extra gaps= 0 total=233 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0288 78 :KGEVTIH 1qavB 1090 :ETHVVLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=236 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1qavB 1013 :PNVISVRLFKRKVGGLGFLVKERVS T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0288 81 :VTIHYNKLQY 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=239 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0288 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQYC 1m5zA 34 :EDFGFSVADGLLEK T0288 30 :CLYIVQVFDNTPAALDG 1m5zA 48 :GVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=243 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 1 :SMVPGKVTLQKDAQ 1m5zA 19 :PVELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=247 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0288 2 :MVPGKVTLQKDAQ 1m5zA 20 :VELHKVTLYKDSG T0288 15 :NLIGISIGGGAQ 1m5zA 34 :EDFGFSVADGLL T0288 28 :CPCLYIVQVFDNTPAALDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR Number of specific fragments extracted= 4 number of extra gaps= 0 total=251 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0288 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 3 number of extra gaps= 0 total=254 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 2 :MVPGKVTLQKDAQN 1be9A 309 :REPRRIVIHRGSTG T0288 17 :IGISIGGGAQYC 1be9A 323 :LGFNIIGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1be9A 335 :GIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=257 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0288 3 :VPGKVTLQKDAQNLIGISIGGGAQ 1be9A 309 :REPRRIVIHRGSTGLGFNIIGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=259 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x6dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1x6dA/merged-good-all-a2m.gz for input Trying 1x6dA/merged-good-all-a2m Error: Couldn't open file 1x6dA/merged-good-all-a2m or 1x6dA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0288 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIHYNKLQY 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 8 number of extra gaps= 6 total=267 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 Warning: unaligning (T0288)Y90 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)T343 T0288 8 :TLQK 1te0A 262 :GGRE T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEV 1te0A 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1te0A 328 :GSVIPVV T0288 85 :YNKLQ 1te0A 337 :RDDKQ Number of specific fragments extracted= 10 number of extra gaps= 7 total=277 Number of alignments=74 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0288)Q14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0288)N15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0288)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0288)A25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0288)Q26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0288)V34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0288)Q35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0288)N39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0288)T40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0288)A43 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0288)L44 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0288)D45 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0288)G46 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0288)D52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0288)E53 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0288)I62 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0288)K63 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0288 12 :DA 1te0A 270 :HA T0288 27 :YCPCLYI 1te0A 278 :QLQGIVV T0288 36 :VFD 1te0A 287 :VSP T0288 41 :PA 1te0A 292 :PA T0288 48 :VAAG 1te0A 298 :IQVN T0288 54 :ITGVNGRS 1te0A 304 :IISVDNKP T0288 66 :TKVEVAKMIQEVKGEVTIHYNKLQYYK 1te0A 314 :SALETMDQVAEIRPGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=284 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0288 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=287 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 1 :SMVPGKVTLQKD 2fcfA 1146 :SMQPRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYK 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTR Number of specific fragments extracted= 3 number of extra gaps= 1 total=290 Number of alignments=76 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0288)A13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0288)N15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0288)A25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0288)Q26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0288 4 :PGKVTLQKD 2fcfA 1149 :PRRVELWRE T0288 16 :LIGISIGGG 2fcfA 1161 :SLGISIVGG T0288 31 :LYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=293 Number of alignments=77 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0288 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0288 13 :AQ 1lcyA 249 :PS T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQE 1lcyA 291 :AEDVYEAVRT T0288 78 :KGEVTIHYNKLQY 1lcyA 301 :QSQLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=298 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 12 :DAQN 1lcyA 248 :EPSF T0288 25 :AQYCPCLYIVQVFDNTPAALDG 1lcyA 252 :PDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIH 1lcyA 302 :SQLAVQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=303 Number of alignments=79 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0288 24 :GAQYCPCLYIVQVFDNTPAALDG 1lcyA 251 :FPDVQHGVLIHKVILGSPAHRAG T0288 48 :VAAGDEITGVNGRSIKG 1lcyA 274 :LRPGDVILAIGEQMVQN T0288 67 :KVEVAKMIQEV 1lcyA 291 :AEDVYEAVRTQ T0288 79 :GEVTIHYNKLQY 1lcyA 302 :SQLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=307 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEV 1sotA 315 :ALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)N86 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0288 9 :LQKDAQNLIGISIG 1sotA 205 :LVNSLGELMGINTL T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIK 1sotA 298 :IQVNDLIISVDNKPAI T0288 66 :TKVEVAKMIQEV 1sotA 314 :SALETMDQVAEI T0288 78 :KGEVTIH 1sotA 328 :GSVIPVV T0288 87 :KLQYYK 1sotA 342 :LTLQVT Number of specific fragments extracted= 6 number of extra gaps= 0 total=317 Number of alignments=82 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0288)C30 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0288)K87 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0288 31 :LYIVQVFDNTPAALDG 1sotA 282 :IVVNEVSPDGPAANAG T0288 48 :VAAGDEITGVNGRSIKG 1sotA 298 :IQVNDLIISVDNKPAIS T0288 67 :KVEVAKMIQEVKGEVTIHYN 1sotA 315 :ALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=320 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0288 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0288)Q89 because last residue in template chain is (2f5yA)V95 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 5 number of extra gaps= 1 total=325 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)M2 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)V3 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 4 :PGKVTLQKDAQN 2f5yA 16 :YRQITIPRGKDG T0288 17 :IGISIGG 2f5yA 28 :FGFTICC T0288 28 :CPCLYIVQVFDNTPAALDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIH 2f5yA 71 :WKCVELAHEIRSCPSEIILL Number of specific fragments extracted= 5 number of extra gaps= 1 total=330 Number of alignments=85 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0288)P4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0288)K63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0288)G64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0288 5 :GKVTLQKDAQNLIGISIGGG 2f5yA 16 :YRQITIPRGKDGFGFTICCD T0288 29 :PCLYIVQVFDNTPAALDG 2f5yA 36 :SPVRVQAVDSGGPAERAG T0288 48 :VAAGDEITGVNGRSI 2f5yA 54 :LQQLDTVLQLNERPV T0288 65 :KTKVEVAKMIQEVKGEVTIHYNKL 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=334 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0288 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=337 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaA)R487 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaA 488 :SRLVQFQKNTDEPMGITLK T0288 23 :GGAQ 1kwaA 508 :NELN T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK Number of specific fragments extracted= 3 number of extra gaps= 0 total=340 Number of alignments=88 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0288)K92 because last residue in template chain is (1kwaA)F574 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1kwaA 489 :RLVQFQKNTDEPMGITLKMNEL T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaA 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 0 total=342 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0288 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYR Number of specific fragments extracted= 2 number of extra gaps= 1 total=344 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0288)Y90 because last residue in template chain is (1kwaB)F574 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK T0288 85 :YNKLQ 1kwaB 569 :PSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=347 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0288)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0288)G24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0288 4 :PGKVTLQKDAQNLIGISIG 1kwaB 488 :SRLVQFQKNTDEPMGITLK T0288 29 :PCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYY 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 2 number of extra gaps= 1 total=349 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0288 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQYC 1pdr 476 :LGFNIVGGEDGE T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 488 :GIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 3 number of extra gaps= 0 total=352 Number of alignments=91 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQN 1pdr 462 :REPRKVVLHRGSTG T0288 17 :IGISIGGGAQ 1pdr 476 :LGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIV T0288 85 :YNK 1pdr 545 :YRP Number of specific fragments extracted= 4 number of extra gaps= 0 total=356 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0288 28 :CPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=358 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0288/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 86 :NKLQYY 1n99A 191 :RDRPFE Number of specific fragments extracted= 5 number of extra gaps= 1 total=363 Number of alignments=94 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEV 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0288 78 :KGEVTI 1n99A 183 :GEKITM T0288 85 :YNKLQYY 1n99A 193 :RPFERTI Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0288)P4 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1n99A 113 :REVILCKDQDGKIGLRLKSIDN T0288 30 :CLYIVQVFDNTPAALDG 1n99A 135 :GIFVQLVQANSPASLVG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGE 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFGE T0288 81 :VTI 1n99A 186 :ITM T0288 86 :NKLQYYK 1n99A 191 :RDRPFER Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 2 :MVPGKVTLQKDAQN 1g9oA 10 :MLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=377 Number of alignments=97 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 1 :SMVPGKVTLQKDAQN 1g9oA 9 :RMLPRLCCLEKGPNG T0288 17 :IGISIGGGAQ 1g9oA 24 :YGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLL T0288 85 :YNKL 1g9oA 93 :PETD Number of specific fragments extracted= 5 number of extra gaps= 0 total=382 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0288 4 :PGKVTLQKDAQNLIGISIGGGAQ 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKG T0288 28 :CPCLYIVQVFDNTPAALDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=385 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0288 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=398 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V3 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)G24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)N86 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)K87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGG 1l6oA 269 :IVG T0288 25 :AQY 1l6oA 275 :ERG T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV Number of specific fragments extracted= 12 number of extra gaps= 12 total=410 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0288)V7 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0288)T8 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0288)D12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0288)A13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0288)Q14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0288)N15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0288)L16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0288)I17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0288)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0288)S20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0288)A25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0288)Q26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0288)C28 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0288)P29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0288)C30 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0288)A42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0288)A43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0288)N58 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0288)G59 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0288)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0288)I62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0288)G64 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0288)K65 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0288)T66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0288)Q75 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0288)E76 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0288)I83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0288)H84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0288)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0288)N86 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0288)L88 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0288)Q89 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0288)Y90 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0288)Y91 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0288)K92 because last residue in template chain is (1l6oA)H345 T0288 4 :PGK 1l6oA 252 :IIT T0288 9 :LQK 1l6oA 257 :LNM T0288 18 :G 1l6oA 266 :G T0288 21 :IGGG 1l6oA 269 :IVGQ T0288 27 :Y 1l6oA 277 :G T0288 31 :LYIVQVFDNTP 1l6oA 281 :IYIGSIMKGGA T0288 44 :LDGTVAAGDEITGV 1l6oA 294 :ADGRIEPGDMLLQV T0288 60 :R 1l6oA 310 :I T0288 63 :K 1l6oA 313 :E T0288 67 :KVEVAKMI 1l6oA 317 :NDDAVRVL T0288 77 :V 1l6oA 327 :I T0288 78 :KGEVT 1l6oA 331 :PGPIV T0288 87 :K 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 12 total=423 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=426 Number of alignments=100 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQYCP 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKAQTP T0288 30 :CLYIVQVFDNTPAALDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVK T0288 85 :YNK 1q3oA 684 :VTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=430 Number of alignments=101 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0288)Y91 because last residue in template chain is (1q3oA)H687 T0288 5 :GKVTLQKDAQNLIGISIGGGAQ 1q3oA 590 :KTVLLQKKDSEGFGFVLRGAKA T0288 27 :YCPCLYIVQVFDNTPAALDG 1q3oA 624 :FPALQYLESVDEGGVAWRAG T0288 48 :VAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQY 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 3 number of extra gaps= 0 total=433 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=435 Number of alignments=103 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)M2 because first residue in template chain is (1n7fA)A668 T0288 3 :VPGKVTLQK 1n7fA 669 :IIYTVELKR T0288 13 :AQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1n7fA 678 :YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=437 Number of alignments=104 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0288)V3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0288)L88 because last residue in template chain is (1n7fA)Q753 T0288 4 :PGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=438 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0288 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=441 Number of alignments=106 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)Y27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0288)C28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0288)P29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 T0288 1 :SMVPGKVTLQKDAQNLIGISIGGGA 1ihjA 12 :GELIHMVTLDKTGKKSFGICIVRGE T0288 26 :Q 1ihjA 39 :D T0288 30 :CLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH 1ihjA 47 :GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELE Number of specific fragments extracted= 3 number of extra gaps= 1 total=444 Number of alignments=107 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0288)L88 because last residue in template chain is (1ihjA)F105 T0288 2 :MVPGKVTLQKDAQNLIGISIGGGAQ 1ihjA 13 :ELIHMVTLDKTGKKSFGICIVRGEV T0288 27 :YCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNK 1ihjA 44 :KTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 2 number of extra gaps= 0 total=446 Number of alignments=108 # command:Using radius: 22.0000 NUMB_ALIGNS: 108 evalue: 0 0.5265, weight 0.1000 evalue: 1 0.5265, weight 0.1000 evalue: 2 0.5265, weight 0.1000 evalue: 3 0.0739, weight 0.8737 evalue: 4 0.0739, weight 0.8737 evalue: 5 0.0739, weight 0.8737 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.3503, weight 0.4012 evalue: 40 0.3503, weight 0.4012 evalue: 41 0.3503, weight 0.4012 evalue: 42 0.1754, weight 0.7001 evalue: 43 0.1754, weight 0.7001 evalue: 44 0.1754, weight 0.7001 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0035, weight 0.9940 evalue: 73 0.0035, weight 0.9940 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0021, weight 0.9965 evalue: 78 0.0021, weight 0.9965 evalue: 79 0.0021, weight 0.9965 evalue: 80 0.3878, weight 0.3370 evalue: 81 0.3878, weight 0.3370 evalue: 82 0.3878, weight 0.3370 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 1.0000 evalue: 89 0.0001, weight 0.9999 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 0.9999 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 1.0000 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 23 RES2ATOM 5 34 RES2ATOM 6 43 RES2ATOM 7 50 RES2ATOM 8 57 RES2ATOM 9 65 RES2ATOM 10 74 RES2ATOM 11 83 RES2ATOM 12 91 RES2ATOM 13 96 RES2ATOM 14 105 RES2ATOM 15 113 RES2ATOM 16 121 RES2ATOM 18 133 RES2ATOM 19 141 RES2ATOM 20 147 RES2ATOM 24 167 RES2ATOM 25 172 RES2ATOM 26 181 RES2ATOM 27 193 RES2ATOM 28 199 RES2ATOM 29 206 RES2ATOM 30 212 RES2ATOM 31 220 RES2ATOM 32 232 RES2ATOM 33 240 RES2ATOM 34 247 RES2ATOM 35 256 RES2ATOM 36 263 RES2ATOM 37 274 RES2ATOM 38 282 RES2ATOM 39 290 RES2ATOM 40 297 RES2ATOM 41 304 RES2ATOM 42 309 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 46 334 RES2ATOM 47 341 RES2ATOM 48 348 RES2ATOM 49 353 RES2ATOM 51 362 RES2ATOM 52 370 RES2ATOM 53 379 RES2ATOM 54 387 RES2ATOM 56 398 RES2ATOM 57 405 RES2ATOM 59 417 RES2ATOM 60 428 RES2ATOM 61 434 RES2ATOM 62 442 RES2ATOM 64 455 RES2ATOM 65 464 RES2ATOM 66 471 RES2ATOM 67 480 RES2ATOM 68 487 RES2ATOM 69 496 RES2ATOM 70 503 RES2ATOM 71 508 RES2ATOM 72 517 RES2ATOM 73 525 RES2ATOM 74 533 RES2ATOM 75 542 RES2ATOM 76 551 RES2ATOM 77 558 RES2ATOM 79 571 RES2ATOM 80 580 RES2ATOM 81 587 RES2ATOM 82 594 RES2ATOM 83 602 RES2ATOM 84 612 RES2ATOM 85 624 RES2ATOM 86 632 RES2ATOM 87 641 RES2ATOM 88 649 RES2ATOM 89 658 RES2ATOM 90 670 RES2ATOM 91 682 RES2ATOM 92 691 Constraint 406 518 6.0814 7.6017 11.4026 100.2126 Constraint 406 509 9.9323 12.4154 18.6231 100.2126 Constraint 406 504 11.1142 13.8928 20.8391 100.2126 Constraint 406 497 9.2300 11.5375 17.3063 100.2126 Constraint 406 488 10.5969 13.2461 19.8692 100.2126 Constraint 406 481 13.7112 17.1390 25.7085 100.2126 Constraint 399 518 4.3013 5.3766 8.0649 100.2126 Constraint 399 509 8.2542 10.3178 15.4767 100.2126 Constraint 399 504 8.3216 10.4019 15.6029 100.2126 Constraint 399 497 5.7540 7.1925 10.7888 100.2126 Constraint 399 488 8.0766 10.0958 15.1437 100.2126 Constraint 399 481 10.9297 13.6621 20.4932 100.2126 Constraint 388 518 10.1157 12.6446 18.9669 100.2126 Constraint 388 509 13.5080 16.8850 25.3275 100.2126 Constraint 388 504 12.6089 15.7611 23.6417 100.2126 Constraint 388 497 8.6752 10.8440 16.2660 100.2126 Constraint 388 488 11.0739 13.8424 20.7636 100.2126 Constraint 388 481 13.9919 17.4898 26.2347 100.2126 Constraint 380 518 8.0595 10.0744 15.1116 100.2126 Constraint 380 509 10.9065 13.6331 20.4497 100.2126 Constraint 380 504 8.9446 11.1807 16.7711 100.2126 Constraint 380 497 5.7675 7.2094 10.8141 100.2126 Constraint 380 488 9.4782 11.8478 17.7717 100.2126 Constraint 380 481 11.3156 14.1445 21.2167 100.2126 Constraint 354 504 13.9897 17.4872 26.2307 100.2126 Constraint 354 497 13.1079 16.3848 24.5773 100.2126 Constraint 349 504 15.5715 19.4643 29.1965 100.2126 Constraint 349 497 14.0255 17.5319 26.2978 100.2126 Constraint 349 406 15.9789 19.9736 29.9604 100.2126 Constraint 305 406 12.1916 15.2395 22.8593 100.2126 Constraint 305 399 10.4056 13.0070 19.5105 100.2126 Constraint 305 380 9.0079 11.2599 16.8898 100.2126 Constraint 275 380 15.6325 19.5406 29.3109 100.2126 Constraint 275 354 9.7880 12.2350 18.3525 100.2126 Constraint 275 349 10.4933 13.1166 19.6749 100.2126 Constraint 264 504 12.5056 15.6321 23.4481 100.2126 Constraint 264 497 13.8970 17.3713 26.0570 100.2126 Constraint 264 380 12.6851 15.8564 23.7846 100.2126 Constraint 264 354 8.8904 11.1129 16.6694 100.2126 Constraint 264 349 10.1600 12.6999 19.0499 100.2126 Constraint 257 518 14.8707 18.5884 27.8826 100.2126 Constraint 257 504 12.8742 16.0928 24.1392 100.2126 Constraint 257 497 12.8658 16.0822 24.1234 100.2126 Constraint 257 406 15.4111 19.2638 28.8958 100.2126 Constraint 257 399 12.9139 16.1423 24.2135 100.2126 Constraint 257 388 13.9773 17.4716 26.2074 100.2126 Constraint 257 380 9.9863 12.4828 18.7243 100.2126 Constraint 257 354 4.9925 6.2407 9.3610 100.2126 Constraint 257 349 5.6378 7.0472 10.5708 100.2126 Constraint 233 518 11.7706 14.7132 22.0698 100.2126 Constraint 233 509 13.5514 16.9393 25.4089 100.2126 Constraint 233 504 10.1964 12.7455 19.1182 100.2126 Constraint 233 497 8.8586 11.0732 16.6098 100.2126 Constraint 233 488 12.9767 16.2209 24.3313 100.2126 Constraint 233 481 13.1719 16.4648 24.6972 100.2126 Constraint 233 406 13.0259 16.2823 24.4235 100.2126 Constraint 233 399 9.7028 12.1286 18.1928 100.2126 Constraint 233 388 9.3808 11.7260 17.5890 100.2126 Constraint 233 380 5.3844 6.7306 10.0958 100.2126 Constraint 233 354 4.5628 5.7035 8.5553 100.2126 Constraint 233 349 5.6091 7.0114 10.5171 100.2126 Constraint 233 305 6.4949 8.1187 12.1780 100.2126 Constraint 221 518 12.3865 15.4831 23.2246 100.2126 Constraint 221 509 13.7691 17.2113 25.8170 100.2126 Constraint 221 504 10.5177 13.1471 19.7206 100.2126 Constraint 221 497 8.4234 10.5293 15.7939 100.2126 Constraint 221 488 11.8865 14.8581 22.2871 100.2126 Constraint 221 481 12.0057 15.0071 22.5107 100.2126 Constraint 221 406 14.6716 18.3396 27.5093 100.2126 Constraint 221 399 10.8892 13.6115 20.4173 100.2126 Constraint 221 388 8.6777 10.8471 16.2707 100.2126 Constraint 221 380 5.8807 7.3509 11.0264 100.2126 Constraint 221 354 6.6525 8.3157 12.4735 100.2126 Constraint 221 349 8.4953 10.6191 15.9286 100.2126 Constraint 518 588 9.4861 11.8577 17.7865 99.5125 Constraint 509 588 13.4061 16.7576 25.1364 99.5125 Constraint 509 581 10.6074 13.2593 19.8889 99.5125 Constraint 504 588 13.5211 16.9014 25.3521 99.5125 Constraint 504 581 10.3319 12.9149 19.3723 99.5125 Constraint 497 588 11.4459 14.3074 21.4611 99.5125 Constraint 497 581 9.5825 11.9781 17.9672 99.5125 Constraint 488 588 13.8879 17.3599 26.0399 99.5125 Constraint 488 581 12.2675 15.3344 23.0016 99.5125 Constraint 481 581 14.1448 17.6810 26.5215 99.5125 Constraint 406 588 4.4739 5.5924 8.3886 99.5125 Constraint 406 581 4.9974 6.2467 9.3701 99.5125 Constraint 406 526 7.3366 9.1707 13.7561 99.5125 Constraint 399 588 6.0103 7.5129 11.2693 99.5125 Constraint 399 581 5.3814 6.7268 10.0902 99.5125 Constraint 399 526 5.1435 6.4293 9.6440 99.5125 Constraint 388 588 9.3231 11.6539 17.4809 99.5125 Constraint 388 581 11.0440 13.8050 20.7075 99.5125 Constraint 388 526 10.9205 13.6507 20.4760 99.5125 Constraint 380 588 8.9557 11.1946 16.7919 99.5125 Constraint 380 581 8.5963 10.7453 16.1180 99.5125 Constraint 380 526 7.2871 9.1088 13.6632 99.5125 Constraint 354 526 13.3569 16.6961 25.0442 99.5125 Constraint 349 588 13.6073 17.0091 25.5136 99.5125 Constraint 349 526 13.7377 17.1722 25.7582 99.5125 Constraint 305 588 10.4081 13.0102 19.5153 99.5125 Constraint 305 581 7.9965 9.9956 14.9935 99.5125 Constraint 305 526 9.0608 11.3260 16.9891 99.5125 Constraint 275 581 15.0433 18.8042 28.2062 99.5125 Constraint 275 526 15.0858 18.8572 28.2858 99.5125 Constraint 264 581 12.0876 15.1095 22.6642 99.5125 Constraint 264 526 11.2079 14.0098 21.0148 99.5125 Constraint 257 588 13.8110 17.2637 25.8956 99.5125 Constraint 257 581 11.5941 14.4926 21.7390 99.5125 Constraint 257 526 11.2618 14.0772 21.1158 99.5125 Constraint 233 588 12.1437 15.1796 22.7694 99.5125 Constraint 233 581 10.6560 13.3200 19.9800 99.5125 Constraint 233 526 9.1723 11.4654 17.1980 99.5125 Constraint 221 526 10.9590 13.6987 20.5481 99.5125 Constraint 354 588 15.8286 19.7857 29.6786 99.1113 Constraint 406 472 13.6792 17.0990 25.6486 99.0091 Constraint 399 472 10.1512 12.6890 19.0335 99.0091 Constraint 388 472 11.5973 14.4967 21.7450 99.0091 Constraint 380 472 8.5920 10.7400 16.1100 99.0091 Constraint 354 472 13.0831 16.3539 24.5308 99.0091 Constraint 349 472 15.2218 19.0272 28.5408 99.0091 Constraint 264 518 15.2488 19.0610 28.5916 99.0091 Constraint 264 509 15.8400 19.8001 29.7001 99.0091 Constraint 264 472 14.5204 18.1505 27.2258 99.0091 Constraint 264 399 14.2794 17.8492 26.7738 99.0091 Constraint 257 472 13.7611 17.2014 25.8021 99.0091 Constraint 233 472 9.7792 12.2240 18.3360 99.0091 Constraint 221 472 8.0105 10.0131 15.0196 99.0091 Constraint 349 581 13.1937 16.4921 24.7382 98.5125 Constraint 472 588 15.7349 19.6686 29.5029 98.3090 Constraint 472 581 13.5582 16.9478 25.4216 98.3090 Constraint 264 588 15.4026 19.2532 28.8799 98.3090 Constraint 435 518 5.8731 7.3413 11.0120 98.2247 Constraint 435 509 8.7641 10.9552 16.4328 98.2247 Constraint 435 504 8.3409 10.4261 15.6391 98.2247 Constraint 371 518 12.2691 15.3364 23.0046 98.2247 Constraint 371 504 12.4986 15.6232 23.4349 98.2247 Constraint 371 497 9.1921 11.4902 17.2352 98.2247 Constraint 371 481 13.9939 17.4924 26.2386 98.2247 Constraint 371 435 7.3408 9.1760 13.7641 98.2247 Constraint 363 504 13.0359 16.2949 24.4424 98.2247 Constraint 363 497 10.6693 13.3366 20.0049 98.2247 Constraint 363 435 9.7489 12.1861 18.2791 98.2247 Constraint 354 435 13.7591 17.1989 25.7983 98.2247 Constraint 349 435 13.7010 17.1262 25.6894 98.2247 Constraint 305 363 8.0793 10.0991 15.1487 98.2247 Constraint 283 363 14.6574 18.3218 27.4826 98.2247 Constraint 283 354 12.3117 15.3896 23.0844 98.2247 Constraint 283 349 12.1401 15.1751 22.7627 98.2247 Constraint 275 363 13.2813 16.6016 24.9024 98.2247 Constraint 264 435 16.1238 20.1547 30.2321 98.2247 Constraint 264 371 14.9387 18.6734 28.0101 98.2247 Constraint 264 363 11.6136 14.5170 21.7755 98.2247 Constraint 257 435 14.1014 17.6267 26.4401 98.2247 Constraint 257 371 11.2798 14.0997 21.1495 98.2247 Constraint 257 363 7.4703 9.3379 14.0068 98.2247 Constraint 248 518 15.0048 18.7560 28.1339 98.2247 Constraint 248 509 15.4604 19.3255 28.9883 98.2247 Constraint 248 504 11.4737 14.3421 21.5131 98.2247 Constraint 248 497 12.1321 15.1652 22.7477 98.2247 Constraint 248 481 14.5517 18.1896 27.2845 98.2247 Constraint 248 435 14.2197 17.7746 26.6619 98.2247 Constraint 248 399 14.0727 17.5908 26.3863 98.2247 Constraint 248 388 15.0582 18.8228 28.2342 98.2247 Constraint 248 380 10.7370 13.4212 20.1318 98.2247 Constraint 248 371 11.6469 14.5586 21.8379 98.2247 Constraint 248 363 9.0891 11.3614 17.0420 98.2247 Constraint 248 354 5.0598 6.3247 9.4871 98.2247 Constraint 248 349 8.3198 10.3997 15.5995 98.2247 Constraint 241 518 13.6876 17.1096 25.6643 98.2247 Constraint 241 509 14.1317 17.6646 26.4969 98.2247 Constraint 241 504 10.1178 12.6472 18.9708 98.2247 Constraint 241 497 10.0121 12.5151 18.7726 98.2247 Constraint 241 488 13.5921 16.9901 25.4852 98.2247 Constraint 241 481 12.3587 15.4483 23.1725 98.2247 Constraint 241 435 11.8923 14.8654 22.2981 98.2247 Constraint 241 399 12.9146 16.1433 24.2149 98.2247 Constraint 241 388 12.8878 16.1097 24.1646 98.2247 Constraint 241 380 8.8746 11.0933 16.6399 98.2247 Constraint 241 371 9.1010 11.3763 17.0644 98.2247 Constraint 241 363 7.9369 9.9212 14.8817 98.2247 Constraint 241 354 5.1922 6.4902 9.7354 98.2247 Constraint 241 349 8.7469 10.9336 16.4004 98.2247 Constraint 233 435 9.4868 11.8586 17.7878 98.2247 Constraint 233 371 6.2906 7.8633 11.7949 98.2247 Constraint 233 363 3.8310 4.7888 7.1831 98.2247 Constraint 221 435 8.6279 10.7849 16.1774 98.2247 Constraint 221 371 4.4959 5.6199 8.4298 98.2247 Constraint 221 363 5.5689 6.9611 10.4417 98.2247 Constraint 429 518 8.3148 10.3935 15.5902 97.5916 Constraint 429 509 11.5554 14.4443 21.6664 97.5916 Constraint 429 504 12.2940 15.3675 23.0512 97.5916 Constraint 429 497 8.3776 10.4720 15.7081 97.5916 Constraint 418 518 5.0881 6.3601 9.5401 97.5916 Constraint 418 509 8.6771 10.8464 16.2696 97.5916 Constraint 418 504 10.3450 12.9313 19.3969 97.5916 Constraint 418 497 7.4747 9.3433 14.0150 97.5916 Constraint 418 488 7.5899 9.4874 14.2312 97.5916 Constraint 342 518 13.0827 16.3534 24.5301 97.5916 Constraint 342 509 15.6212 19.5264 29.2897 97.5916 Constraint 342 504 12.9113 16.1391 24.2087 97.5916 Constraint 342 497 11.7007 14.6259 21.9389 97.5916 Constraint 342 429 14.6564 18.3205 27.4808 97.5916 Constraint 342 418 14.2667 17.8333 26.7500 97.5916 Constraint 342 406 12.1911 15.2388 22.8583 97.5916 Constraint 342 399 10.0506 12.5632 18.8448 97.5916 Constraint 298 518 13.1670 16.4588 24.6882 97.5916 Constraint 298 509 15.0268 18.7835 28.1752 97.5916 Constraint 298 504 13.0919 16.3649 24.5473 97.5916 Constraint 298 497 13.6315 17.0393 25.5590 97.5916 Constraint 298 418 15.4658 19.3322 28.9983 97.5916 Constraint 298 406 11.9078 14.8847 22.3271 97.5916 Constraint 298 399 11.3039 14.1299 21.1948 97.5916 Constraint 298 388 15.2511 19.0639 28.5959 97.5916 Constraint 298 380 11.7036 14.6295 21.9442 97.5916 Constraint 298 354 12.1951 15.2438 22.8657 97.5916 Constraint 275 342 9.7633 12.2041 18.3062 97.5916 Constraint 264 342 8.3030 10.3788 15.5681 97.5916 Constraint 257 342 4.7039 5.8799 8.8198 97.5916 Constraint 233 429 13.3136 16.6420 24.9630 97.5916 Constraint 233 418 13.5371 16.9214 25.3822 97.5916 Constraint 233 342 4.9255 6.1569 9.2353 97.5916 Constraint 221 429 12.3077 15.3846 23.0769 97.5916 Constraint 221 418 13.6888 17.1110 25.6664 97.5916 Constraint 221 342 9.0438 11.3048 16.9572 97.5916 Constraint 221 298 14.4809 18.1011 27.1516 97.5916 Constraint 435 588 9.8405 12.3006 18.4509 97.5246 Constraint 435 581 9.8004 12.2505 18.3757 97.5246 Constraint 435 526 7.5437 9.4296 14.1444 97.5246 Constraint 371 588 12.4238 15.5297 23.2946 97.5246 Constraint 371 526 11.7164 14.6455 21.9683 97.5246 Constraint 363 588 11.4940 14.3674 21.5512 97.5246 Constraint 363 526 11.3516 14.1896 21.2843 97.5246 Constraint 283 581 14.0619 17.5774 26.3661 97.5246 Constraint 283 526 15.0896 18.8619 28.2929 97.5246 Constraint 248 526 11.5146 14.3932 21.5898 97.5246 Constraint 241 526 10.9822 13.7277 20.5915 97.5246 Constraint 354 518 16.1760 20.2200 30.3300 97.2127 Constraint 349 518 16.2998 20.3747 30.5621 97.2127 Constraint 305 518 12.4347 15.5434 23.3151 97.2127 Constraint 305 509 14.4810 18.1013 27.1520 97.2127 Constraint 305 504 11.7924 14.7405 22.1108 97.2127 Constraint 305 497 11.5583 14.4478 21.6718 97.2127 Constraint 305 488 15.5683 19.4603 29.1905 97.2127 Constraint 305 388 12.6455 15.8069 23.7104 97.2127 Constraint 221 305 10.6723 13.3404 20.0106 97.2127 Constraint 257 509 16.2776 20.3470 30.5205 97.2126 Constraint 481 552 12.4118 15.5147 23.2721 97.1158 Constraint 406 552 5.2832 6.6040 9.9061 97.1158 Constraint 399 552 6.0046 7.5057 11.2586 97.1158 Constraint 380 552 10.2949 12.8687 19.3030 97.1158 Constraint 305 552 10.7363 13.4204 20.1305 97.1158 Constraint 257 552 13.9448 17.4310 26.1465 97.1158 Constraint 233 552 12.7169 15.8962 23.8442 97.1158 Constraint 371 472 10.4664 13.0830 19.6245 97.0212 Constraint 363 472 12.2436 15.3045 22.9568 97.0212 Constraint 248 472 11.5609 14.4511 21.6766 97.0212 Constraint 241 472 8.7592 10.9489 16.4234 97.0212 Constraint 354 581 14.3979 17.9974 26.9961 96.9007 Constraint 221 588 14.4357 18.0446 27.0669 96.9007 Constraint 221 581 13.4514 16.8142 25.2213 96.9007 Constraint 429 588 10.2570 12.8212 19.2318 96.8915 Constraint 429 581 11.8483 14.8104 22.2156 96.8915 Constraint 429 526 11.0427 13.8033 20.7050 96.8915 Constraint 418 588 8.2579 10.3223 15.4835 96.8915 Constraint 418 581 8.8998 11.1247 16.6870 96.8915 Constraint 418 526 8.2952 10.3690 15.5535 96.8915 Constraint 342 588 9.8745 12.3431 18.5146 96.8915 Constraint 342 581 8.8899 11.1124 16.6686 96.8915 Constraint 342 526 10.1589 12.6986 19.0479 96.8915 Constraint 298 588 10.1695 12.7118 19.0677 96.8915 Constraint 298 581 7.1339 8.9173 13.3760 96.8915 Constraint 298 526 9.5623 11.9528 17.9292 96.8915 Constraint 363 581 11.3947 14.2434 21.3650 96.5246 Constraint 406 534 9.7395 12.1743 18.2615 96.5125 Constraint 399 534 8.5805 10.7257 16.0885 96.5125 Constraint 388 534 14.7605 18.4507 27.6760 96.5125 Constraint 380 534 11.2837 14.1047 21.1570 96.5125 Constraint 305 534 11.9952 14.9940 22.4909 96.5125 Constraint 264 534 12.7285 15.9106 23.8659 96.5125 Constraint 257 534 14.0566 17.5708 26.3562 96.5125 Constraint 233 534 12.7030 15.8788 23.8182 96.5125 Constraint 221 534 14.2822 17.8528 26.7792 96.5125 Constraint 504 572 14.3670 17.9587 26.9381 96.5125 Constraint 406 572 6.9707 8.7134 13.0701 96.5125 Constraint 399 572 9.2307 11.5384 17.3076 96.5125 Constraint 305 572 10.6836 13.3546 20.0318 96.5125 Constraint 257 572 14.6352 18.2939 27.4409 96.5125 Constraint 342 472 13.8754 17.3442 26.0163 96.3881 Constraint 264 552 13.5109 16.8886 25.3329 96.3134 Constraint 371 581 12.8234 16.0292 24.0438 96.1876 Constraint 248 581 13.7248 17.1560 25.7340 96.1876 Constraint 305 472 13.6988 17.1235 25.6852 96.0092 Constraint 472 552 12.9554 16.1942 24.2913 95.9123 Constraint 363 429 12.6314 15.7892 23.6838 95.6037 Constraint 342 435 11.6471 14.5589 21.8383 95.6037 Constraint 323 406 12.4469 15.5586 23.3379 95.6037 Constraint 323 399 11.7694 14.7118 22.0677 95.6037 Constraint 323 388 13.4677 16.8346 25.2520 95.6037 Constraint 323 380 11.0263 13.7829 20.6743 95.6037 Constraint 298 435 14.7641 18.4552 27.6827 95.6037 Constraint 298 371 15.0011 18.7513 28.1270 95.6037 Constraint 298 363 11.6952 14.6190 21.9284 95.6037 Constraint 291 504 13.2587 16.5734 24.8601 95.6037 Constraint 291 406 14.7902 18.4878 27.7317 95.6037 Constraint 291 399 13.3906 16.7382 25.1073 95.6037 Constraint 291 380 12.6164 15.7705 23.6557 95.6037 Constraint 291 371 15.3029 19.1287 28.6930 95.6037 Constraint 291 363 11.7493 14.6866 22.0299 95.6037 Constraint 291 354 10.4450 13.0563 19.5844 95.6037 Constraint 291 349 10.3637 12.9546 19.4319 95.6037 Constraint 283 342 10.3982 12.9977 19.4966 95.6037 Constraint 257 323 7.8072 9.7590 14.6386 95.6037 Constraint 248 342 8.2757 10.3446 15.5169 95.6037 Constraint 248 323 12.0260 15.0326 22.5488 95.6037 Constraint 241 429 16.1352 20.1690 30.2535 95.6037 Constraint 241 342 9.0848 11.3559 17.0339 95.6037 Constraint 241 323 13.6163 17.0203 25.5305 95.6037 Constraint 233 323 9.7201 12.1501 18.2251 95.6037 Constraint 221 323 13.8345 17.2932 25.9398 95.6037 Constraint 380 572 12.7094 15.8868 23.8301 95.5125 Constraint 497 572 13.8306 17.2883 25.9325 95.5125 Constraint 371 509 14.6786 18.3483 27.5224 95.2248 Constraint 371 488 12.2726 15.3407 23.0111 95.2248 Constraint 363 518 13.0537 16.3172 24.4757 95.2248 Constraint 363 509 15.6865 19.6081 29.4121 95.2248 Constraint 363 488 14.4748 18.0935 27.1403 95.2248 Constraint 305 435 12.5888 15.7360 23.6040 95.2247 Constraint 305 371 11.4016 14.2520 21.3779 95.2247 Constraint 443 518 9.9495 12.4369 18.6554 95.2247 Constraint 443 509 12.3271 15.4089 23.1134 95.2247 Constraint 380 443 7.5263 9.4078 14.1117 95.2247 Constraint 371 443 7.5761 9.4701 14.2051 95.2247 Constraint 363 443 11.4055 14.2569 21.3853 95.2247 Constraint 241 443 14.1316 17.6645 26.4967 95.2247 Constraint 233 443 12.0720 15.0900 22.6350 95.2247 Constraint 221 443 9.8224 12.2780 18.4170 95.2247 Constraint 283 380 16.4644 20.5805 30.8707 95.2247 Constraint 310 406 15.9564 19.9455 29.9182 95.2247 Constraint 310 399 14.4027 18.0034 27.0050 95.2247 Constraint 310 380 12.5830 15.7288 23.5932 95.2247 Constraint 310 363 10.1926 12.7408 19.1112 95.2247 Constraint 233 310 8.9941 11.2427 16.8640 95.2247 Constraint 406 543 7.5809 9.4762 14.2142 95.1122 Constraint 399 543 7.7971 9.7463 14.6195 95.1122 Constraint 388 543 14.4345 18.0431 27.0647 95.1122 Constraint 380 543 12.0743 15.0929 22.6394 95.1122 Constraint 233 543 14.8829 18.6036 27.9055 95.1122 Constraint 248 588 16.4775 20.5969 30.8954 94.9127 Constraint 241 588 16.2495 20.3119 30.4678 94.9127 Constraint 241 581 13.9469 17.4336 26.1505 94.9127 Constraint 323 588 9.2150 11.5187 17.2780 94.9035 Constraint 323 581 8.5525 10.6907 16.0360 94.9035 Constraint 323 526 12.0109 15.0136 22.5204 94.9035 Constraint 291 588 13.3148 16.6435 24.9652 94.9035 Constraint 291 581 10.0357 12.5446 18.8169 94.9035 Constraint 291 526 10.7851 13.4814 20.2220 94.9035 Constraint 233 572 14.5857 18.2322 27.3482 94.7743 Constraint 342 488 15.7662 19.7078 29.5617 94.5917 Constraint 305 429 16.0321 20.0401 30.0602 94.5916 Constraint 305 418 14.7377 18.4221 27.6332 94.5916 Constraint 349 429 16.6301 20.7876 31.1815 94.5916 Constraint 443 526 11.9767 14.9709 22.4563 94.5246 Constraint 435 534 10.7682 13.4602 20.1903 94.5246 Constraint 371 534 15.5867 19.4834 29.2251 94.5246 Constraint 248 534 13.6506 17.0632 25.5948 94.5246 Constraint 241 534 13.4870 16.8588 25.2882 94.5246 Constraint 310 588 13.6328 17.0410 25.5615 94.5246 Constraint 310 581 11.5461 14.4327 21.6490 94.5246 Constraint 310 572 13.3408 16.6759 25.0139 94.5246 Constraint 310 526 12.8906 16.1133 24.1700 94.5246 Constraint 418 552 8.2403 10.3004 15.4506 94.4947 Constraint 342 552 12.0402 15.0503 22.5755 94.4947 Constraint 298 552 9.5533 11.9416 17.9124 94.4947 Constraint 248 488 15.8136 19.7670 29.6505 94.2249 Constraint 213 518 8.1710 10.2137 15.3206 94.2126 Constraint 213 509 9.7416 12.1770 18.2655 94.2126 Constraint 213 504 7.3251 9.1564 13.7346 94.2126 Constraint 213 497 4.1872 5.2340 7.8510 94.2126 Constraint 213 488 7.5173 9.3966 14.0950 94.2126 Constraint 213 481 8.5727 10.7158 16.0737 94.2126 Constraint 213 406 11.2404 14.0504 21.0757 94.2126 Constraint 213 399 7.3476 9.1845 13.7768 94.2126 Constraint 213 388 6.7791 8.4739 12.7109 94.2126 Constraint 213 380 3.9108 4.8885 7.3328 94.2126 Constraint 213 354 10.3586 12.9482 19.4223 94.2126 Constraint 213 349 11.4273 14.2841 21.4261 94.2126 Constraint 388 552 12.5618 15.7023 23.5534 94.1158 Constraint 221 552 14.8665 18.5831 27.8746 94.1158 Constraint 264 572 14.6043 18.2554 27.3831 93.9721 Constraint 472 543 11.8460 14.8075 22.2113 93.9087 Constraint 429 534 13.9502 17.4377 26.1566 93.8915 Constraint 418 534 10.5417 13.1771 19.7657 93.8915 Constraint 342 534 13.7533 17.1916 25.7875 93.8915 Constraint 298 534 11.5108 14.3885 21.5828 93.8915 Constraint 418 572 11.6390 14.5488 21.8232 93.8915 Constraint 342 572 11.8147 14.7684 22.1525 93.8915 Constraint 298 572 8.3951 10.4939 15.7409 93.8915 Constraint 406 559 8.0349 10.0437 15.0655 93.6459 Constraint 399 559 10.1171 12.6464 18.9696 93.6459 Constraint 305 559 12.8618 16.0773 24.1159 93.6459 Constraint 443 581 13.8929 17.3661 26.0491 93.5246 Constraint 435 572 13.7099 17.1373 25.7060 93.5246 Constraint 213 588 12.2722 15.3402 23.0103 93.5125 Constraint 213 581 11.2176 14.0220 21.0330 93.5125 Constraint 213 526 7.8346 9.7932 14.6898 93.5125 Constraint 526 595 7.1812 8.9765 13.4647 93.5125 Constraint 518 595 8.3978 10.4972 15.7458 93.5125 Constraint 509 595 11.9865 14.9832 22.4747 93.5125 Constraint 504 595 10.8115 13.5144 20.2716 93.5125 Constraint 497 595 8.4754 10.5943 15.8914 93.5125 Constraint 488 595 11.9012 14.8765 22.3147 93.5125 Constraint 481 595 14.0965 17.6206 26.4309 93.5125 Constraint 406 595 6.3698 7.9622 11.9434 93.5125 Constraint 399 595 4.6145 5.7681 8.6521 93.5125 Constraint 388 595 6.8154 8.5193 12.7789 93.5125 Constraint 380 595 4.8113 6.0142 9.0212 93.5125 Constraint 354 595 11.4543 14.3178 21.4768 93.5125 Constraint 349 595 9.7323 12.1654 18.2481 93.5125 Constraint 305 595 7.4055 9.2568 13.8852 93.5125 Constraint 275 595 14.8850 18.6062 27.9093 93.5125 Constraint 264 595 12.3243 15.4053 23.1080 93.5125 Constraint 257 595 10.0517 12.5647 18.8470 93.5125 Constraint 233 595 7.5987 9.4984 14.2476 93.5125 Constraint 221 595 10.0322 12.5402 18.8103 93.5125 Constraint 354 481 16.6339 20.7924 31.1885 93.2128 Constraint 248 552 15.1557 18.9446 28.4169 93.1349 Constraint 435 543 10.4577 13.0721 19.6082 93.1243 Constraint 213 472 5.2723 6.5903 9.8855 93.0091 Constraint 443 588 12.8542 16.0677 24.1016 92.9127 Constraint 388 572 14.2260 17.7825 26.6738 92.9007 Constraint 291 518 14.6992 18.3740 27.5610 92.6038 Constraint 291 497 14.1928 17.7411 26.6116 92.6038 Constraint 323 497 14.7395 18.4244 27.6366 92.6037 Constraint 323 435 14.5497 18.1872 27.2807 92.6037 Constraint 291 435 15.9518 19.9397 29.9095 92.6037 Constraint 315 406 15.2100 19.0125 28.5188 92.6037 Constraint 315 399 14.6351 18.2938 27.4408 92.6037 Constraint 315 380 14.0285 17.5356 26.3034 92.6037 Constraint 315 371 16.2730 20.3412 30.5118 92.6037 Constraint 248 315 12.1377 15.1721 22.7582 92.6037 Constraint 233 315 11.7242 14.6553 21.9829 92.6037 Constraint 221 315 16.1072 20.1340 30.2010 92.6037 Constraint 323 552 12.1243 15.1554 22.7330 92.5068 Constraint 291 552 11.9984 14.9980 22.4970 92.5068 Constraint 429 543 12.4600 15.5750 23.3624 92.4912 Constraint 418 543 8.3270 10.4088 15.6132 92.4912 Constraint 342 543 15.4290 19.2863 28.9295 92.4912 Constraint 298 543 13.2756 16.5945 24.8918 92.4912 Constraint 148 509 9.4439 11.8049 17.7074 92.3586 Constraint 472 595 12.2374 15.2968 22.9452 92.3090 Constraint 363 481 15.5415 19.4269 29.1403 92.2248 Constraint 310 504 15.4070 19.2588 28.8881 92.2247 Constraint 310 497 15.4833 19.3541 29.0311 92.2247 Constraint 310 388 16.1028 20.1285 30.1928 92.2247 Constraint 310 371 14.1768 17.7210 26.5815 92.2247 Constraint 241 310 11.0196 13.7745 20.6617 92.2247 Constraint 221 310 13.1591 16.4489 24.6734 92.2247 Constraint 213 435 4.4171 5.5213 8.2820 92.2247 Constraint 213 371 5.5997 6.9997 10.4995 92.2247 Constraint 213 363 7.7186 9.6482 14.4723 92.2247 Constraint 354 443 15.6128 19.5160 29.2740 92.2247 Constraint 283 552 15.9680 19.9599 29.9399 92.1278 Constraint 435 552 9.8586 12.3233 18.4849 92.1278 Constraint 371 552 14.6488 18.3110 27.4664 92.1278 Constraint 310 552 14.2777 17.8471 26.7706 92.1278 Constraint 305 543 13.9428 17.4285 26.1428 92.1123 Constraint 148 526 6.3471 7.9339 11.9008 92.0216 Constraint 148 518 8.6666 10.8333 16.2499 92.0216 Constraint 122 406 9.5732 11.9665 17.9497 92.0216 Constraint 264 406 16.2374 20.2967 30.4451 92.0198 Constraint 148 504 5.7811 7.2264 10.8396 91.9574 Constraint 148 481 8.6654 10.8318 16.2477 91.9574 Constraint 134 509 12.3364 15.4205 23.1307 91.9574 Constraint 122 509 10.8830 13.6038 20.4057 91.9574 Constraint 122 481 13.3182 16.6477 24.9716 91.9574 Constraint 291 534 12.4628 15.5785 23.3678 91.9035 Constraint 323 572 9.5115 11.8894 17.8341 91.9035 Constraint 315 588 12.3662 15.4577 23.1866 91.9035 Constraint 315 581 10.6909 13.3637 20.0455 91.9035 Constraint 315 572 11.1972 13.9965 20.9948 91.9035 Constraint 315 526 13.6682 17.0852 25.6279 91.9035 Constraint 291 572 11.9874 14.9842 22.4764 91.9035 Constraint 349 572 16.0001 20.0002 30.0003 91.9008 Constraint 418 559 11.6990 14.6238 21.9357 91.8985 Constraint 342 559 14.7384 18.4230 27.6344 91.8985 Constraint 298 559 10.4093 13.0117 19.5175 91.8985 Constraint 148 497 5.2338 6.5422 9.8133 91.6204 Constraint 148 488 9.0901 11.3627 17.0440 91.6204 Constraint 148 472 5.6261 7.0326 10.5489 91.6204 Constraint 142 509 12.1091 15.1363 22.7045 91.6204 Constraint 134 504 9.1247 11.4058 17.1087 91.6204 Constraint 122 518 9.2938 11.6172 17.4259 91.6204 Constraint 122 504 8.8698 11.0872 16.6308 91.6204 Constraint 122 497 9.6133 12.0166 18.0249 91.6204 Constraint 122 488 12.9945 16.2431 24.3646 91.6204 Constraint 122 472 12.2177 15.2721 22.9081 91.6204 Constraint 122 435 11.2490 14.0613 21.0919 91.6204 Constraint 122 399 8.0932 10.1165 15.1747 91.6204 Constraint 122 388 12.8185 16.0231 24.0347 91.6204 Constraint 122 380 8.7890 10.9863 16.4794 91.6204 Constraint 122 371 12.7056 15.8821 23.8231 91.6204 Constraint 122 363 10.3889 12.9861 19.4792 91.6204 Constraint 122 354 11.2924 14.1154 21.1732 91.6204 Constraint 122 349 11.1700 13.9626 20.9438 91.6204 Constraint 122 305 4.7134 5.8918 8.8376 91.6204 Constraint 122 283 10.0752 12.5940 18.8911 91.6204 Constraint 122 275 10.6663 13.3329 19.9993 91.6204 Constraint 122 264 7.0346 8.7932 13.1898 91.6204 Constraint 122 257 7.6563 9.5704 14.3556 91.6204 Constraint 122 248 9.3476 11.6845 17.5267 91.6204 Constraint 122 241 10.4895 13.1118 19.6677 91.6204 Constraint 122 233 8.1102 10.1378 15.2066 91.6204 Constraint 122 221 11.7046 14.6308 21.9461 91.6204 Constraint 291 388 16.6470 20.8088 31.2132 91.6038 Constraint 213 429 8.6059 10.7574 16.1361 91.5916 Constraint 213 418 9.5185 11.8982 17.8472 91.5916 Constraint 213 342 10.1665 12.7081 19.0622 91.5916 Constraint 213 298 14.1168 17.6460 26.4690 91.5916 Constraint 363 534 15.2105 19.0131 28.5197 91.5247 Constraint 443 534 14.9970 18.7462 28.1193 91.5246 Constraint 435 595 7.3524 9.1905 13.7857 91.5246 Constraint 371 595 8.4132 10.5165 15.7748 91.5246 Constraint 363 595 7.2220 9.0275 13.5412 91.5246 Constraint 310 595 11.0280 13.7850 20.6775 91.5246 Constraint 283 595 14.8328 18.5410 27.8115 91.5246 Constraint 248 595 12.3508 15.4384 23.1577 91.5246 Constraint 241 595 11.8442 14.8052 22.2078 91.5246 Constraint 429 552 11.8572 14.8215 22.2323 91.4947 Constraint 148 588 12.6720 15.8400 23.7599 91.3215 Constraint 148 581 10.2315 12.7894 19.1842 91.3215 Constraint 148 552 10.8071 13.5088 20.2632 91.3215 Constraint 148 406 11.9183 14.8978 22.3467 91.3215 Constraint 148 399 8.2860 10.3574 15.5362 91.3215 Constraint 142 552 12.6554 15.8192 23.7289 91.3215 Constraint 142 406 14.8981 18.6227 27.9340 91.3215 Constraint 134 581 8.4298 10.5373 15.8059 91.3215 Constraint 134 552 10.2698 12.8373 19.2559 91.3215 Constraint 134 406 12.0679 15.0849 22.6273 91.3215 Constraint 122 581 5.2274 6.5342 9.8013 91.3215 Constraint 122 552 6.7871 8.4839 12.7259 91.3215 Constraint 134 481 13.1093 16.3866 24.5799 91.2573 Constraint 305 481 15.8263 19.7829 29.6743 91.2127 Constraint 213 305 11.0624 13.8280 20.7420 91.2127 Constraint 349 443 15.4232 19.2791 28.9186 91.0212 Constraint 148 435 7.5924 9.4905 14.2358 90.9203 Constraint 148 388 9.9524 12.4406 18.6608 90.9203 Constraint 148 380 5.5159 6.8948 10.3422 90.9203 Constraint 148 371 8.0579 10.0724 15.1086 90.9203 Constraint 148 363 7.9350 9.9188 14.8782 90.9203 Constraint 148 354 8.5454 10.6818 16.0226 90.9203 Constraint 148 349 10.3838 12.9797 19.4696 90.9203 Constraint 148 305 8.9147 11.1433 16.7150 90.9203 Constraint 148 283 14.9700 18.7125 28.0688 90.9203 Constraint 148 275 13.6054 17.0067 25.5101 90.9203 Constraint 148 264 9.9329 12.4161 18.6241 90.9203 Constraint 148 257 8.6473 10.8091 16.2137 90.9203 Constraint 148 248 7.1746 8.9682 13.4523 90.9203 Constraint 148 241 5.0760 6.3450 9.5175 90.9203 Constraint 148 233 4.8681 6.0851 9.1277 90.9203 Constraint 148 221 5.2908 6.6135 9.9203 90.9203 Constraint 142 588 15.0507 18.8134 28.2200 90.9203 Constraint 142 581 11.8601 14.8251 22.2377 90.9203 Constraint 142 526 8.5587 10.6984 16.0476 90.9203 Constraint 142 518 11.9952 14.9940 22.4910 90.9203 Constraint 142 504 8.0497 10.0621 15.0931 90.9203 Constraint 142 497 9.2809 11.6012 17.4018 90.9203 Constraint 142 488 12.8331 16.0414 24.0621 90.9203 Constraint 142 481 11.3295 14.1619 21.2429 90.9203 Constraint 142 472 8.7713 10.9641 16.4462 90.9203 Constraint 142 435 11.9634 14.9543 22.4314 90.9203 Constraint 142 399 11.7122 14.6403 21.9604 90.9203 Constraint 142 388 13.7991 17.2489 25.8734 90.9203 Constraint 142 380 9.1751 11.4689 17.2033 90.9203 Constraint 142 371 11.1688 13.9610 20.9415 90.9203 Constraint 142 363 9.4687 11.8359 17.7538 90.9203 Constraint 142 354 7.3238 9.1547 13.7321 90.9203 Constraint 142 349 10.0945 12.6181 18.9271 90.9203 Constraint 142 305 7.9439 9.9298 14.8948 90.9203 Constraint 142 283 11.8376 14.7970 22.1955 90.9203 Constraint 142 275 10.0227 12.5284 18.7926 90.9203 Constraint 142 264 6.3856 7.9820 11.9731 90.9203 Constraint 142 257 6.3357 7.9196 11.8794 90.9203 Constraint 142 248 3.5074 4.3842 6.5764 90.9203 Constraint 142 241 3.8342 4.7927 7.1891 90.9203 Constraint 142 233 5.6793 7.0992 10.6488 90.9203 Constraint 142 221 7.6462 9.5578 14.3367 90.9203 Constraint 134 588 11.3505 14.1881 21.2821 90.9203 Constraint 134 526 7.1539 8.9424 13.4136 90.9203 Constraint 134 518 10.8981 13.6226 20.4339 90.9203 Constraint 134 497 9.2796 11.5994 17.3992 90.9203 Constraint 134 488 13.2929 16.6162 24.9243 90.9203 Constraint 134 472 10.7537 13.4422 20.1633 90.9203 Constraint 134 435 10.9074 13.6343 20.4514 90.9203 Constraint 134 399 9.3767 11.7209 17.5813 90.9203 Constraint 134 388 11.8402 14.8002 22.2003 90.9203 Constraint 134 380 7.3464 9.1830 13.7745 90.9203 Constraint 134 371 10.0794 12.5992 18.8988 90.9203 Constraint 134 363 7.3433 9.1791 13.7686 90.9203 Constraint 134 354 7.0314 8.7892 13.1838 90.9203 Constraint 134 349 7.8362 9.7953 14.6930 90.9203 Constraint 134 305 3.8326 4.7907 7.1861 90.9203 Constraint 134 283 9.8155 12.2694 18.4041 90.9203 Constraint 134 275 8.9390 11.1738 16.7607 90.9203 Constraint 134 264 5.4718 6.8397 10.2595 90.9203 Constraint 134 257 4.2040 5.2550 7.8825 90.9203 Constraint 134 248 5.3472 6.6840 10.0259 90.9203 Constraint 134 241 6.4106 8.0132 12.0199 90.9203 Constraint 134 233 4.2956 5.3695 8.0542 90.9203 Constraint 134 221 8.2010 10.2513 15.3770 90.9203 Constraint 122 588 9.2250 11.5312 17.2969 90.9203 Constraint 122 526 5.4238 6.7797 10.1696 90.9203 Constraint 363 572 14.8629 18.5786 27.8679 90.9127 Constraint 429 595 9.4467 11.8084 17.7126 90.8915 Constraint 418 595 8.5059 10.6324 15.9486 90.8915 Constraint 342 595 6.2026 7.7532 11.6298 90.8915 Constraint 298 595 8.8310 11.0388 16.5582 90.8915 Constraint 399 465 10.7690 13.4613 20.1919 90.6242 Constraint 388 465 12.0244 15.0305 22.5457 90.6242 Constraint 380 465 10.4525 13.0657 19.5985 90.6242 Constraint 233 465 13.2578 16.5723 24.8584 90.6242 Constraint 221 465 11.0259 13.7824 20.6736 90.6242 Constraint 283 572 15.1010 18.8763 28.3145 90.5247 Constraint 526 603 10.5762 13.2203 19.8304 90.5127 Constraint 518 603 10.2236 12.7795 19.1693 90.5127 Constraint 509 603 14.1486 17.6858 26.5287 90.5127 Constraint 504 603 13.5395 16.9244 25.3866 90.5127 Constraint 497 603 10.1161 12.6452 18.9678 90.5127 Constraint 488 603 12.8026 16.0033 24.0049 90.5127 Constraint 481 603 15.8192 19.7740 29.6609 90.5127 Constraint 406 603 7.5036 9.3795 14.0693 90.5127 Constraint 399 603 6.2964 7.8705 11.8058 90.5127 Constraint 388 603 3.9985 4.9981 7.4972 90.5127 Constraint 380 603 5.9732 7.4665 11.1998 90.5127 Constraint 354 603 13.5671 16.9588 25.4382 90.5127 Constraint 349 603 11.3685 14.2106 21.3159 90.5127 Constraint 305 603 11.4373 14.2967 21.4450 90.5127 Constraint 257 603 13.4945 16.8681 25.3022 90.5127 Constraint 233 603 10.0641 12.5801 18.8701 90.5127 Constraint 221 603 11.0014 13.7518 20.6277 90.5127 Constraint 213 534 11.0758 13.8448 20.7672 90.5125 Constraint 291 543 15.1321 18.9151 28.3727 90.5033 Constraint 264 559 15.2546 19.0682 28.6023 90.4314 Constraint 207 518 11.4632 14.3290 21.4935 90.2016 Constraint 207 509 13.1690 16.4613 24.6919 90.2016 Constraint 207 504 11.1653 13.9566 20.9348 90.2016 Constraint 207 497 7.7429 9.6786 14.5179 90.2016 Constraint 207 488 9.9626 12.4532 18.6798 90.2016 Constraint 207 481 11.3374 14.1718 21.2576 90.2016 Constraint 207 406 13.8176 17.2720 25.9079 90.2016 Constraint 207 399 10.2015 12.7518 19.1278 90.2016 Constraint 207 388 6.4422 8.0527 12.0791 90.2016 Constraint 207 380 6.2150 7.7688 11.6532 90.2016 Constraint 207 354 11.4472 14.3090 21.4635 90.2016 Constraint 207 349 12.2966 15.3708 23.0562 90.2016 Constraint 429 572 14.6872 18.3589 27.5384 90.1534 Constraint 443 543 14.4786 18.0982 27.1473 90.1243 Constraint 291 559 13.2476 16.5595 24.8392 89.9106 Constraint 264 543 15.8497 19.8121 29.7181 89.8977 Constraint 465 581 15.0728 18.8410 28.2615 89.6243 Constraint 323 518 14.6316 18.2895 27.4342 89.6038 Constraint 291 509 15.8099 19.7624 29.6436 89.6038 Constraint 241 315 14.5745 18.2181 27.3272 89.6037 Constraint 342 443 14.3880 17.9850 26.9776 89.6037 Constraint 315 552 13.6733 17.0916 25.6374 89.5068 Constraint 456 588 12.8933 16.1166 24.1749 89.5028 Constraint 456 581 12.2770 15.3462 23.0193 89.5028 Constraint 456 526 8.5146 10.6433 15.9649 89.5028 Constraint 388 456 8.2635 10.3293 15.4940 89.5028 Constraint 380 456 7.5410 9.4262 14.1393 89.5028 Constraint 371 456 9.7867 12.2334 18.3500 89.5028 Constraint 363 456 12.5967 15.7459 23.6189 89.5028 Constraint 342 456 14.6132 18.2664 27.3997 89.5028 Constraint 241 456 12.8012 16.0015 24.0022 89.5028 Constraint 233 456 11.6926 14.6158 21.9237 89.5028 Constraint 221 456 9.9918 12.4897 18.7346 89.5028 Constraint 207 526 11.8193 14.7741 22.1612 89.5014 Constraint 148 534 9.1690 11.4613 17.1919 89.3586 Constraint 241 418 16.2258 20.2823 30.4235 89.3103 Constraint 241 406 16.3328 20.4160 30.6240 89.3103 Constraint 472 603 13.8035 17.2544 25.8816 89.3092 Constraint 213 443 6.8087 8.5109 12.7663 89.2247 Constraint 363 552 13.8613 17.3266 25.9899 89.1279 Constraint 443 552 14.1288 17.6610 26.4914 89.1278 Constraint 257 543 16.6810 20.8513 31.2769 89.1123 Constraint 213 543 12.3360 15.4200 23.1301 89.1122 Constraint 122 429 14.6940 18.3675 27.5513 88.9994 Constraint 122 418 12.1869 15.2337 22.8505 88.9994 Constraint 122 342 7.1335 8.9169 13.3753 88.9994 Constraint 122 323 7.9566 9.9458 14.9187 88.9994 Constraint 122 298 4.4813 5.6016 8.4024 88.9994 Constraint 122 291 5.7548 7.1935 10.7903 88.9994 Constraint 207 472 7.8969 9.8711 14.8066 88.9981 Constraint 134 534 10.1028 12.6286 18.9428 88.9574 Constraint 241 552 15.0564 18.8205 28.2307 88.9314 Constraint 371 572 16.5507 20.6884 31.0326 88.9128 Constraint 323 559 13.4327 16.7908 25.1863 88.9106 Constraint 323 595 7.6796 9.5995 14.3992 88.9035 Constraint 315 595 11.1120 13.8901 20.8351 88.9035 Constraint 291 595 10.9719 13.7149 20.5724 88.9035 Constraint 148 418 11.4761 14.3452 21.5177 88.7004 Constraint 134 543 12.7458 15.9323 23.8985 88.6585 Constraint 380 559 14.1687 17.7108 26.5662 88.6459 Constraint 371 465 12.2734 15.3417 23.0126 88.6363 Constraint 241 465 12.8225 16.0281 24.0421 88.6363 Constraint 122 443 15.4913 19.3642 29.0463 88.6204 Constraint 142 534 10.4432 13.0540 19.5810 88.6204 Constraint 122 534 7.6651 9.5813 14.3720 88.6204 Constraint 122 310 8.1462 10.1828 15.2742 88.6204 Constraint 435 603 7.1054 8.8817 13.3226 88.5248 Constraint 371 603 7.6845 9.6057 14.4085 88.5248 Constraint 363 603 8.1825 10.2281 15.3422 88.5248 Constraint 310 603 14.6566 18.3207 27.4811 88.5248 Constraint 248 603 15.6019 19.5024 29.2536 88.5248 Constraint 241 603 14.3359 17.9199 26.8798 88.5248 Constraint 443 595 10.7197 13.3996 20.0994 88.5246 Constraint 310 534 15.3543 19.1929 28.7894 88.5246 Constraint 354 456 15.7288 19.6610 29.4915 88.5029 Constraint 207 581 14.3712 17.9640 26.9460 88.5015 Constraint 148 543 11.5813 14.4766 21.7149 88.3215 Constraint 142 543 13.8166 17.2708 25.9061 88.3215 Constraint 148 572 14.6927 18.3659 27.5488 88.3215 Constraint 134 572 12.2369 15.2961 22.9442 88.3215 Constraint 122 572 8.5386 10.6733 16.0099 88.3215 Constraint 148 465 9.1598 11.4497 17.1746 88.2993 Constraint 148 456 8.5196 10.6495 15.9742 88.2993 Constraint 148 429 12.0390 15.0487 22.5731 88.2993 Constraint 148 342 8.7392 10.9241 16.3861 88.2993 Constraint 148 323 12.7974 15.9967 23.9951 88.2993 Constraint 148 298 11.5934 14.4917 21.7376 88.2993 Constraint 148 291 11.0778 13.8473 20.7709 88.2993 Constraint 142 465 12.8595 16.0744 24.1116 88.2993 Constraint 142 456 12.8805 16.1006 24.1509 88.2993 Constraint 142 429 16.3588 20.4485 30.6728 88.2993 Constraint 142 418 15.3524 19.1905 28.7857 88.2993 Constraint 142 342 8.7921 10.9901 16.4851 88.2993 Constraint 142 323 12.5070 15.6337 23.4505 88.2993 Constraint 142 298 10.5279 13.1598 19.7398 88.2993 Constraint 142 291 8.5970 10.7462 16.1193 88.2993 Constraint 134 465 14.2759 17.8449 26.7673 88.2993 Constraint 134 456 12.9236 16.1545 24.2317 88.2993 Constraint 134 429 14.8585 18.5732 27.8598 88.2993 Constraint 134 418 13.5804 16.9755 25.4633 88.2993 Constraint 134 342 5.0197 6.2746 9.4120 88.2993 Constraint 134 323 8.3083 10.3854 15.5781 88.2993 Constraint 134 298 6.7673 8.4591 12.6887 88.2993 Constraint 134 291 5.8983 7.3728 11.0593 88.2993 Constraint 122 465 15.0659 18.8323 28.2485 88.2993 Constraint 122 456 13.3142 16.6427 24.9641 88.2993 Constraint 207 435 6.2979 7.8723 11.8085 88.2136 Constraint 207 371 4.5196 5.6495 8.4742 88.2136 Constraint 207 363 8.4021 10.5026 15.7540 88.2136 Constraint 213 552 11.6640 14.5800 21.8700 88.1158 Constraint 207 588 14.3981 17.9976 26.9964 88.1003 Constraint 257 559 16.3187 20.3984 30.5976 87.9448 Constraint 349 552 16.0169 20.0211 30.0316 87.9244 Constraint 148 443 10.8808 13.6010 20.4015 87.9203 Constraint 142 443 15.2532 19.0665 28.5998 87.9203 Constraint 134 443 14.4925 18.1157 27.1735 87.9203 Constraint 122 543 9.7600 12.2000 18.3000 87.9203 Constraint 148 310 12.0752 15.0940 22.6410 87.9203 Constraint 142 310 9.8990 12.3737 18.5605 87.9203 Constraint 134 310 6.8761 8.5951 12.8927 87.9203 Constraint 481 588 16.4893 20.6116 30.9174 87.9007 Constraint 429 603 7.0916 8.8644 13.2967 87.8917 Constraint 418 603 8.0510 10.0637 15.0956 87.8917 Constraint 342 603 9.2459 11.5574 17.3361 87.8917 Constraint 298 603 13.1102 16.3877 24.5816 87.8917 Constraint 213 572 15.5172 19.3965 29.0947 87.7744 Constraint 465 552 13.6774 17.0967 25.6451 87.6242 Constraint 465 543 11.8791 14.8489 22.2733 87.6242 Constraint 465 534 11.2826 14.1033 21.1550 87.6242 Constraint 342 481 16.4836 20.6045 30.9067 87.5918 Constraint 207 429 8.9257 11.1572 16.7358 87.5805 Constraint 207 418 11.4931 14.3664 21.5496 87.5805 Constraint 207 342 12.2892 15.3615 23.0423 87.5805 Constraint 534 603 14.4917 18.1146 27.1719 87.5127 Constraint 213 595 8.3819 10.4773 15.7160 87.5125 Constraint 148 559 14.8568 18.5710 27.8565 87.4478 Constraint 134 559 13.3118 16.6398 24.9597 87.4478 Constraint 122 559 9.1974 11.4967 17.2451 87.4478 Constraint 310 559 15.6791 19.5988 29.3983 87.3580 Constraint 207 305 14.0163 17.5204 26.2806 87.2016 Constraint 315 559 14.2633 17.8291 26.7436 86.9106 Constraint 488 572 15.8445 19.8056 29.7083 86.7744 Constraint 435 559 14.1291 17.6613 26.4920 86.6580 Constraint 213 291 14.2705 17.8381 26.7572 86.6038 Constraint 213 323 14.1327 17.6659 26.4989 86.6037 Constraint 323 504 15.4728 19.3410 29.0114 86.6037 Constraint 323 418 15.5533 19.4416 29.1624 86.6037 Constraint 305 456 15.2281 19.0351 28.5526 86.5028 Constraint 456 552 11.2637 14.0797 21.1195 86.5028 Constraint 456 543 10.4461 13.0577 19.5865 86.5028 Constraint 456 534 10.7068 13.3835 20.0752 86.5028 Constraint 207 534 15.0384 18.7980 28.1970 86.5014 Constraint 310 518 16.4458 20.5572 30.8358 86.2248 Constraint 213 310 14.6089 18.2612 27.3917 86.2247 Constraint 310 435 16.4506 20.5632 30.8449 86.2247 Constraint 221 543 16.0473 20.0592 30.0887 86.1239 Constraint 122 315 8.6783 10.8479 16.2718 85.9994 Constraint 323 603 10.8432 13.5540 20.3311 85.9038 Constraint 315 603 14.7070 18.3837 27.5755 85.9038 Constraint 291 603 15.2449 19.0562 28.5843 85.9038 Constraint 323 534 14.8403 18.5503 27.8255 85.9036 Constraint 363 465 14.8341 18.5426 27.8139 85.6364 Constraint 122 213 10.5289 13.1612 19.7418 85.6204 Constraint 354 534 16.3333 20.4166 30.6250 85.5351 Constraint 443 603 8.6042 10.7553 16.1330 85.5248 Constraint 349 456 16.3729 20.4661 30.6992 85.5030 Constraint 248 456 15.4316 19.2895 28.9342 85.5030 Constraint 264 603 16.3316 20.4146 30.6218 85.3094 Constraint 148 315 14.4991 18.1239 27.1858 85.2993 Constraint 142 315 13.0044 16.2554 24.3832 85.2993 Constraint 134 315 9.2930 11.6163 17.4244 85.2993 Constraint 207 443 5.9054 7.3817 11.0726 85.2136 Constraint 371 543 16.3262 20.4077 30.6116 85.1134 Constraint 148 213 4.2211 5.2764 7.9146 84.9203 Constraint 142 213 8.5438 10.6798 16.0197 84.9203 Constraint 134 213 8.6504 10.8129 16.2194 84.9203 Constraint 148 595 8.5493 10.6866 16.0299 84.9203 Constraint 142 595 11.0246 13.7808 20.6712 84.9203 Constraint 134 595 7.5326 9.4157 14.1236 84.9203 Constraint 122 595 7.0441 8.8051 13.2076 84.9203 Constraint 248 465 15.6814 19.6017 29.4026 84.6365 Constraint 213 465 7.3496 9.1870 13.7804 84.6242 Constraint 465 595 13.9612 17.4515 26.1773 84.6242 Constraint 283 588 16.7119 20.8899 31.3348 84.5247 Constraint 213 603 9.2773 11.5966 17.3950 84.5127 Constraint 298 472 15.9886 19.9857 29.9785 84.3881 Constraint 66 581 5.9712 7.4639 11.1959 84.2932 Constraint 66 552 8.4854 10.6068 15.9102 84.2932 Constraint 66 534 12.2453 15.3066 22.9599 84.2932 Constraint 66 526 10.5719 13.2149 19.8224 84.2932 Constraint 66 518 13.0975 16.3719 24.5578 84.2932 Constraint 66 504 14.8212 18.5264 27.7897 84.2932 Constraint 66 497 14.8587 18.5734 27.8601 84.2932 Constraint 66 418 14.1643 17.7054 26.5581 84.2932 Constraint 66 406 9.9455 12.4318 18.6478 84.2932 Constraint 66 399 10.8633 13.5791 20.3687 84.2932 Constraint 66 388 15.3168 19.1460 28.7191 84.2932 Constraint 66 380 12.8480 16.0600 24.0899 84.2932 Constraint 66 349 13.9720 17.4649 26.1974 84.2932 Constraint 66 342 9.7641 12.2051 18.3076 84.2932 Constraint 66 305 8.0689 10.0861 15.1291 84.2932 Constraint 66 298 5.2460 6.5575 9.8362 84.2932 Constraint 66 275 13.5030 16.8788 25.3181 84.2932 Constraint 66 264 11.5943 14.4929 21.7394 84.2932 Constraint 66 257 11.8460 14.8075 22.2113 84.2932 Constraint 66 233 13.0490 16.3112 24.4668 84.2932 Constraint 58 588 6.0591 7.5739 11.3608 84.2932 Constraint 58 581 4.3373 5.4216 8.1324 84.2932 Constraint 58 552 7.7620 9.7025 14.5537 84.2932 Constraint 58 543 11.9796 14.9745 22.4618 84.2932 Constraint 58 534 11.3660 14.2075 21.3112 84.2932 Constraint 58 526 8.6236 10.7795 16.1692 84.2932 Constraint 58 518 11.2324 14.0405 21.0607 84.2932 Constraint 58 509 14.0593 17.5741 26.3611 84.2932 Constraint 58 504 12.8588 16.0735 24.1103 84.2932 Constraint 58 497 12.2451 15.3064 22.9596 84.2932 Constraint 58 429 14.2529 17.8162 26.7243 84.2932 Constraint 58 418 12.1072 15.1340 22.7011 84.2932 Constraint 58 406 8.4215 10.5268 15.7902 84.2932 Constraint 58 399 8.3444 10.4306 15.6458 84.2932 Constraint 58 388 12.0010 15.0013 22.5019 84.2932 Constraint 58 380 9.4853 11.8567 17.7850 84.2932 Constraint 58 349 10.9425 13.6782 20.5172 84.2932 Constraint 58 342 6.6879 8.3599 12.5399 84.2932 Constraint 58 305 5.7459 7.1823 10.7735 84.2932 Constraint 58 298 4.8575 6.0719 9.1078 84.2932 Constraint 58 264 10.4070 13.0087 19.5131 84.2932 Constraint 58 257 9.5318 11.9147 17.8720 84.2932 Constraint 58 233 9.8150 12.2687 18.4031 84.2932 Constraint 51 588 4.4565 5.5706 8.3560 84.2932 Constraint 51 581 6.0363 7.5454 11.3180 84.2932 Constraint 51 552 9.4180 11.7725 17.6588 84.2932 Constraint 51 543 13.6912 17.1141 25.6711 84.2932 Constraint 51 534 13.9912 17.4889 26.2334 84.2932 Constraint 51 526 10.9741 13.7176 20.5764 84.2932 Constraint 51 518 12.5305 15.6631 23.4947 84.2932 Constraint 51 504 15.3050 19.1312 28.6968 84.2932 Constraint 51 497 13.8434 17.3043 25.9564 84.2932 Constraint 51 429 13.6370 17.0462 25.5694 84.2932 Constraint 51 418 11.9782 14.9727 22.4591 84.2932 Constraint 51 406 8.1978 10.2473 15.3709 84.2932 Constraint 51 399 8.9930 11.2412 16.8619 84.2932 Constraint 51 388 11.3988 14.2485 21.3727 84.2932 Constraint 51 380 10.3578 12.9472 19.4208 84.2932 Constraint 51 354 14.6288 18.2860 27.4289 84.2932 Constraint 51 349 11.9223 14.9028 22.3543 84.2932 Constraint 51 342 8.2416 10.3020 15.4530 84.2932 Constraint 51 305 8.6774 10.8467 16.2701 84.2932 Constraint 51 298 8.1828 10.2285 15.3427 84.2932 Constraint 51 264 13.7811 17.2264 25.8396 84.2932 Constraint 51 257 12.1416 15.1770 22.7655 84.2932 Constraint 51 233 11.7272 14.6590 21.9885 84.2932 Constraint 51 221 14.9516 18.6895 28.0342 84.2932 Constraint 257 481 16.3022 20.3777 30.5666 84.2128 Constraint 264 388 16.9756 21.2195 31.8292 84.2128 Constraint 66 148 14.0510 17.5637 26.3456 84.0375 Constraint 66 142 14.1316 17.6645 26.4968 84.0375 Constraint 66 134 10.2725 12.8406 19.2609 84.0375 Constraint 58 148 11.1983 13.9979 20.9968 83.6363 Constraint 58 142 11.8320 14.7900 22.1850 83.6363 Constraint 58 134 7.7088 9.6360 14.4540 83.6363 Constraint 213 456 5.5757 6.9696 10.4545 83.5028 Constraint 456 595 10.6963 13.3704 20.0556 83.5028 Constraint 207 595 10.7709 13.4636 20.1954 83.5014 Constraint 142 572 15.7916 19.7395 29.6092 83.3216 Constraint 354 552 16.4879 20.6099 30.9149 83.3103 Constraint 66 588 7.8442 9.8053 14.7079 83.2993 Constraint 66 543 12.5311 15.6639 23.4959 83.2993 Constraint 66 435 15.1014 18.8768 28.3152 83.2993 Constraint 66 363 13.8259 17.2824 25.9236 83.2993 Constraint 66 323 6.9785 8.7232 13.0848 83.2993 Constraint 66 291 8.6885 10.8607 16.2910 83.2993 Constraint 66 283 11.4296 14.2870 21.4304 83.2993 Constraint 66 248 15.0610 18.8262 28.2393 83.2993 Constraint 58 435 12.1634 15.2043 22.8064 83.2993 Constraint 58 363 10.3557 12.9447 19.4170 83.2993 Constraint 58 323 5.2077 6.5096 9.7644 83.2993 Constraint 58 291 8.0206 10.0258 15.0387 83.2993 Constraint 58 283 11.4896 14.3620 21.5430 83.2993 Constraint 58 248 12.7299 15.9124 23.8686 83.2993 Constraint 51 456 15.8142 19.7677 29.6516 83.2993 Constraint 51 435 12.6253 15.7816 23.6725 83.2993 Constraint 51 371 13.2361 16.5452 24.8178 83.2993 Constraint 51 363 11.0299 13.7874 20.6811 83.2993 Constraint 51 323 6.2701 7.8377 11.7565 83.2993 Constraint 51 291 11.3907 14.2383 21.3575 83.2993 Constraint 51 248 15.6296 19.5370 29.3055 83.2993 Constraint 51 148 13.5568 16.9460 25.4190 83.2993 Constraint 51 142 14.9287 18.6609 27.9913 83.2993 Constraint 51 134 10.7584 13.4480 20.1721 83.2993 Constraint 51 122 8.9015 11.1269 16.6904 83.2993 Constraint 44 588 5.7934 7.2418 10.8626 83.2993 Constraint 44 581 7.2894 9.1118 13.6677 83.2993 Constraint 44 552 10.7775 13.4719 20.2079 83.2993 Constraint 44 526 10.8390 13.5488 20.3232 83.2993 Constraint 44 518 12.5183 15.6479 23.4718 83.2993 Constraint 44 497 12.6558 15.8198 23.7297 83.2993 Constraint 44 456 14.4648 18.0810 27.1215 83.2993 Constraint 44 435 11.0735 13.8419 20.7628 83.2993 Constraint 44 429 12.4152 15.5191 23.2786 83.2993 Constraint 44 418 11.9058 14.8822 22.3234 83.2993 Constraint 44 406 9.2957 11.6196 17.4294 83.2993 Constraint 44 399 8.5694 10.7117 16.0676 83.2993 Constraint 44 388 8.8891 11.1113 16.6670 83.2993 Constraint 44 380 8.0020 10.0026 15.0038 83.2993 Constraint 44 371 9.9830 12.4787 18.7181 83.2993 Constraint 44 363 7.6232 9.5290 14.2934 83.2993 Constraint 44 354 11.7387 14.6734 22.0101 83.2993 Constraint 44 349 8.7472 10.9340 16.4010 83.2993 Constraint 44 342 5.6584 7.0730 10.6095 83.2993 Constraint 44 323 5.6558 7.0697 10.6046 83.2993 Constraint 44 305 7.5523 9.4403 14.1605 83.2993 Constraint 44 298 8.8571 11.0714 16.6071 83.2993 Constraint 44 291 11.1706 13.9632 20.9448 83.2993 Constraint 44 264 13.0061 16.2576 24.3864 83.2993 Constraint 44 257 10.2430 12.8038 19.2057 83.2993 Constraint 44 248 13.5768 16.9710 25.4565 83.2993 Constraint 44 241 13.6657 17.0821 25.6231 83.2993 Constraint 44 233 9.0614 11.3268 16.9902 83.2993 Constraint 44 221 12.0407 15.0509 22.5763 83.2993 Constraint 44 148 11.6583 14.5729 21.8593 83.2993 Constraint 44 142 13.2331 16.5414 24.8121 83.2993 Constraint 44 134 9.2209 11.5261 17.2892 83.2993 Constraint 44 122 9.0145 11.2681 16.9022 83.2993 Constraint 58 354 12.7392 15.9240 23.8860 83.2932 Constraint 58 221 13.4489 16.8111 25.2167 83.2932 Constraint 363 543 16.4648 20.5810 30.8716 83.1133 Constraint 315 534 15.8318 19.7898 29.6847 82.9036 Constraint 122 207 14.2921 17.8652 26.7977 82.6204 Constraint 283 534 16.1761 20.2201 30.3302 82.5246 Constraint 142 559 15.8176 19.7720 29.6580 82.4478 Constraint 456 572 16.0396 20.0495 30.0742 82.2994 Constraint 58 456 14.9607 18.7009 28.0514 82.2993 Constraint 58 371 12.9162 16.1453 24.2179 82.2993 Constraint 58 241 13.6439 17.0549 25.5824 82.2993 Constraint 44 504 14.6682 18.3353 27.5029 82.2993 Constraint 35 588 5.8098 7.2622 10.8933 82.2993 Constraint 35 581 9.3311 11.6638 17.4957 82.2993 Constraint 35 552 12.3741 15.4676 23.2014 82.2993 Constraint 35 526 12.8572 16.0715 24.1073 82.2993 Constraint 35 518 13.4453 16.8066 25.2099 82.2993 Constraint 35 497 13.8304 17.2880 25.9321 82.2993 Constraint 35 456 14.6986 18.3732 27.5598 82.2993 Constraint 35 435 11.2234 14.0292 21.0438 82.2993 Constraint 35 429 11.2130 14.0162 21.0243 82.2993 Constraint 35 418 11.4647 14.3308 21.4963 82.2993 Constraint 35 406 9.4298 11.7873 17.6809 82.2993 Constraint 35 399 9.3003 11.6254 17.4381 82.2993 Constraint 35 388 8.0400 10.0500 15.0750 82.2993 Constraint 35 380 9.1615 11.4519 17.1778 82.2993 Constraint 35 371 10.3887 12.9859 19.4789 82.2993 Constraint 35 363 9.2696 11.5869 17.3804 82.2993 Constraint 35 354 14.2495 17.8118 26.7178 82.2993 Constraint 35 349 11.0377 13.7971 20.6957 82.2993 Constraint 35 342 8.9646 11.2057 16.8086 82.2993 Constraint 35 323 9.0565 11.3206 16.9810 82.2993 Constraint 35 305 11.2206 14.0257 21.0385 82.2993 Constraint 35 298 12.3538 15.4423 23.1634 82.2993 Constraint 35 257 13.6147 17.0184 25.5276 82.2993 Constraint 35 233 11.5443 14.4304 21.6455 82.2993 Constraint 35 221 13.5344 16.9180 25.3771 82.2993 Constraint 35 148 13.8503 17.3129 25.9693 82.2993 Constraint 35 142 16.1820 20.2275 30.3413 82.2993 Constraint 35 134 12.4720 15.5901 23.3851 82.2993 Constraint 35 122 12.2045 15.2556 22.8834 82.2993 Constraint 51 283 14.3768 17.9710 26.9566 82.2993 Constraint 241 543 16.2415 20.3019 30.4529 82.2993 Constraint 58 488 15.5143 19.3929 29.0893 82.2932 Constraint 66 354 15.6990 19.6238 29.4357 82.2932 Constraint 66 509 15.4373 19.2967 28.9450 82.2932 Constraint 58 275 12.5382 15.6728 23.5091 82.2932 Constraint 97 342 13.8388 17.2985 25.9478 82.2922 Constraint 97 305 10.9073 13.6341 20.4511 82.2922 Constraint 97 257 12.9344 16.1680 24.2520 82.2922 Constraint 97 248 14.0156 17.5194 26.2792 82.2922 Constraint 148 603 11.2259 14.0323 21.0485 81.9205 Constraint 142 603 14.4728 18.0910 27.1365 81.9205 Constraint 134 603 11.4599 14.3249 21.4874 81.9205 Constraint 122 603 11.4806 14.3508 21.5262 81.9205 Constraint 148 207 7.9873 9.9841 14.9762 81.9203 Constraint 142 207 11.7144 14.6431 21.9646 81.9203 Constraint 134 207 11.9958 14.9947 22.4921 81.9203 Constraint 465 603 14.5212 18.1515 27.2273 81.6245 Constraint 323 543 15.8760 19.8450 29.7674 81.5034 Constraint 51 241 16.0985 20.1232 30.1847 81.2993 Constraint 44 543 14.6956 18.3695 27.5542 81.2993 Constraint 44 534 14.4637 18.0797 27.1195 81.2993 Constraint 35 291 14.7956 18.4945 27.7417 81.2993 Constraint 106 497 13.3013 16.6266 24.9399 81.2957 Constraint 106 399 12.6185 15.7731 23.6596 81.2957 Constraint 106 380 13.9352 17.4190 26.1285 81.2957 Constraint 106 342 11.9402 14.9253 22.3879 81.2957 Constraint 106 305 9.0248 11.2810 16.9214 81.2957 Constraint 106 264 8.0317 10.0397 15.0595 81.2957 Constraint 106 257 10.9320 13.6650 20.4974 81.2957 Constraint 106 248 11.7994 14.7493 22.1239 81.2957 Constraint 106 241 13.6148 17.0185 25.5278 81.2957 Constraint 106 233 12.6812 15.8515 23.7773 81.2957 Constraint 51 509 15.9269 19.9087 29.8630 81.2932 Constraint 58 572 5.8885 7.3606 11.0409 81.2932 Constraint 51 572 5.8657 7.3321 10.9982 81.2932 Constraint 92 342 14.1866 17.7333 26.6000 81.2922 Constraint 207 465 8.8575 11.0719 16.6078 81.2872 Constraint 264 481 16.1520 20.1900 30.2850 81.2128 Constraint 207 552 15.1159 18.8949 28.3424 81.1048 Constraint 465 588 16.3964 20.4955 30.7432 80.6243 Constraint 456 603 10.6336 13.2920 19.9381 80.5030 Constraint 207 456 7.3375 9.1719 13.7579 80.5028 Constraint 207 603 10.0314 12.5392 18.8088 80.5017 Constraint 44 509 15.9883 19.9853 29.9780 80.2993 Constraint 66 559 8.0728 10.0910 15.1364 80.2993 Constraint 58 559 9.2945 11.6182 17.4273 80.2993 Constraint 51 559 10.5138 13.1423 19.7134 80.2993 Constraint 51 443 15.4963 19.3704 29.0556 80.2993 Constraint 44 443 13.3863 16.7329 25.0993 80.2993 Constraint 66 572 4.7508 5.9385 8.9078 80.2993 Constraint 66 315 7.5671 9.4588 14.1882 80.2993 Constraint 66 310 9.9596 12.4495 18.6743 80.2993 Constraint 58 315 7.3820 9.2276 13.8413 80.2993 Constraint 58 310 8.6530 10.8162 16.2244 80.2993 Constraint 51 315 9.2707 11.5884 17.3826 80.2993 Constraint 51 310 11.0943 13.8679 20.8018 80.2993 Constraint 44 572 9.0899 11.3624 17.0436 80.2993 Constraint 44 315 9.4421 11.8027 17.7040 80.2993 Constraint 44 310 10.0702 12.5877 18.8816 80.2993 Constraint 97 588 14.7926 18.4908 27.7361 80.2993 Constraint 97 581 10.5859 13.2324 19.8486 80.2993 Constraint 97 552 10.3576 12.9470 19.4204 80.2993 Constraint 97 526 11.0266 13.7833 20.6749 80.2993 Constraint 97 518 14.3176 17.8970 26.8455 80.2993 Constraint 97 504 13.2876 16.6095 24.9142 80.2993 Constraint 97 406 14.5662 18.2077 27.3116 80.2993 Constraint 97 399 14.5725 18.2156 27.3234 80.2993 Constraint 97 298 7.9764 9.9705 14.9558 80.2993 Constraint 97 291 8.4914 10.6142 15.9213 80.2993 Constraint 97 283 10.5543 13.1929 19.7893 80.2993 Constraint 97 275 12.3881 15.4852 23.2277 80.2993 Constraint 97 264 9.6050 12.0063 18.0094 80.2993 Constraint 92 588 13.8591 17.3238 25.9857 80.2993 Constraint 92 581 10.0173 12.5216 18.7824 80.2993 Constraint 92 552 10.0245 12.5306 18.7958 80.2993 Constraint 92 526 11.7459 14.6824 22.0236 80.2993 Constraint 92 518 14.7119 18.3899 27.5849 80.2993 Constraint 92 504 14.6716 18.3395 27.5092 80.2993 Constraint 92 406 13.9119 17.3898 26.0848 80.2993 Constraint 92 399 14.5616 18.2021 27.3031 80.2993 Constraint 92 305 11.2121 14.0151 21.0226 80.2993 Constraint 92 298 7.8291 9.7864 14.6796 80.2993 Constraint 92 291 9.3650 11.7063 17.5594 80.2993 Constraint 92 283 11.2952 14.1190 21.1785 80.2993 Constraint 92 264 11.2253 14.0316 21.0474 80.2993 Constraint 106 588 13.5044 16.8805 25.3207 80.2993 Constraint 106 581 9.1049 11.3811 17.0717 80.2993 Constraint 106 552 8.8153 11.0192 16.5288 80.2993 Constraint 106 526 8.7258 10.9072 16.3608 80.2993 Constraint 106 518 12.2955 15.3693 23.0540 80.2993 Constraint 106 509 12.3414 15.4267 23.1401 80.2993 Constraint 106 504 10.8748 13.5935 20.3902 80.2993 Constraint 106 406 13.1215 16.4019 24.6029 80.2993 Constraint 106 298 6.8591 8.5738 12.8608 80.2993 Constraint 106 291 7.1288 8.9110 13.3665 80.2993 Constraint 106 283 9.9816 12.4771 18.7156 80.2993 Constraint 106 275 11.2694 14.0868 21.1302 80.2993 Constraint 106 323 11.7129 14.6411 21.9617 80.2957 Constraint 106 310 10.7597 13.4497 20.1745 80.2957 Constraint 305 443 15.8309 19.7886 29.6829 80.2247 Constraint 388 633 9.1277 11.4096 17.1144 80.0947 Constraint 380 633 9.4501 11.8126 17.7190 80.0947 Constraint 349 633 6.9279 8.6598 12.9898 80.0947 Constraint 233 633 8.9736 11.2170 16.8255 80.0947 Constraint 221 633 9.2041 11.5051 17.2577 80.0947 Constraint 488 559 14.1157 17.6446 26.4669 79.7814 Constraint 75 148 12.5423 15.6779 23.5168 79.7376 Constraint 75 142 12.3744 15.4680 23.2021 79.7376 Constraint 106 572 10.7788 13.4735 20.2103 79.7004 Constraint 291 472 15.5006 19.3757 29.0636 79.4004 Constraint 173 497 11.2740 14.0925 21.1388 79.3901 Constraint 173 443 10.1004 12.6255 18.9382 79.3901 Constraint 173 435 11.2787 14.0984 21.1476 79.3901 Constraint 173 388 12.6948 15.8685 23.8027 79.3901 Constraint 173 380 12.5001 15.6251 23.4376 79.3901 Constraint 173 371 11.0946 13.8682 20.8023 79.3901 Constraint 168 504 12.0535 15.0669 22.6004 79.3901 Constraint 168 497 10.0209 12.5261 18.7891 79.3901 Constraint 168 488 10.5629 13.2036 19.8054 79.3901 Constraint 168 481 10.4147 13.0184 19.5276 79.3901 Constraint 168 443 9.9670 12.4588 18.6882 79.3901 Constraint 168 435 10.4326 13.0408 19.5612 79.3901 Constraint 168 388 12.3450 15.4313 23.1469 79.3901 Constraint 168 380 11.5011 14.3764 21.5646 79.3901 Constraint 168 371 10.4788 13.0986 19.6478 79.3901 Constraint 168 241 11.6034 14.5042 21.7563 79.3901 Constraint 35 241 16.0947 20.1184 30.1776 79.2994 Constraint 58 443 15.6923 19.6154 29.4231 79.2993 Constraint 35 443 12.5165 15.6457 23.4685 79.2993 Constraint 35 572 10.4724 13.0905 19.6358 79.2993 Constraint 35 315 12.8042 16.0052 24.0078 79.2993 Constraint 35 310 13.6323 17.0403 25.5605 79.2993 Constraint 97 543 12.1255 15.1569 22.7354 79.2993 Constraint 97 534 9.9800 12.4750 18.7125 79.2993 Constraint 92 543 12.3221 15.4026 23.1040 79.2993 Constraint 92 534 10.9857 13.7321 20.5981 79.2993 Constraint 92 323 12.4238 15.5297 23.2945 79.2993 Constraint 92 275 13.5724 16.9656 25.4483 79.2993 Constraint 92 257 13.9519 17.4399 26.1599 79.2993 Constraint 106 315 10.7210 13.4012 20.1018 79.2993 Constraint 75 588 9.2754 11.5943 17.3914 79.2932 Constraint 75 581 5.5587 6.9484 10.4226 79.2932 Constraint 75 552 6.5788 8.2235 12.3353 79.2932 Constraint 75 543 10.0999 12.6248 18.9373 79.2932 Constraint 75 534 9.2040 11.5049 17.2574 79.2932 Constraint 75 526 8.4226 10.5282 15.7923 79.2932 Constraint 75 518 11.2799 14.0999 21.1499 79.2932 Constraint 75 509 12.9173 16.1466 24.2199 79.2932 Constraint 75 504 12.2913 15.3642 23.0462 79.2932 Constraint 75 406 9.7172 12.1465 18.2197 79.2932 Constraint 75 399 10.1970 12.7462 19.1193 79.2932 Constraint 75 349 14.7220 18.4025 27.6037 79.2932 Constraint 75 342 10.4715 13.0894 19.6341 79.2932 Constraint 75 305 8.1013 10.1267 15.1900 79.2932 Constraint 75 298 5.2647 6.5809 9.8714 79.2932 Constraint 75 264 10.3803 12.9754 19.4631 79.2932 Constraint 75 257 11.6202 14.5253 21.7879 79.2932 Constraint 75 233 12.6325 15.7907 23.6860 79.2932 Constraint 51 275 15.3717 19.2146 28.8219 79.2932 Constraint 97 233 14.9568 18.6960 28.0441 79.2922 Constraint 97 310 12.2869 15.3586 23.0379 79.2922 Constraint 84 518 14.0790 17.5987 26.3981 79.2872 Constraint 84 509 15.1123 18.8904 28.3356 79.2872 Constraint 84 504 14.3342 17.9177 26.8766 79.2872 Constraint 84 399 13.2162 16.5203 24.7805 79.2872 Constraint 342 633 8.9864 11.2329 16.8494 79.2210 Constraint 354 633 9.1156 11.3945 17.0918 79.0947 Constraint 233 559 15.9613 19.9517 29.9275 79.0432 Constraint 248 406 16.9411 21.1764 31.7646 79.0105 Constraint 173 472 9.0923 11.3653 17.0480 78.9890 Constraint 168 472 7.7085 9.6356 14.4534 78.9890 Constraint 388 625 5.6131 7.0164 10.5245 78.9684 Constraint 380 625 7.3890 9.2363 13.8544 78.9684 Constraint 354 625 10.8764 13.5956 20.3933 78.9684 Constraint 349 625 9.1312 11.4140 17.1211 78.9684 Constraint 233 625 9.0974 11.3717 17.0576 78.9684 Constraint 221 625 8.4379 10.5473 15.8210 78.9684 Constraint 399 613 9.0328 11.2910 16.9365 78.8686 Constraint 388 613 6.0981 7.6227 11.4340 78.8686 Constraint 380 613 5.4712 6.8390 10.2586 78.8686 Constraint 354 613 9.1117 11.3897 17.0845 78.8686 Constraint 349 613 6.9772 8.7215 13.0823 78.8686 Constraint 257 613 9.9927 12.4909 18.7363 78.8686 Constraint 233 613 6.7044 8.3805 12.5707 78.8686 Constraint 221 613 7.9634 9.9542 14.9314 78.8686 Constraint 275 552 16.6796 20.8496 31.2743 78.8229 Constraint 84 148 14.5001 18.1252 27.1878 78.7376 Constraint 44 488 16.1029 20.1286 30.1930 78.2993 Constraint 97 323 12.8412 16.0515 24.0773 78.2993 Constraint 44 559 13.0375 16.2969 24.4453 78.2993 Constraint 75 323 8.9368 11.1710 16.7565 78.2993 Constraint 75 291 7.9922 9.9902 14.9853 78.2993 Constraint 75 283 11.2340 14.0425 21.0638 78.2993 Constraint 75 275 13.0866 16.3583 24.5375 78.2993 Constraint 75 248 13.8814 17.3517 26.0276 78.2993 Constraint 84 342 12.0662 15.0828 22.6242 78.2957 Constraint 84 257 12.3174 15.3968 23.0951 78.2957 Constraint 58 213 12.5743 15.7179 23.5768 78.2932 Constraint 51 213 13.8665 17.3332 25.9997 78.2932 Constraint 75 497 13.0948 16.3685 24.5527 78.2932 Constraint 75 418 13.4251 16.7814 25.1721 78.2932 Constraint 75 388 15.5876 19.4845 29.2267 78.2932 Constraint 75 380 12.4559 15.5699 23.3549 78.2932 Constraint 75 354 15.5938 19.4922 29.2383 78.2932 Constraint 66 595 8.9560 11.1950 16.7924 78.2932 Constraint 58 595 5.6990 7.1237 10.6855 78.2932 Constraint 51 595 5.9601 7.4501 11.1752 78.2932 Constraint 354 488 16.8316 21.0395 31.5593 78.2130 Constraint 257 488 16.5821 20.7276 31.0914 78.2129 Constraint 371 633 6.6488 8.3111 12.4666 78.1068 Constraint 363 633 5.5537 6.9421 10.4132 78.1068 Constraint 207 543 15.6200 19.5250 29.2874 78.1014 Constraint 257 633 11.5290 14.4113 21.6169 78.0947 Constraint 257 625 12.9907 16.2383 24.3575 77.9684 Constraint 305 625 12.9009 16.1262 24.1892 77.9684 Constraint 305 613 9.2357 11.5446 17.3169 77.8686 Constraint 497 613 10.7983 13.4979 20.2469 77.8686 Constraint 106 559 9.5036 11.8796 17.8193 77.7004 Constraint 429 559 15.1213 18.9016 28.3524 77.6329 Constraint 342 465 16.7083 20.8853 31.3280 77.6245 Constraint 168 363 13.4517 16.8147 25.2220 77.3901 Constraint 168 354 14.5125 18.1406 27.2110 77.3901 Constraint 168 248 14.9064 18.6329 27.9494 77.3901 Constraint 173 488 11.4485 14.3106 21.4660 77.3901 Constraint 35 264 16.4955 20.6194 30.9291 77.2994 Constraint 44 213 11.7480 14.6850 22.0275 77.2993 Constraint 97 559 9.6190 12.0238 18.0356 77.2993 Constraint 92 559 8.4364 10.5455 15.8182 77.2993 Constraint 75 435 14.2652 17.8315 26.7473 77.2993 Constraint 75 363 14.2404 17.8005 26.7007 77.2993 Constraint 84 588 11.9509 14.9386 22.4079 77.2993 Constraint 84 581 8.3353 10.4191 15.6287 77.2993 Constraint 84 552 9.2580 11.5725 17.3588 77.2993 Constraint 84 543 12.2737 15.3421 23.0131 77.2993 Constraint 84 534 10.9518 13.6898 20.5346 77.2993 Constraint 84 526 10.8601 13.5751 20.3627 77.2993 Constraint 84 406 12.5909 15.7386 23.6079 77.2993 Constraint 84 323 10.1248 12.6560 18.9840 77.2993 Constraint 84 305 9.1327 11.4159 17.1239 77.2993 Constraint 84 298 5.6342 7.0427 10.5641 77.2993 Constraint 84 291 7.6409 9.5512 14.3267 77.2993 Constraint 84 283 9.9307 12.4134 18.6200 77.2993 Constraint 84 275 12.3055 15.3819 23.0729 77.2993 Constraint 84 264 10.0275 12.5344 18.8016 77.2993 Constraint 44 595 4.3337 5.4171 8.1256 77.2993 Constraint 106 543 10.7857 13.4822 20.2233 77.2993 Constraint 106 534 8.1211 10.1513 15.2270 77.2993 Constraint 97 572 11.1709 13.9637 20.9455 77.2993 Constraint 97 315 11.5962 14.4952 21.7428 77.2993 Constraint 92 572 9.5269 11.9086 17.8629 77.2993 Constraint 92 315 11.1649 13.9561 20.9342 77.2993 Constraint 106 354 14.8714 18.5892 27.8838 77.2960 Constraint 106 595 12.3119 15.3898 23.0848 77.2957 Constraint 84 380 15.0324 18.7905 28.1857 77.2837 Constraint 84 233 14.3769 17.9711 26.9566 77.2837 Constraint 342 625 9.8252 12.2815 18.4223 77.2210 Constraint 342 613 6.3124 7.8906 11.8358 77.1212 Constraint 241 633 12.1245 15.1556 22.7334 77.1068 Constraint 435 625 9.7221 12.1526 18.2289 76.9804 Constraint 371 625 4.4713 5.5891 8.3837 76.9804 Constraint 363 625 6.0172 7.5215 11.2823 76.9804 Constraint 399 625 11.1554 13.9443 20.9164 76.9684 Constraint 248 443 16.6787 20.8484 31.2726 76.9247 Constraint 435 613 8.9858 11.2323 16.8484 76.8806 Constraint 371 613 5.3372 6.6716 10.0073 76.8806 Constraint 363 613 4.0956 5.1195 7.6792 76.8806 Constraint 248 613 12.0418 15.0523 22.5784 76.8806 Constraint 241 613 10.9149 13.6436 20.4655 76.8806 Constraint 526 613 11.2299 14.0374 21.0561 76.8686 Constraint 173 363 14.3790 17.9738 26.9607 76.3902 Constraint 168 429 12.6679 15.8349 23.7523 76.3901 Constraint 173 429 12.9784 16.2230 24.3345 76.3901 Constraint 35 213 12.8281 16.0351 24.0527 76.2993 Constraint 35 595 6.0111 7.5139 11.2709 76.2993 Constraint 92 310 12.5152 15.6440 23.4660 76.2993 Constraint 97 509 14.1092 17.6365 26.4548 76.2993 Constraint 66 213 15.6304 19.5380 29.3070 76.2932 Constraint 97 595 14.4539 18.0673 27.1010 76.2922 Constraint 84 497 15.6086 19.5108 29.2662 76.2872 Constraint 44 283 13.8523 17.3153 25.9730 76.1993 Constraint 429 613 10.8715 13.5894 20.3842 76.1212 Constraint 399 633 13.3972 16.7465 25.1198 75.9947 Constraint 168 518 13.6285 17.0356 25.5534 75.9890 Constraint 173 456 9.7847 12.2309 18.3463 75.7006 Constraint 168 456 8.9460 11.1825 16.7738 75.7006 Constraint 75 572 5.9300 7.4126 11.1188 75.7004 Constraint 472 613 13.2221 16.5276 24.7914 75.6651 Constraint 35 248 16.5322 20.6653 30.9979 75.2995 Constraint 173 465 8.3304 10.4130 15.6194 75.2994 Constraint 168 465 7.4246 9.2808 13.9212 75.2994 Constraint 35 559 14.4305 18.0382 27.0572 75.2993 Constraint 75 559 6.6531 8.3164 12.4745 75.2993 Constraint 75 315 9.0225 11.2781 16.9172 75.2993 Constraint 75 310 10.4068 13.0086 19.5128 75.2993 Constraint 106 363 15.1854 18.9817 28.4725 75.2957 Constraint 66 603 12.5449 15.6811 23.5217 75.2935 Constraint 58 603 9.4449 11.8061 17.7091 75.2935 Constraint 51 603 8.0618 10.0773 15.1159 75.2935 Constraint 323 625 13.1093 16.3866 24.5799 75.2331 Constraint 429 625 10.5995 13.2494 19.8741 75.2210 Constraint 44 472 15.9138 19.8922 29.8383 75.1993 Constraint 323 613 9.5765 11.9706 17.9558 75.1333 Constraint 429 633 14.0900 17.6125 26.4187 75.1210 Constraint 248 633 13.2047 16.5059 24.7588 75.1068 Constraint 435 633 12.5501 15.6877 23.5315 75.1068 Constraint 305 633 11.9622 14.9527 22.4291 75.0947 Constraint 213 633 11.4285 14.2857 21.4285 75.0947 Constraint 443 633 12.8372 16.0465 24.0698 75.0068 Constraint 443 625 9.3134 11.6418 17.4627 74.9804 Constraint 213 625 9.3898 11.7373 17.6059 74.9684 Constraint 443 613 10.3881 12.9852 19.4777 74.8806 Constraint 518 613 12.2631 15.3289 22.9933 74.8746 Constraint 264 613 13.5144 16.8930 25.3394 74.8686 Constraint 213 613 8.5985 10.7481 16.1221 74.8686 Constraint 504 613 13.4604 16.8255 25.2382 74.8686 Constraint 406 613 11.1301 13.9126 20.8690 74.8686 Constraint 354 465 16.4829 20.6036 30.9054 74.6245 Constraint 213 315 16.6328 20.7910 31.1864 74.6037 Constraint 44 603 5.9714 7.4642 11.1963 74.2995 Constraint 84 559 8.3174 10.3968 15.5951 74.2993 Constraint 35 504 16.4557 20.5696 30.8545 74.2993 Constraint 84 572 7.9679 9.9599 14.9398 74.2993 Constraint 84 315 8.9911 11.2388 16.8582 74.2993 Constraint 84 310 10.5218 13.1522 19.7283 74.2993 Constraint 92 595 14.1755 17.7194 26.5791 74.2993 Constraint 106 349 15.3092 19.1365 28.7047 74.2960 Constraint 58 207 15.5871 19.4839 29.2258 74.2932 Constraint 497 633 14.3663 17.9579 26.9368 74.0008 Constraint 173 481 11.1192 13.8990 20.8485 73.9995 Constraint 248 625 14.2377 17.7971 26.6956 73.9805 Constraint 241 625 12.3053 15.3817 23.0725 73.9805 Constraint 248 543 16.6134 20.7667 31.1501 73.9315 Constraint 310 613 11.8369 14.7962 22.1942 73.8806 Constraint 323 429 16.4736 20.5920 30.8880 73.6038 Constraint 257 456 16.0250 20.0313 30.0469 73.5030 Constraint 194 497 10.7868 13.4835 20.2252 73.3783 Constraint 194 488 11.5746 14.4683 21.7024 73.3783 Constraint 194 380 10.9440 13.6800 20.5199 73.3783 Constraint 35 603 4.6062 5.7578 8.6367 73.2995 Constraint 35 534 16.4489 20.5611 30.8416 73.2994 Constraint 456 559 15.0347 18.7934 28.1900 73.2994 Constraint 44 207 13.5970 16.9962 25.4944 73.2993 Constraint 35 207 13.8914 17.3642 26.0464 73.2993 Constraint 84 248 14.3052 17.8815 26.8223 73.2959 Constraint 75 595 9.5356 11.9194 17.8792 73.2932 Constraint 194 429 11.2516 14.0646 21.0968 73.2783 Constraint 323 633 11.7993 14.7491 22.1237 73.2331 Constraint 44 275 14.0416 17.5520 26.3280 73.1993 Constraint 58 472 15.2639 19.0799 28.6199 73.1933 Constraint 275 613 15.1629 18.9536 28.4304 73.1684 Constraint 298 613 11.9199 14.8999 22.3498 73.1212 Constraint 418 613 11.8179 14.7724 22.1586 73.1212 Constraint 481 559 15.4378 19.2973 28.9459 73.0342 Constraint 194 472 9.6137 12.0171 18.0257 72.9771 Constraint 497 625 11.9678 14.9598 22.4396 72.9744 Constraint 406 625 13.3822 16.7278 25.0917 72.8745 Constraint 275 534 16.3079 20.3849 30.5774 72.5231 Constraint 526 633 15.3905 19.2381 28.8571 72.3006 Constraint 168 526 14.1151 17.6439 26.4658 72.2994 Constraint 75 241 15.1013 18.8766 28.3149 72.2993 Constraint 92 509 14.8775 18.5969 27.8954 72.2993 Constraint 106 213 14.7845 18.4806 27.7210 72.2957 Constraint 75 213 14.5757 18.2197 27.3295 72.2932 Constraint 92 248 15.4449 19.3061 28.9592 72.2923 Constraint 291 613 13.0036 16.2545 24.3817 72.1333 Constraint 194 504 13.6397 17.0497 25.5745 72.0784 Constraint 173 504 12.9030 16.1287 24.1930 71.9995 Constraint 310 625 15.1214 18.9017 28.3526 71.9805 Constraint 148 613 9.6379 12.0474 18.0711 71.9469 Constraint 142 613 11.8922 14.8653 22.2979 71.9469 Constraint 134 613 9.1970 11.4962 17.2443 71.9469 Constraint 207 613 9.0369 11.2961 16.9442 71.5315 Constraint 194 435 9.8833 12.3541 18.5311 71.3904 Constraint 194 371 9.2405 11.5506 17.3259 71.3904 Constraint 168 399 13.9413 17.4266 26.1399 71.3901 Constraint 194 481 12.3208 15.4010 23.1015 71.3783 Constraint 194 518 14.2429 17.8036 26.7055 71.3783 Constraint 194 388 10.1774 12.7217 19.0825 71.3783 Constraint 24 588 10.7082 13.3852 20.0778 71.2996 Constraint 24 435 11.0444 13.8055 20.7082 71.2996 Constraint 24 429 10.6784 13.3480 20.0220 71.2996 Constraint 24 399 11.5867 14.4834 21.7251 71.2996 Constraint 24 388 6.2371 7.7964 11.6946 71.2996 Constraint 24 380 9.2495 11.5619 17.3428 71.2996 Constraint 24 371 7.8713 9.8391 14.7586 71.2996 Constraint 24 363 8.3729 10.4661 15.6992 71.2996 Constraint 24 354 13.6778 17.0972 25.6458 71.2996 Constraint 24 349 10.8223 13.5279 20.2918 71.2996 Constraint 24 342 10.8841 13.6052 20.4078 71.2996 Constraint 24 257 15.1491 18.9363 28.4045 71.2996 Constraint 24 233 11.6819 14.6023 21.9035 71.2996 Constraint 24 221 11.9622 14.9528 22.4292 71.2996 Constraint 24 134 14.3712 17.9640 26.9460 71.2996 Constraint 84 595 12.1963 15.2453 22.8680 71.2993 Constraint 194 418 14.0499 17.5623 26.3435 71.2783 Constraint 194 399 13.8661 17.3327 25.9990 71.2783 Constraint 275 572 16.5161 20.6452 30.9677 71.2126 Constraint 35 543 15.7690 19.7112 29.5668 71.1994 Constraint 148 633 12.5142 15.6427 23.4641 71.1730 Constraint 134 633 12.1164 15.1455 22.7182 71.1730 Constraint 418 633 16.0177 20.0222 30.0333 71.1273 Constraint 310 633 13.2811 16.6013 24.9020 71.1068 Constraint 134 625 12.4343 15.5429 23.3143 71.0467 Constraint 148 625 11.5926 14.4907 21.7361 71.0467 Constraint 122 613 10.8904 13.6130 20.4195 70.9469 Constraint 472 625 13.8845 17.3557 26.0335 70.7709 Constraint 207 633 10.3405 12.9256 19.3884 70.7577 Constraint 472 559 16.4082 20.5103 30.7654 70.6330 Constraint 207 625 7.9602 9.9502 14.9254 70.6314 Constraint 526 625 13.6853 17.1067 25.6600 70.5733 Constraint 504 625 15.3352 19.1690 28.7535 70.4733 Constraint 298 633 15.1207 18.9009 28.3513 70.4270 Constraint 315 388 16.6928 20.8660 31.2990 70.3038 Constraint 24 581 13.5616 16.9521 25.4281 70.2996 Constraint 24 497 14.2248 17.7810 26.6715 70.2996 Constraint 24 418 13.0031 16.2539 24.3808 70.2996 Constraint 24 406 12.9666 16.2082 24.3124 70.2996 Constraint 24 323 12.9193 16.1491 24.2237 70.2996 Constraint 75 221 15.9170 19.8963 29.8444 70.1932 Constraint 418 625 12.7871 15.9838 23.9758 70.1271 Constraint 142 633 14.0322 17.5402 26.3103 70.0730 Constraint 406 633 15.6045 19.5056 29.2584 70.0010 Constraint 488 613 13.9571 17.4464 26.1696 69.8747 Constraint 114 509 11.5146 14.3933 21.5899 69.7575 Constraint 298 488 16.6932 20.8664 31.2997 69.5919 Constraint 518 625 13.9098 17.3873 26.0809 69.4733 Constraint 114 518 11.2352 14.0440 21.0660 69.4205 Constraint 114 504 9.4529 11.8161 17.7241 69.4205 Constraint 114 497 11.6149 14.5186 21.7779 69.4205 Constraint 114 488 14.4343 18.0429 27.0643 69.4205 Constraint 114 481 13.7913 17.2392 25.8587 69.4205 Constraint 114 472 13.3009 16.6261 24.9391 69.4205 Constraint 114 435 14.1783 17.7229 26.5843 69.4205 Constraint 114 406 12.4668 15.5834 23.3752 69.4205 Constraint 114 399 11.2719 14.0899 21.1348 69.4205 Constraint 114 380 12.1266 15.1582 22.7373 69.4205 Constraint 114 371 15.9297 19.9121 29.8682 69.4205 Constraint 114 363 13.6923 17.1154 25.6731 69.4205 Constraint 114 354 13.2214 16.5267 24.7901 69.4205 Constraint 114 349 13.9757 17.4697 26.2045 69.4205 Constraint 114 305 7.3258 9.1573 13.7360 69.4205 Constraint 114 283 9.6121 12.0152 18.0227 69.4205 Constraint 114 275 10.2398 12.7998 19.1997 69.4205 Constraint 114 264 6.4638 8.0798 12.1197 69.4205 Constraint 114 257 9.2024 11.5030 17.2544 69.4205 Constraint 114 248 9.8601 12.3252 18.4878 69.4205 Constraint 114 241 11.6846 14.6058 21.9086 69.4205 Constraint 114 233 10.7543 13.4429 20.1643 69.4205 Constraint 114 221 14.1552 17.6940 26.5410 69.4205 Constraint 456 613 12.1453 15.1816 22.7725 69.4030 Constraint 194 443 7.9866 9.9832 14.9748 69.3904 Constraint 194 354 14.9450 18.6812 28.0219 69.3783 Constraint 200 429 10.5616 13.2020 19.8030 69.3783 Constraint 200 380 9.6647 12.0809 18.1213 69.3783 Constraint 24 456 14.1117 17.6397 26.4595 69.2996 Constraint 24 443 10.1855 12.7318 19.0978 69.2996 Constraint 24 148 14.1682 17.7103 26.5654 69.2996 Constraint 66 371 16.2959 20.3698 30.5548 69.2994 Constraint 75 603 13.4551 16.8188 25.2283 69.2935 Constraint 194 465 9.1400 11.4250 17.1374 69.2876 Constraint 264 625 16.7789 20.9736 31.4604 69.1721 Constraint 315 613 12.7060 15.8826 23.8238 69.1333 Constraint 142 625 14.1890 17.7362 26.6043 69.0467 Constraint 488 625 14.7939 18.4924 27.7386 68.8746 Constraint 114 588 12.7155 15.8944 23.8416 68.7203 Constraint 114 581 8.2619 10.3273 15.4910 68.7203 Constraint 114 552 8.4370 10.5463 15.8195 68.7203 Constraint 114 526 7.3406 9.1757 13.7636 68.7203 Constraint 114 310 9.4695 11.8369 17.7554 68.4205 Constraint 456 633 15.3856 19.2320 28.8480 68.4028 Constraint 257 418 16.8621 21.0776 31.6164 68.3988 Constraint 283 559 16.0818 20.1022 30.1534 68.3585 Constraint 24 305 13.9796 17.4745 26.2117 68.2996 Constraint 24 241 15.6576 19.5720 29.3581 68.2996 Constraint 97 497 15.1920 18.9899 28.4849 68.2993 Constraint 75 371 16.4419 20.5524 30.8286 68.2993 Constraint 114 572 10.7867 13.4833 20.2250 68.1215 Constraint 200 481 11.1827 13.9783 20.9675 68.0784 Constraint 291 633 15.3968 19.2459 28.8689 68.0319 Constraint 173 399 14.8963 18.6204 27.9306 67.9890 Constraint 257 443 16.6141 20.7676 31.1514 67.9247 Constraint 472 633 15.7535 19.6919 29.5379 67.7972 Constraint 194 456 9.1353 11.4191 17.1287 67.7008 Constraint 213 559 15.5175 19.3969 29.0953 67.4444 Constraint 315 633 14.7525 18.4406 27.6609 67.4331 Constraint 194 363 12.7112 15.8890 23.8336 67.3904 Constraint 200 435 8.7157 10.8946 16.3419 67.3903 Constraint 200 371 8.3863 10.4829 15.7244 67.3903 Constraint 200 504 12.1714 15.2143 22.8214 67.3783 Constraint 200 497 9.2137 11.5171 17.2756 67.3783 Constraint 200 488 10.2578 12.8222 19.2334 67.3783 Constraint 200 388 9.3808 11.7260 17.5890 67.3783 Constraint 315 497 16.6202 20.7752 31.1629 67.3040 Constraint 51 488 16.6014 20.7517 31.1276 67.2935 Constraint 114 559 9.9441 12.4301 18.6452 67.2478 Constraint 298 625 15.7002 19.6252 29.4379 67.2273 Constraint 275 504 15.9770 19.9713 29.9569 67.2127 Constraint 75 488 15.2273 19.0341 28.5512 67.1933 Constraint 75 481 15.8929 19.8661 29.7991 67.1933 Constraint 75 472 15.6741 19.5926 29.3889 67.1933 Constraint 283 613 15.9019 19.8773 29.8160 67.1806 Constraint 354 642 9.2857 11.6072 17.4107 67.0948 Constraint 349 642 8.1910 10.2388 15.3582 67.0948 Constraint 233 642 9.5022 11.8777 17.8166 67.0948 Constraint 200 472 8.0792 10.0990 15.1485 66.9771 Constraint 264 633 15.3950 19.2438 28.8657 66.8995 Constraint 114 418 14.9932 18.7415 28.1123 66.7994 Constraint 114 342 10.4161 13.0201 19.5302 66.7994 Constraint 114 323 10.8317 13.5396 20.3094 66.7994 Constraint 114 298 6.1131 7.6414 11.4621 66.7994 Constraint 114 291 5.9806 7.4758 11.2137 66.7994 Constraint 114 595 10.9073 13.6341 20.4511 66.7203 Constraint 35 488 16.6382 20.7978 31.1966 66.2996 Constraint 168 595 15.4919 19.3649 29.0474 66.2889 Constraint 75 456 15.9117 19.8896 29.8344 66.1993 Constraint 58 613 9.8087 12.2608 18.3912 66.1935 Constraint 371 642 6.6038 8.2547 12.3821 66.1068 Constraint 363 642 6.8718 8.5898 12.8847 66.1068 Constraint 221 642 8.3640 10.4551 15.6826 66.0948 Constraint 388 642 9.7740 12.2175 18.3263 66.0947 Constraint 380 642 10.0459 12.5574 18.8361 66.0947 Constraint 122 633 14.5458 18.1822 27.2733 66.0731 Constraint 114 315 10.1760 12.7200 19.0799 65.7994 Constraint 114 543 10.5101 13.1376 19.7064 65.7203 Constraint 114 534 7.5588 9.4486 14.1728 65.7203 Constraint 456 625 12.1533 15.1916 22.7874 65.5029 Constraint 200 518 12.8325 16.0406 24.0609 65.3783 Constraint 200 509 13.7510 17.1887 25.7830 65.3783 Constraint 200 399 12.3757 15.4696 23.2044 65.3783 Constraint 315 518 16.6347 20.7934 31.1901 65.3039 Constraint 24 122 15.3608 19.2011 28.8016 65.2996 Constraint 24 213 12.1128 15.1410 22.7115 65.2996 Constraint 24 310 16.3698 20.4623 30.6934 65.2996 Constraint 24 603 5.5431 6.9289 10.3933 65.2996 Constraint 24 595 8.9869 11.2336 16.8504 65.2996 Constraint 44 625 9.4080 11.7600 17.6401 65.2993 Constraint 44 633 9.5562 11.9453 17.9179 65.2993 Constraint 388 559 15.6762 19.5953 29.3929 65.2959 Constraint 200 418 12.9201 16.1501 24.2252 65.2783 Constraint 275 371 16.8221 21.0276 31.5414 65.2248 Constraint 44 613 6.2169 7.7711 11.6567 65.1995 Constraint 51 613 9.3046 11.6308 17.4462 65.1935 Constraint 465 613 14.9859 18.7324 28.0986 65.1876 Constraint 114 456 15.5154 19.3943 29.0914 65.0994 Constraint 122 625 14.2293 17.7866 26.6799 65.0467 Constraint 200 526 13.5559 16.9449 25.4174 64.6782 Constraint 194 603 13.6553 17.0691 25.6036 64.5782 Constraint 509 613 14.9100 18.6375 27.9562 64.4737 Constraint 200 443 7.5619 9.4523 14.1785 64.3903 Constraint 194 509 14.8571 18.5713 27.8570 64.3783 Constraint 354 429 17.2375 21.5469 32.3204 64.3771 Constraint 66 241 16.0905 20.1131 30.1697 64.2994 Constraint 35 625 8.7911 10.9889 16.4833 64.2993 Constraint 342 642 10.5367 13.1708 19.7562 64.2211 Constraint 35 613 6.8844 8.6055 12.9083 64.1995 Constraint 257 642 12.3792 15.4741 23.2111 64.0948 Constraint 173 518 14.0492 17.5615 26.3422 63.9995 Constraint 168 509 12.9176 16.1470 24.2205 63.9995 Constraint 481 613 15.6901 19.6126 29.4189 63.8749 Constraint 114 603 15.2922 19.1152 28.6729 63.7206 Constraint 200 456 8.3426 10.4283 15.6424 63.7008 Constraint 114 213 13.0984 16.3731 24.5596 63.4205 Constraint 200 363 11.5853 14.4817 21.7225 63.3904 Constraint 200 354 13.6412 17.0515 25.5773 63.3783 Constraint 200 349 15.0726 18.8407 28.2611 63.3783 Constraint 200 342 15.0774 18.8468 28.2702 63.3783 Constraint 24 526 14.8799 18.5998 27.8997 63.2996 Constraint 35 633 9.4952 11.8690 17.8035 63.2993 Constraint 106 472 14.1951 17.7439 26.6158 63.2959 Constraint 58 633 13.4342 16.7927 25.1891 63.2934 Constraint 97 380 15.6373 19.5466 29.3199 63.2923 Constraint 168 418 13.8683 17.3354 26.0031 63.2889 Constraint 200 465 8.0283 10.0354 15.0531 63.2875 Constraint 465 625 15.1047 18.8809 28.3213 63.1934 Constraint 173 354 15.4172 19.2715 28.9073 63.1902 Constraint 241 642 11.5273 14.4091 21.6137 63.1069 Constraint 305 642 13.5130 16.8913 25.3369 63.0948 Constraint 291 625 16.4864 20.6080 30.9120 62.8321 Constraint 534 613 14.6060 18.2575 27.3863 62.7735 Constraint 194 526 14.8020 18.5025 27.7538 62.6888 Constraint 315 504 16.5318 20.6648 30.9972 62.6039 Constraint 24 207 11.3478 14.1848 21.2771 62.2996 Constraint 106 481 14.0776 17.5970 26.3955 62.2959 Constraint 51 625 12.4499 15.5623 23.3435 62.2933 Constraint 24 518 14.8331 18.5413 27.8120 62.1996 Constraint 435 642 12.7922 15.9902 23.9853 62.1068 Constraint 213 642 11.3606 14.2008 21.3012 62.0947 Constraint 399 642 14.4657 18.0821 27.1231 61.9949 Constraint 349 418 16.9528 21.1911 31.7866 61.9876 Constraint 106 435 14.9786 18.7232 28.0848 61.2957 Constraint 58 625 13.1652 16.4565 24.6848 61.2934 Constraint 92 233 15.4729 19.3411 29.0116 61.2926 Constraint 323 642 14.0767 17.5959 26.3938 61.2332 Constraint 173 418 14.6060 18.2574 27.3862 61.1890 Constraint 429 642 14.5052 18.1315 27.1973 61.1213 Constraint 552 625 15.4671 19.3338 29.0007 61.0828 Constraint 543 613 15.1022 18.8778 28.3167 61.0734 Constraint 168 625 13.3457 16.6821 25.0232 60.6936 Constraint 142 200 13.0843 16.3553 24.5330 60.4009 Constraint 51 633 12.5163 15.6453 23.4680 60.2995 Constraint 51 207 15.8962 19.8703 29.8054 60.2934 Constraint 168 603 15.1831 18.9789 28.4683 60.2891 Constraint 315 625 16.2181 20.2726 30.4089 60.2333 Constraint 24 552 15.5716 19.4646 29.1968 60.1996 Constraint 44 114 13.0460 16.3075 24.4613 60.0993 Constraint 443 642 12.5244 15.6555 23.4833 60.0068 Constraint 497 642 14.3856 17.9820 26.9730 60.0010 Constraint 443 572 17.1014 21.3767 32.0651 59.9891 Constraint 248 642 13.0595 16.3244 24.4867 59.7699 Constraint 207 642 9.6878 12.1097 18.1646 59.7577 Constraint 310 472 16.4457 20.5572 30.8357 59.7214 Constraint 173 625 13.6689 17.0862 25.6292 59.6936 Constraint 200 603 12.6854 15.8567 23.7851 59.6782 Constraint 305 465 16.5980 20.7475 31.1212 59.6245 Constraint 168 613 14.3310 17.9137 26.8706 59.5938 Constraint 349 534 16.8900 21.1125 31.6687 59.5029 Constraint 114 388 16.1682 20.2103 30.3155 59.4208 Constraint 84 349 15.3054 19.1318 28.6977 59.2959 Constraint 207 310 16.8440 21.0550 31.5826 59.2138 Constraint 24 298 16.0903 20.1129 30.1693 59.1997 Constraint 24 142 16.8513 21.0641 31.5961 59.1996 Constraint 58 481 16.2231 20.2789 30.4183 59.1934 Constraint 194 595 14.7025 18.3781 27.5672 59.1771 Constraint 114 465 16.2070 20.2587 30.3881 59.0995 Constraint 173 509 13.7322 17.1653 25.7479 58.9997 Constraint 518 633 16.3296 20.4120 30.6180 58.9058 Constraint 207 323 15.8598 19.8247 29.7371 58.5928 Constraint 134 194 15.5562 19.4452 29.1678 58.4010 Constraint 134 200 14.1194 17.6493 26.4739 58.4009 Constraint 173 526 14.7111 18.3888 27.5832 58.2994 Constraint 97 241 15.0858 18.8572 28.2858 58.2925 Constraint 92 497 15.9565 19.9457 29.9185 58.2875 Constraint 66 613 12.2465 15.3081 22.9621 58.1937 Constraint 310 642 14.6902 18.3627 27.5441 58.1069 Constraint 173 603 15.5541 19.4426 29.1640 57.9891 Constraint 200 595 13.3730 16.7163 25.0745 57.6782 Constraint 194 613 12.9880 16.2350 24.3525 57.4818 Constraint 106 221 15.2194 19.0242 28.5363 57.2961 Constraint 24 572 15.1346 18.9183 28.3774 57.1996 Constraint 106 418 14.9458 18.6822 28.0233 57.1994 Constraint 148 642 12.2594 15.3242 22.9863 57.1731 Constraint 168 342 16.2574 20.3218 30.4827 56.3903 Constraint 106 488 14.4375 18.0469 27.0703 56.2958 Constraint 200 406 15.4327 19.2908 28.9363 56.2783 Constraint 173 248 16.0280 20.0351 30.0526 56.2009 Constraint 24 613 6.5288 8.1609 12.2414 56.1996 Constraint 75 613 13.3534 16.6918 25.0377 56.1936 Constraint 134 642 12.7631 15.9539 23.9308 56.1731 Constraint 24 248 16.9550 21.1938 31.7907 56.0997 Constraint 194 625 11.3100 14.1375 21.2062 55.6818 Constraint 298 456 16.7237 20.9046 31.3569 55.5031 Constraint 335 588 9.4698 11.8372 17.7558 55.2996 Constraint 335 581 9.7902 12.2377 18.3566 55.2996 Constraint 335 552 13.3782 16.7227 25.0841 55.2996 Constraint 335 526 13.0592 16.3240 24.4860 55.2996 Constraint 335 497 15.2362 19.0453 28.5679 55.2996 Constraint 335 435 14.0060 17.5076 26.2613 55.2996 Constraint 335 429 15.9520 19.9400 29.9101 55.2996 Constraint 335 418 15.4886 19.3608 29.0412 55.2996 Constraint 335 406 12.8420 16.0525 24.0788 55.2996 Constraint 335 399 11.6322 14.5402 21.8104 55.2996 Constraint 275 335 12.2210 15.2762 22.9144 55.2996 Constraint 264 335 11.6873 14.6091 21.9137 55.2996 Constraint 257 335 8.4363 10.5454 15.8181 55.2996 Constraint 248 335 12.3938 15.4923 23.2384 55.2996 Constraint 241 335 13.2695 16.5869 24.8803 55.2996 Constraint 233 335 8.9038 11.1298 16.6947 55.2996 Constraint 221 335 12.5522 15.6903 23.5354 55.2996 Constraint 213 335 13.5087 16.8858 25.3288 55.2996 Constraint 148 335 12.6477 15.8096 23.7144 55.2996 Constraint 142 335 13.0476 16.3095 24.4642 55.2996 Constraint 134 335 9.0044 11.2555 16.8833 55.2996 Constraint 122 335 9.7338 12.1672 18.2509 55.2996 Constraint 24 633 7.1267 8.9084 13.3626 55.2996 Constraint 200 534 16.0616 20.0770 30.1154 55.2770 Constraint 323 443 16.8705 21.0882 31.6322 55.1924 Constraint 35 114 15.9895 19.9869 29.9803 55.0994 Constraint 182 472 9.1746 11.4683 17.2024 54.6775 Constraint 173 613 14.8687 18.5859 27.8789 54.3938 Constraint 182 497 10.7506 13.4382 20.1573 54.3785 Constraint 182 429 11.7751 14.7189 22.0783 54.3785 Constraint 182 388 11.3081 14.1351 21.2027 54.3785 Constraint 182 380 11.5070 14.3837 21.5756 54.3785 Constraint 66 335 9.2682 11.5853 17.3779 54.2996 Constraint 58 335 6.7657 8.4572 12.6858 54.2996 Constraint 51 335 6.6657 8.3322 12.4983 54.2996 Constraint 44 335 4.6281 5.7851 8.6777 54.2996 Constraint 35 335 7.3866 9.2332 13.8498 54.2996 Constraint 84 603 15.8119 19.7648 29.6472 54.2996 Constraint 84 363 15.3512 19.1890 28.7835 54.2959 Constraint 84 418 15.5715 19.4644 29.1965 54.2876 Constraint 106 613 15.6667 19.5834 29.3752 54.1997 Constraint 142 642 13.6356 17.0446 25.5668 54.1732 Constraint 472 642 14.9407 18.6759 28.0138 53.8035 Constraint 207 298 16.9478 21.1847 31.7771 53.5808 Constraint 24 625 5.1540 6.4425 9.6638 53.2997 Constraint 44 642 12.1920 15.2400 22.8600 53.2994 Constraint 106 603 15.9778 19.9723 29.9584 53.1963 Constraint 75 429 16.0800 20.1000 30.1499 53.1935 Constraint 24 472 16.5926 20.7408 31.1112 52.9996 Constraint 248 572 16.8960 21.1200 31.6801 52.9890 Constraint 275 633 15.6289 19.5361 29.3042 52.8996 Constraint 200 633 13.4817 16.8521 25.2782 52.6818 Constraint 200 613 12.2874 15.3593 23.0389 52.5818 Constraint 194 633 13.4710 16.8388 25.2581 52.4818 Constraint 456 642 14.9246 18.6557 27.9835 52.4032 Constraint 182 443 8.9344 11.1680 16.7521 52.3906 Constraint 182 435 10.1008 12.6260 18.9390 52.3906 Constraint 182 371 10.1330 12.6662 18.9993 52.3906 Constraint 182 488 10.8997 13.6246 20.4369 52.3785 Constraint 335 518 15.4105 19.2632 28.8948 52.2997 Constraint 17 443 12.7001 15.8751 23.8127 52.2997 Constraint 17 435 13.9106 17.3882 26.0824 52.2997 Constraint 17 429 13.9438 17.4298 26.1447 52.2997 Constraint 17 399 14.6640 18.3300 27.4950 52.2997 Constraint 17 388 9.2228 11.5285 17.2927 52.2997 Constraint 17 380 11.5890 14.4863 21.7294 52.2997 Constraint 17 371 9.1575 11.4468 17.1702 52.2997 Constraint 17 363 9.1214 11.4018 17.1026 52.2997 Constraint 17 354 13.5716 16.9645 25.4468 52.2997 Constraint 17 349 10.5395 13.1744 19.7616 52.2997 Constraint 17 342 11.8526 14.8157 22.2236 52.2997 Constraint 17 323 13.9115 17.3893 26.0840 52.2997 Constraint 17 233 12.7409 15.9262 23.8892 52.2997 Constraint 17 221 12.9175 16.1468 24.2203 52.2997 Constraint 17 134 15.7449 19.6812 29.5217 52.2997 Constraint 75 335 11.1225 13.9032 20.8548 52.2996 Constraint 207 335 15.2730 19.0913 28.6369 52.2996 Constraint 35 642 12.3750 15.4688 23.2031 52.2994 Constraint 84 241 15.3258 19.1572 28.7358 52.2959 Constraint 92 380 15.8265 19.7831 29.6746 52.2926 Constraint 283 504 16.4111 20.5139 30.7708 52.2250 Constraint 35 106 16.4989 20.6236 30.9354 52.1996 Constraint 182 481 11.4658 14.3322 21.4984 52.0786 Constraint 194 342 15.8257 19.7821 29.6731 52.0784 Constraint 509 625 16.7176 20.8970 31.3456 51.7796 Constraint 122 200 16.2519 20.3149 30.4723 51.6999 Constraint 200 625 11.1347 13.9184 20.8776 51.6818 Constraint 168 633 14.6489 18.3111 27.4666 51.5937 Constraint 17 588 13.5963 16.9954 25.4931 51.2997 Constraint 24 335 10.2829 12.8537 19.2805 51.2997 Constraint 17 257 15.6897 19.6121 29.4181 51.2997 Constraint 335 572 11.4358 14.2948 21.4421 51.2997 Constraint 291 418 17.0065 21.2581 31.8871 50.9998 Constraint 24 315 16.2743 20.3429 30.5144 50.9997 Constraint 114 613 13.9282 17.4103 26.1154 50.8470 Constraint 182 363 13.4769 16.8462 25.2692 50.3906 Constraint 84 335 12.9825 16.2282 24.3423 50.2996 Constraint 465 559 16.9437 21.1797 31.7695 50.2996 Constraint 182 465 8.4364 10.5455 15.8182 50.2878 Constraint 84 613 15.2159 19.0199 28.5299 50.1998 Constraint 58 642 15.5751 19.4689 29.2034 50.1935 Constraint 168 349 15.4223 19.2778 28.9168 50.0902 Constraint 354 509 17.3394 21.6743 32.5114 49.7210 Constraint 182 504 12.8996 16.1245 24.1867 49.6895 Constraint 481 625 16.6415 20.8019 31.2029 49.4737 Constraint 17 305 15.1742 18.9678 28.4516 49.2998 Constraint 335 559 14.9312 18.6640 27.9959 49.2998 Constraint 17 497 16.6470 20.8087 31.2130 49.2997 Constraint 17 213 14.0152 17.5190 26.2785 49.2997 Constraint 168 534 14.7525 18.4407 27.6610 49.2997 Constraint 335 443 16.0371 20.0464 30.0696 49.2996 Constraint 92 335 15.0334 18.7917 28.1876 49.2996 Constraint 335 603 9.4956 11.8695 17.8042 49.2996 Constraint 335 595 7.1984 8.9980 13.4970 49.2996 Constraint 84 354 15.4613 19.3266 28.9899 49.2960 Constraint 24 488 16.3938 20.4923 30.7384 49.1998 Constraint 97 481 16.0058 20.0072 30.0108 49.1995 Constraint 200 581 16.2227 20.2784 30.4176 49.1771 Constraint 349 650 9.8993 12.3741 18.5612 49.0948 Constraint 194 349 15.4709 19.3387 29.0080 49.0784 Constraint 182 456 8.9652 11.2065 16.8097 48.7010 Constraint 264 488 16.8040 21.0050 31.5074 48.6982 Constraint 17 148 15.8102 19.7627 29.6441 48.2997 Constraint 342 650 12.3722 15.4653 23.1980 48.2211 Constraint 97 472 16.2951 20.3688 30.5533 48.1924 Constraint 182 418 13.8752 17.3440 26.0159 48.1785 Constraint 388 650 11.2496 14.0620 21.0930 48.0948 Constraint 380 650 11.9877 14.9846 22.4769 48.0948 Constraint 221 650 10.7486 13.4357 20.1536 48.0948 Constraint 213 650 13.3042 16.6303 24.9454 48.0948 Constraint 122 642 15.6467 19.5584 29.3376 48.0732 Constraint 200 305 16.2152 20.2691 30.4036 47.9774 Constraint 17 418 16.2371 20.2963 30.4445 47.2997 Constraint 17 603 8.9887 11.2358 16.8538 47.2997 Constraint 17 595 11.7349 14.6686 22.0030 47.2997 Constraint 17 207 12.5916 15.7395 23.6093 47.2997 Constraint 106 335 13.6148 17.0186 25.5278 47.2996 Constraint 84 435 16.2677 20.3347 30.5020 47.2996 Constraint 17 406 16.0505 20.0632 30.0948 47.1997 Constraint 24 200 14.3201 17.9002 26.8503 47.1997 Constraint 51 642 15.3307 19.1634 28.7451 47.1995 Constraint 363 650 8.9220 11.1525 16.7288 47.1069 Constraint 233 650 11.5228 14.4035 21.6053 47.0948 Constraint 58 465 16.8746 21.0932 31.6398 46.9934 Constraint 182 518 13.5589 16.9486 25.4229 46.3906 Constraint 182 399 13.6492 17.0615 25.5923 46.3785 Constraint 264 642 15.9382 19.9227 29.8840 46.3125 Constraint 97 335 14.8658 18.5822 27.8733 46.2998 Constraint 335 504 16.4340 20.5425 30.8137 46.2997 Constraint 526 642 15.5315 19.4144 29.1216 46.2127 Constraint 35 509 16.7819 20.9774 31.4660 46.1998 Constraint 106 465 16.0014 20.0018 30.0026 46.1994 Constraint 106 456 15.2738 19.0923 28.6384 46.1994 Constraint 371 650 8.4404 10.5505 15.8257 46.1069 Constraint 24 194 14.2072 17.7590 26.6385 46.0997 Constraint 354 650 10.9133 13.6416 20.4624 46.0949 Constraint 257 650 14.0877 17.6096 26.4144 46.0949 Constraint 182 509 13.8880 17.3600 26.0401 45.6895 Constraint 207 291 17.0579 21.3223 31.9835 45.5933 Constraint 182 603 14.5220 18.1525 27.2288 45.4784 Constraint 17 581 15.9728 19.9660 29.9491 45.2998 Constraint 335 633 9.1004 11.3755 17.0633 45.2997 Constraint 298 481 16.6870 20.8587 31.2881 45.2919 Constraint 315 543 16.9654 21.2067 31.8101 45.2037 Constraint 335 613 7.2213 9.0266 13.5400 45.1997 Constraint 323 472 16.4685 20.5857 30.8785 45.1005 Constraint 66 625 15.8766 19.8457 29.7686 45.0936 Constraint 66 221 15.7963 19.7454 29.6180 45.0934 Constraint 363 559 16.5927 20.7409 31.1113 44.9962 Constraint 472 572 16.8645 21.0806 31.6209 44.8109 Constraint 207 650 11.5144 14.3930 21.5895 44.7578 Constraint 363 659 10.3556 12.9446 19.4168 44.6058 Constraint 349 659 10.6700 13.3376 20.0063 44.5998 Constraint 380 659 13.5264 16.9080 25.3620 44.5998 Constraint 168 642 12.9125 16.1407 24.2110 44.5937 Constraint 504 633 16.5676 20.7095 31.0643 44.5625 Constraint 194 642 11.9799 14.9749 22.4623 44.4819 Constraint 17 456 16.5854 20.7317 31.0976 44.2998 Constraint 17 241 16.1115 20.1394 30.2090 44.2997 Constraint 24 642 9.3859 11.7324 17.5986 44.2997 Constraint 97 354 15.5948 19.4935 29.2403 44.1925 Constraint 435 650 14.5991 18.2488 27.3732 44.1070 Constraint 241 650 13.6672 17.0840 25.6261 44.1069 Constraint 35 472 16.9778 21.2222 31.8333 44.0996 Constraint 168 257 16.2676 20.3345 30.5018 44.0903 Constraint 173 595 15.6627 19.5784 29.3676 44.0890 Constraint 310 543 17.2888 21.6110 32.4165 43.9212 Constraint 342 659 13.2844 16.6055 24.9083 43.7262 Constraint 182 526 14.3871 17.9839 26.9758 43.6905 Constraint 371 659 10.1250 12.6562 18.9843 43.6058 Constraint 291 481 16.5662 20.7078 31.0617 43.6041 Constraint 388 659 12.6499 15.8123 23.7185 43.5999 Constraint 194 406 16.1255 20.1569 30.2353 43.3782 Constraint 323 509 16.5054 20.6318 30.9477 43.3040 Constraint 168 552 16.4739 20.5923 30.8885 43.2998 Constraint 335 534 16.1117 20.1396 30.2094 43.2998 Constraint 335 625 10.4389 13.0487 19.5730 43.2997 Constraint 323 456 16.5369 20.6711 31.0066 43.2031 Constraint 66 429 16.0276 20.0345 30.0517 43.0938 Constraint 354 659 11.9224 14.9030 22.3545 42.5999 Constraint 233 659 12.7569 15.9461 23.9192 42.5999 Constraint 221 659 12.0244 15.0305 22.5458 42.5999 Constraint 182 354 14.6482 18.3102 27.4653 42.3785 Constraint 168 543 15.3929 19.2411 28.8617 42.2998 Constraint 9 588 15.2771 19.0964 28.6446 42.1998 Constraint 9 443 12.6131 15.7664 23.6495 42.1998 Constraint 9 435 14.3735 17.9669 26.9503 42.1998 Constraint 9 429 14.5987 18.2483 27.3725 42.1998 Constraint 9 399 15.6371 19.5464 29.3196 42.1998 Constraint 9 388 9.7649 12.2062 18.3093 42.1998 Constraint 9 380 12.0578 15.0723 22.6084 42.1998 Constraint 9 371 8.8640 11.0800 16.6200 42.1998 Constraint 9 363 9.2591 11.5739 17.3609 42.1998 Constraint 9 349 10.6569 13.3211 19.9816 42.1998 Constraint 9 342 12.6236 15.7795 23.6692 42.1998 Constraint 9 233 12.7885 15.9856 23.9784 42.1998 Constraint 17 310 16.7390 20.9238 31.3857 42.1997 Constraint 200 552 16.6229 20.7786 31.1679 42.1806 Constraint 44 200 16.0605 20.0757 30.1135 42.0997 Constraint 305 650 14.8918 18.6148 27.9222 42.0950 Constraint 182 595 15.3258 19.1572 28.7358 42.0772 Constraint 92 418 15.8650 19.8313 29.7469 41.9997 Constraint 182 613 14.0604 17.5755 26.3633 41.5819 Constraint 173 642 13.3874 16.7343 25.1014 41.4937 Constraint 257 465 16.7502 20.9378 31.4067 41.3245 Constraint 17 613 8.0955 10.1193 15.1790 41.1998 Constraint 248 650 15.0537 18.8171 28.2256 41.1140 Constraint 24 504 17.0259 21.2824 31.9236 40.9996 Constraint 200 642 12.2774 15.3467 23.0201 40.6818 Constraint 291 642 16.1726 20.2158 30.3236 40.4389 Constraint 315 435 16.8605 21.0756 31.6134 40.3039 Constraint 17 335 10.9138 13.6422 20.4633 40.2998 Constraint 17 633 6.3975 7.9969 11.9953 40.2998 Constraint 443 559 16.9535 21.1919 31.7878 40.2962 Constraint 84 213 15.7236 19.6545 29.4817 40.2840 Constraint 207 659 13.0627 16.3284 24.4926 40.2628 Constraint 9 354 12.9615 16.2019 24.3028 40.1998 Constraint 9 221 12.0939 15.1173 22.6760 40.1998 Constraint 66 633 15.2081 19.0102 28.5152 40.1936 Constraint 283 399 16.6652 20.8315 31.2472 39.9358 Constraint 257 659 14.7901 18.4876 27.7314 39.5999 Constraint 200 543 16.4688 20.5860 30.8790 39.5784 Constraint 114 207 16.3542 20.4427 30.6640 39.4210 Constraint 17 625 6.2239 7.7799 11.6698 39.2998 Constraint 114 335 13.1057 16.3821 24.5732 39.0997 Constraint 35 200 16.0487 20.0608 30.0913 39.0997 Constraint 24 465 17.0351 21.2939 31.9409 38.9998 Constraint 552 633 16.5963 20.7453 31.1180 38.8082 Constraint 315 642 16.1145 20.1431 30.2147 38.7400 Constraint 182 625 12.3350 15.4187 23.1280 38.6819 Constraint 241 659 14.7381 18.4227 27.6340 38.6059 Constraint 213 659 14.4231 18.0289 27.0433 38.5999 Constraint 173 633 14.3257 17.9072 26.8607 38.3937 Constraint 9 305 15.7869 19.7337 29.6005 38.1998 Constraint 9 134 15.8783 19.8479 29.7719 38.1998 Constraint 9 323 14.9134 18.6418 27.9626 38.1998 Constraint 97 488 16.2259 20.2824 30.4236 38.1995 Constraint 97 213 15.9376 19.9221 29.8831 38.1928 Constraint 97 349 15.6248 19.5310 29.2965 38.1925 Constraint 51 472 16.5211 20.6514 30.9771 38.0937 Constraint 443 650 13.9282 17.4102 26.1154 37.8071 Constraint 9 213 13.7958 17.2447 25.8670 37.1998 Constraint 9 603 10.2355 12.7944 19.1916 37.1998 Constraint 9 595 12.8574 16.0717 24.1076 37.1998 Constraint 134 650 14.9013 18.6266 27.9400 37.1733 Constraint 335 543 16.8266 21.0333 31.5499 36.9998 Constraint 399 650 15.6748 19.5936 29.3903 36.7950 Constraint 97 363 15.6406 19.5507 29.3260 36.1929 Constraint 148 650 14.5750 18.2188 27.3282 36.1733 Constraint 429 650 15.2014 19.0017 28.5025 35.9214 Constraint 182 642 13.2944 16.6180 24.9270 35.6819 Constraint 182 633 14.6712 18.3390 27.5086 35.5819 Constraint 173 534 15.7459 19.6823 29.5235 35.2996 Constraint 44 650 13.4848 16.8560 25.2840 35.2995 Constraint 323 650 14.5510 18.1888 27.2832 35.2334 Constraint 9 241 15.4253 19.2816 28.9224 35.1998 Constraint 9 148 15.4512 19.3140 28.9710 35.1998 Constraint 35 283 16.9686 21.2108 31.8162 35.0997 Constraint 142 650 15.8662 19.8327 29.7491 34.9733 Constraint 35 650 13.4892 16.8615 25.2922 34.2997 Constraint 168 406 15.3906 19.2382 28.8573 34.2893 Constraint 264 456 16.9544 21.1931 31.7896 34.2029 Constraint 106 371 16.0556 20.0695 30.1042 34.1962 Constraint 504 642 15.9738 19.9672 29.9508 34.0128 Constraint 221 572 16.9649 21.2062 31.8093 33.9997 Constraint 200 588 15.8426 19.8032 29.7049 33.9771 Constraint 418 642 15.8556 19.8195 29.7292 33.9345 Constraint 335 456 16.7712 20.9640 31.4459 33.2999 Constraint 335 642 11.4023 14.2529 21.3794 33.2997 Constraint 298 429 16.9512 21.1891 31.7836 33.2921 Constraint 84 221 16.3358 20.4198 30.6297 33.2842 Constraint 9 257 15.3266 19.1582 28.7373 33.1998 Constraint 275 497 16.3521 20.4402 30.6603 32.9129 Constraint 298 642 16.1322 20.1653 30.2479 32.7402 Constraint 354 572 17.1550 21.4438 32.1656 32.6739 Constraint 9 497 16.3336 20.4171 30.6256 32.1998 Constraint 9 207 11.3374 14.1717 21.2576 32.1998 Constraint 17 200 14.9456 18.6820 28.0230 32.1998 Constraint 97 435 16.2370 20.2963 30.4444 32.1928 Constraint 9 613 8.6229 10.7786 16.1679 32.0998 Constraint 182 406 16.0587 20.0734 30.1100 32.0906 Constraint 84 472 16.3013 20.3766 30.5649 32.0874 Constraint 248 659 15.7055 19.6319 29.4478 31.7323 Constraint 518 642 16.0074 20.0092 30.0138 31.7130 Constraint 200 650 13.9293 17.4116 26.1174 31.5818 Constraint 371 671 10.5957 13.2447 19.8670 31.4116 Constraint 363 671 10.5464 13.1830 19.7745 31.4116 Constraint 349 671 10.7376 13.4220 20.1330 31.4116 Constraint 221 671 12.4005 15.5007 23.2510 31.4116 Constraint 9 633 6.1041 7.6302 11.4452 31.1998 Constraint 9 625 6.2002 7.7502 11.6253 31.1998 Constraint 35 659 14.8041 18.5051 27.7576 31.1997 Constraint 106 388 16.2243 20.2804 30.4206 31.1963 Constraint 173 349 15.1854 18.9817 28.4726 31.1903 Constraint 17 194 14.8242 18.5302 27.7953 31.0997 Constraint 97 418 15.3318 19.1648 28.7472 30.9997 Constraint 406 642 16.2091 20.2614 30.3921 30.8082 Constraint 305 659 15.3085 19.1356 28.7034 30.6000 Constraint 233 671 12.9666 16.2083 24.3124 30.4116 Constraint 17 642 8.7182 10.8977 16.3466 30.2998 Constraint 534 625 17.0171 21.2713 31.9070 30.2128 Constraint 9 335 12.1157 15.1447 22.7170 30.1999 Constraint 24 168 16.0829 20.1036 30.1554 30.1998 Constraint 44 659 14.7395 18.4244 27.6366 30.1997 Constraint 310 650 15.1484 18.9355 28.4032 30.1141 Constraint 275 588 16.8330 21.0412 31.5618 30.0881 Constraint 148 659 15.9688 19.9610 29.9416 30.0734 Constraint 44 465 17.0606 21.3258 31.9887 29.9998 Constraint 44 194 16.1544 20.1930 30.2895 29.9997 Constraint 75 625 16.5490 20.6863 31.0294 29.9937 Constraint 481 572 16.8230 21.0288 31.5432 29.9894 Constraint 354 671 11.6078 14.5098 21.7647 29.4117 Constraint 443 659 14.8456 18.5570 27.8355 29.4059 Constraint 182 349 15.7065 19.6332 29.4497 29.3906 Constraint 9 456 15.8926 19.8658 29.7987 29.1998 Constraint 182 534 15.5907 19.4884 29.2325 29.0999 Constraint 283 633 16.5550 20.6938 31.0407 29.0057 Constraint 497 650 15.5429 19.4286 29.1430 28.8082 Constraint 275 642 15.8498 19.8122 29.7183 28.4389 Constraint 380 671 13.3936 16.7420 25.1129 28.4117 Constraint 194 650 12.4682 15.5853 23.3779 28.3819 Constraint 182 552 17.0653 21.3317 31.9975 28.1000 Constraint 35 194 15.9020 19.8774 29.8162 27.9998 Constraint 342 671 13.1501 16.4376 24.6564 27.5380 Constraint 168 650 13.1159 16.3949 24.5924 27.3938 Constraint 465 642 15.5753 19.4691 29.2037 27.3368 Constraint 24 650 10.1365 12.6707 19.0060 27.2998 Constraint 97 221 16.1088 20.1360 30.2040 27.1929 Constraint 24 173 14.6640 18.3300 27.4951 26.9998 Constraint 92 435 16.4809 20.6011 30.9016 26.9928 Constraint 323 659 14.3555 17.9444 26.9166 26.7323 Constraint 388 671 12.7222 15.9027 23.8541 26.4117 Constraint 92 241 15.4079 19.2599 28.8899 26.2929 Constraint 17 122 16.9379 21.1723 31.7585 26.1997 Constraint 75 633 16.4328 20.5410 30.8116 26.1938 Constraint 92 349 15.7231 19.6539 29.4809 26.0929 Constraint 241 572 17.0701 21.3377 32.0065 25.9997 Constraint 275 472 16.5066 20.6333 30.9499 25.7094 Constraint 241 671 14.3540 17.9426 26.9138 25.4118 Constraint 194 659 14.2118 17.7647 26.6470 25.3880 Constraint 291 488 16.7038 20.8797 31.3196 25.3042 Constraint 194 534 15.8189 19.7737 29.6605 25.2998 Constraint 291 456 16.9892 21.2365 31.8547 25.2032 Constraint 24 659 11.4580 14.3225 21.4838 25.1999 Constraint 173 342 15.7552 19.6940 29.5410 25.1903 Constraint 35 275 16.9789 21.2236 31.8354 25.0998 Constraint 92 354 16.0155 20.0194 30.0291 25.0928 Constraint 207 671 13.0342 16.2928 24.4392 25.0746 Constraint 134 659 15.8015 19.7518 29.6277 25.0734 Constraint 114 429 16.6065 20.7582 31.1372 24.7998 Constraint 310 659 15.4535 19.3169 28.9753 24.7323 Constraint 435 659 14.5604 18.2004 27.3007 24.6060 Constraint 213 671 14.0873 17.6091 26.4137 24.4117 Constraint 257 429 16.8584 21.0730 31.6095 24.2920 Constraint 122 194 16.3856 20.4820 30.7231 24.2012 Constraint 9 642 7.6341 9.5426 14.3139 24.1999 Constraint 173 543 15.8662 19.8328 29.7492 24.1997 Constraint 182 342 15.7129 19.6411 29.4617 24.1906 Constraint 488 642 15.8187 19.7734 29.6601 24.1141 Constraint 92 363 15.4560 19.3200 28.9799 24.0929 Constraint 3 388 11.9820 14.9775 22.4663 23.9999 Constraint 3 380 14.1301 17.6627 26.4940 23.9999 Constraint 3 371 11.2716 14.0895 21.1342 23.9999 Constraint 3 363 10.7652 13.4565 20.1848 23.9999 Constraint 3 354 14.2501 17.8127 26.7190 23.9999 Constraint 3 349 11.3439 14.1799 21.2698 23.9999 Constraint 3 342 13.6086 17.0107 25.5160 23.9999 Constraint 3 233 14.2813 17.8516 26.7774 23.9999 Constraint 3 221 14.3604 17.9506 26.9258 23.9999 Constraint 44 481 17.2419 21.5524 32.3286 23.9998 Constraint 248 418 16.6206 20.7757 31.1636 23.9996 Constraint 92 481 16.1834 20.2292 30.3439 23.9879 Constraint 92 488 16.2184 20.2730 30.4095 23.9878 Constraint 349 488 16.9194 21.1493 31.7239 23.9139 Constraint 472 650 16.1520 20.1901 30.2851 23.6047 Constraint 182 543 16.1049 20.1311 30.1967 23.5011 Constraint 257 671 14.2201 17.7751 26.6627 23.4117 Constraint 435 671 15.3842 19.2302 28.8453 23.4117 Constraint 335 650 13.1162 16.3953 24.5929 23.2997 Constraint 9 200 14.3743 17.9679 26.9519 23.1999 Constraint 9 194 14.0046 17.5057 26.2586 23.0998 Constraint 194 305 16.4072 20.5091 30.7636 23.0891 Constraint 3 443 14.7474 18.4343 27.6514 22.9999 Constraint 97 603 16.5322 20.6653 30.9979 22.9929 Constraint 194 581 16.3938 20.4922 30.7383 22.9772 Constraint 429 659 15.1276 18.9094 28.3642 22.5263 Constraint 275 559 15.5950 19.4937 29.2406 22.3500 Constraint 17 248 16.7335 20.9169 31.3753 22.2998 Constraint 9 248 16.3081 20.3851 30.5776 22.1998 Constraint 182 257 15.9427 19.9283 29.8925 22.1907 Constraint 97 613 15.8383 19.7978 29.6968 22.0964 Constraint 92 613 15.5687 19.4609 29.1914 22.0964 Constraint 66 488 15.9426 19.9282 29.8924 22.0937 Constraint 92 603 15.7498 19.6873 29.5309 22.0929 Constraint 17 298 16.9895 21.2369 31.8553 21.9998 Constraint 200 659 14.4470 18.0588 27.0881 21.5880 Constraint 173 650 12.1980 15.2475 22.8712 21.4939 Constraint 168 659 13.3380 16.6725 25.0088 21.3938 Constraint 443 671 15.0576 18.8220 28.2330 21.3117 Constraint 168 581 16.1834 20.2293 30.3439 21.2894 Constraint 456 650 16.0359 20.0449 30.0674 21.2032 Constraint 335 659 14.3650 17.9562 26.9343 21.1998 Constraint 24 671 11.9724 14.9654 22.4482 21.0999 Constraint 66 472 15.7460 19.6825 29.5238 21.0937 Constraint 84 388 15.9751 19.9689 29.9534 21.0843 Constraint 24 182 14.3620 17.9526 26.9288 20.9999 Constraint 24 291 16.9900 21.2375 31.8563 20.9998 Constraint 148 671 15.6359 19.5448 29.3172 20.9734 Constraint 488 633 16.4488 20.5611 30.8416 20.5689 Constraint 248 671 15.4460 19.3075 28.9612 20.4118 Constraint 182 650 13.7051 17.1313 25.6970 20.3820 Constraint 349 465 17.3719 21.7148 32.5722 20.3245 Constraint 17 526 16.9431 21.1788 31.7683 20.2998 Constraint 106 207 16.4642 20.5802 30.8703 20.1963 Constraint 66 456 15.7002 19.6252 29.4378 20.0998 Constraint 84 481 15.7616 19.7021 29.5531 20.0878 Constraint 92 213 15.6580 19.5724 29.3587 20.0808 Constraint 3 603 11.8769 14.8461 22.2692 19.9999 Constraint 3 595 14.3255 17.9069 26.8603 19.9999 Constraint 17 315 16.2143 20.2679 30.4018 19.9998 Constraint 194 588 15.9238 19.9047 29.8571 19.9773 Constraint 114 633 16.6691 20.8364 31.2546 19.9735 Constraint 323 488 16.4494 20.5618 30.8427 19.3043 Constraint 275 399 15.7842 19.7302 29.5953 19.2024 Constraint 173 257 16.5944 20.7430 31.1144 19.2009 Constraint 9 418 16.4870 20.6088 30.9132 19.1999 Constraint 9 581 16.7822 20.9777 31.4666 19.1998 Constraint 35 671 13.4253 16.7816 25.1724 19.0997 Constraint 44 671 13.2062 16.5077 24.7615 19.0997 Constraint 3 435 16.1955 20.2444 30.3666 18.9999 Constraint 9 310 16.2847 20.3558 30.5337 18.9998 Constraint 134 671 15.3939 19.2424 28.8636 18.9734 Constraint 543 625 16.9384 21.1730 31.7596 18.4854 Constraint 194 543 16.1728 20.2160 30.3240 18.4011 Constraint 84 488 15.4889 19.3611 29.0416 18.0878 Constraint 3 257 15.8324 19.7905 29.6858 17.9999 Constraint 194 552 16.3159 20.3948 30.5922 17.9999 Constraint 173 552 16.7726 20.9658 31.4487 17.9998 Constraint 75 465 16.2655 20.3319 30.4978 17.9936 Constraint 323 671 13.6706 17.0882 25.6323 17.5380 Constraint 310 671 15.0059 18.7574 28.1361 17.4118 Constraint 305 671 14.6128 18.2660 27.3989 17.4118 Constraint 173 659 13.2076 16.5096 24.7643 17.3939 Constraint 17 650 7.8759 9.8448 14.7672 17.2999 Constraint 51 650 15.1260 18.9075 28.3613 17.2997 Constraint 58 650 15.7268 19.6584 29.4877 17.2936 Constraint 335 671 14.4016 18.0020 27.0030 17.0999 Constraint 84 429 16.4307 20.5384 30.8075 17.0878 Constraint 3 213 15.9074 19.8842 29.8263 16.9999 Constraint 9 406 16.8294 21.0367 31.5551 16.9998 Constraint 173 406 15.6594 19.5743 29.3615 16.9998 Constraint 75 443 16.7716 20.9645 31.4467 16.9997 Constraint 92 472 16.2575 20.3219 30.4828 16.9879 Constraint 122 182 16.4886 20.6108 30.9162 16.8001 Constraint 399 659 14.4820 18.1025 27.1537 16.4000 Constraint 114 443 16.7819 20.9773 31.4660 16.3210 Constraint 9 182 15.4784 19.3479 29.0219 16.1999 Constraint 17 659 9.4809 11.8511 17.7767 16.1999 Constraint 142 659 16.1179 20.1474 30.2211 16.1998 Constraint 182 305 16.3336 20.4170 30.6255 16.1907 Constraint 84 371 16.1464 20.1829 30.2744 16.0963 Constraint 3 588 15.4392 19.2990 28.9485 16.0000 Constraint 3 323 14.1078 17.6348 26.4522 16.0000 Constraint 3 613 9.8701 12.3377 18.5065 16.0000 Constraint 3 207 13.7936 17.2420 25.8630 15.9999 Constraint 371 559 16.8223 21.0278 31.5417 15.9964 Constraint 465 633 16.7179 20.8974 31.3461 15.9938 Constraint 122 173 17.0069 21.2586 31.8879 15.8001 Constraint 173 671 15.5816 19.4770 29.2155 15.4010 Constraint 497 659 15.5209 19.4011 29.1016 15.4000 Constraint 371 683 12.1396 15.1745 22.7617 15.3106 Constraint 363 683 12.9955 16.2443 24.3665 15.3106 Constraint 17 182 15.5130 19.3913 29.0870 15.0999 Constraint 51 671 16.0825 20.1031 30.1547 15.0999 Constraint 66 207 15.2542 19.0677 28.6016 15.0939 Constraint 51 200 16.2864 20.3581 30.5371 15.0939 Constraint 335 472 17.2865 21.6081 32.4121 15.0000 Constraint 3 633 7.7460 9.6825 14.5237 15.0000 Constraint 3 625 8.2733 10.3416 15.5124 15.0000 Constraint 3 429 15.6631 19.5789 29.3684 14.9999 Constraint 354 418 16.6678 20.8347 31.2521 14.9998 Constraint 173 581 16.8694 21.0868 31.6302 14.9998 Constraint 168 588 16.1186 20.1482 30.2223 14.9894 Constraint 182 659 14.2444 17.8055 26.7082 14.4881 Constraint 194 671 14.1172 17.6465 26.4697 14.4011 Constraint 354 683 13.6691 17.0864 25.6296 14.3106 Constraint 349 683 13.3959 16.7448 25.1172 14.3106 Constraint 106 429 15.8345 19.7931 29.6897 14.1963 Constraint 207 572 16.8335 21.0418 31.5628 14.1250 Constraint 17 671 10.6380 13.2975 19.9463 14.0999 Constraint 17 142 17.2479 21.5598 32.3397 14.0999 Constraint 9 173 13.1811 16.4764 24.7146 14.0998 Constraint 3 335 12.5529 15.6911 23.5367 14.0000 Constraint 97 456 15.9557 19.9446 29.9169 14.0000 Constraint 17 173 13.3079 16.6349 24.9523 13.9998 Constraint 264 418 16.0668 20.0835 30.1252 13.9878 Constraint 221 683 13.2057 16.5071 24.7606 13.9736 Constraint 481 642 16.3464 20.4330 30.6495 13.6760 Constraint 168 305 15.8905 19.8632 29.7948 13.3904 Constraint 315 650 14.9303 18.6629 27.9943 13.3404 Constraint 9 650 7.8587 9.8234 14.7350 13.1999 Constraint 66 443 15.9534 19.9417 29.9126 13.1000 Constraint 51 659 15.8304 19.7880 29.6821 13.0999 Constraint 142 671 15.9528 19.9410 29.9115 13.0998 Constraint 66 642 16.0274 20.0342 30.0514 13.0939 Constraint 3 305 15.5653 19.4566 29.1849 13.0000 Constraint 3 642 9.4328 11.7910 17.6866 13.0000 Constraint 3 399 16.4745 20.5931 30.8897 12.9999 Constraint 3 241 16.2577 20.3221 30.4832 12.9999 Constraint 17 518 16.9341 21.1676 31.7514 12.9999 Constraint 182 581 16.3372 20.4215 30.6322 12.9894 Constraint 92 388 16.1601 20.2001 30.3002 12.9809 Constraint 92 221 15.2233 19.0291 28.5437 12.9809 Constraint 114 625 16.6660 20.8325 31.2488 12.9735 Constraint 275 625 17.2074 21.5093 32.2639 12.9393 Constraint 349 481 17.2535 21.5669 32.3504 12.9254 Constraint 283 497 16.0887 20.1108 30.1663 12.9254 Constraint 315 659 15.1860 18.9825 28.4737 12.5326 Constraint 200 671 13.3157 16.6446 24.9669 12.5011 Constraint 9 168 14.8326 18.5408 27.8111 12.1999 Constraint 9 142 16.7470 20.9338 31.4006 12.1998 Constraint 9 659 8.9767 11.2209 16.8314 12.0999 Constraint 24 683 13.2175 16.5218 24.7827 12.0999 Constraint 66 481 15.8588 19.8235 29.7352 12.0939 Constraint 3 134 16.3485 20.4356 30.6534 11.9999 Constraint 58 200 15.3333 19.1666 28.7499 11.9939 Constraint 275 650 15.3811 19.2263 28.8395 11.9394 Constraint 310 509 17.0914 21.3643 32.0464 11.7219 Constraint 588 671 14.7843 18.4804 27.7206 11.4119 Constraint 168 671 14.7730 18.4662 27.6993 11.4010 Constraint 264 465 16.9451 21.1814 31.7721 11.3247 Constraint 399 671 14.9691 18.7114 28.0671 11.3119 Constraint 233 683 14.0097 17.5121 26.2682 11.3106 Constraint 388 683 13.8734 17.3418 26.0127 11.3106 Constraint 526 650 15.9829 19.9786 29.9679 11.2081 Constraint 58 671 15.9354 19.9192 29.8788 11.0999 Constraint 58 659 16.6287 20.7859 31.1789 11.0999 Constraint 24 559 16.3120 20.3900 30.5850 11.0000 Constraint 3 310 15.7033 19.6292 29.4438 11.0000 Constraint 3 148 16.5765 20.7206 31.0809 10.9999 Constraint 44 173 16.3514 20.4393 30.6590 10.9998 Constraint 75 207 15.1360 18.9200 28.3800 10.9939 Constraint 92 429 16.5253 20.6566 30.9849 10.9808 Constraint 207 683 13.3216 16.6520 24.9780 10.9735 Constraint 472 671 16.0406 20.0508 30.0761 10.9107 Constraint 283 518 17.1114 21.3893 32.0840 10.8250 Constraint 84 633 16.8153 21.0191 31.5287 10.1999 Constraint 283 642 16.7882 20.9852 31.4778 10.1391 Constraint 84 456 16.0140 20.0176 30.0263 10.1000 Constraint 17 168 15.2867 19.1083 28.6625 10.1000 Constraint 114 200 16.8004 21.0004 31.5007 10.1000 Constraint 248 429 17.1330 21.4162 32.1243 10.0107 Constraint 248 559 16.0004 20.0005 30.0007 10.0000 Constraint 9 671 9.4574 11.8217 17.7326 10.0000 Constraint 241 683 14.9749 18.7186 28.0779 9.9736 Constraint 122 650 15.6753 19.5942 29.3912 9.9734 Constraint 264 650 15.2732 19.0915 28.6372 9.9392 Constraint 418 650 15.1029 18.8787 28.3180 9.9345 Constraint 418 659 15.4677 19.3346 29.0020 9.5265 Constraint 298 650 14.8090 18.5113 27.7670 9.3345 Constraint 497 671 15.1894 18.9867 28.4801 9.3118 Constraint 275 671 16.2914 20.3643 30.5464 9.1370 Constraint 371 692 13.0761 16.3451 24.5177 9.1000 Constraint 363 692 13.9219 17.4024 26.1036 9.1000 Constraint 354 692 14.6686 18.3357 27.5036 9.1000 Constraint 221 692 13.9977 17.4971 26.2457 9.1000 Constraint 17 683 12.8023 16.0029 24.0044 9.0999 Constraint 283 603 17.0471 21.3089 31.9633 9.0881 Constraint 35 173 15.9412 19.9265 29.8898 9.0000 Constraint 3 315 15.8306 19.7882 29.6824 9.0000 Constraint 92 456 15.9122 19.8902 29.8353 9.0000 Constraint 17 572 16.6135 20.7669 31.1504 9.0000 Constraint 335 509 17.0949 21.3686 32.0529 9.0000 Constraint 35 182 16.8117 21.0146 31.5219 8.9999 Constraint 9 315 16.3602 20.4502 30.6754 8.9999 Constraint 315 418 17.2972 21.6215 32.4322 8.9999 Constraint 310 418 16.9266 21.1583 31.7374 8.9999 Constraint 114 168 16.8585 21.0731 31.6097 8.9998 Constraint 173 588 16.4967 20.6209 30.9313 8.9998 Constraint 92 371 15.3243 19.1553 28.7330 8.9929 Constraint 114 642 17.1721 21.4651 32.1977 8.8737 Constraint 406 650 14.0442 17.5552 26.3328 8.8082 Constraint 456 659 16.1777 20.2221 30.3331 8.8022 Constraint 472 659 15.5456 19.4320 29.1480 8.6108 Constraint 298 659 14.8953 18.6192 27.9288 8.5336 Constraint 342 683 14.8508 18.5635 27.8453 8.4369 Constraint 200 323 16.4200 20.5250 30.7875 8.3906 Constraint 213 683 15.1548 18.9435 28.4153 8.3106 Constraint 248 683 16.3223 20.4028 30.6043 8.3106 Constraint 380 683 13.8324 17.2905 25.9357 8.3106 Constraint 581 659 13.8622 17.3277 25.9916 8.1253 Constraint 552 642 16.8689 21.0861 31.6291 8.0130 Constraint 581 671 15.3378 19.1723 28.7584 8.0108 Constraint 3 581 16.7178 20.8973 31.3459 8.0000 Constraint 24 543 17.0570 21.3212 31.9818 8.0000 Constraint 3 248 16.8200 21.0250 31.5374 8.0000 Constraint 84 625 16.8646 21.0808 31.6212 8.0000 Constraint 200 335 15.7393 19.6741 29.5111 7.9999 Constraint 168 264 16.6265 20.7831 31.1746 7.9999 Constraint 44 168 16.2577 20.3221 30.4832 7.9998 Constraint 58 194 15.5315 19.4144 29.1216 7.9939 Constraint 182 588 16.1070 20.1338 30.2007 7.9894 Constraint 291 650 14.8458 18.5573 27.8359 7.9394 Constraint 443 683 13.7954 17.2442 25.8663 7.8736 Constraint 310 488 16.9815 21.2268 31.8403 7.7109 Constraint 275 659 16.1307 20.1634 30.2451 7.6382 Constraint 315 671 14.3501 17.9377 26.9065 7.5381 Constraint 406 659 13.7279 17.1599 25.7398 7.5265 Constraint 429 671 13.5200 16.9000 25.3501 7.4382 Constraint 518 650 15.5746 19.4683 29.2024 7.4071 Constraint 182 671 15.2604 19.0756 28.6133 7.4012 Constraint 264 659 16.1264 20.1580 30.2370 7.3384 Constraint 257 683 15.3024 19.1280 28.6920 7.3106 Constraint 9 526 16.1338 20.1673 30.2509 7.1999 Constraint 264 671 15.9607 19.9509 29.9263 7.1370 Constraint 349 692 13.6824 17.1030 25.6545 7.1000 Constraint 241 692 15.5577 19.4472 29.1707 7.1000 Constraint 233 692 14.6073 18.2591 27.3887 7.1000 Constraint 200 683 14.2695 17.8369 26.7554 7.0999 Constraint 35 683 13.8803 17.3504 26.0256 7.0999 Constraint 283 406 15.0473 18.8092 28.2137 7.0109 Constraint 275 406 14.8511 18.5639 27.8458 7.0109 Constraint 97 465 16.0965 20.1206 30.1809 7.0000 Constraint 44 182 16.8184 21.0230 31.5345 6.9999 Constraint 9 472 15.9414 19.9268 29.8902 6.9999 Constraint 9 298 17.0772 21.3465 32.0197 6.9999 Constraint 51 194 16.5019 20.6273 30.9410 6.9940 Constraint 97 388 16.2000 20.2500 30.3750 6.9929 Constraint 504 650 16.7117 20.8896 31.3345 6.7130 Constraint 509 642 16.8951 21.1189 31.6783 6.6118 Constraint 298 671 14.2578 17.8222 26.7333 6.5383 Constraint 488 650 15.9030 19.8788 29.8182 6.4071 Constraint 291 659 15.1017 18.8771 28.3157 6.3385 Constraint 406 671 15.0867 18.8583 28.2875 6.3120 Constraint 595 683 14.9969 18.7461 28.1192 6.3107 Constraint 526 659 15.0175 18.7719 28.1579 6.1385 Constraint 315 472 16.3210 20.4012 30.6018 6.1009 Constraint 283 472 16.9370 21.1713 31.7569 6.1009 Constraint 106 633 17.2424 21.5530 32.3295 6.0999 Constraint 44 683 14.9246 18.6557 27.9836 6.0999 Constraint 35 465 17.3456 21.6820 32.5230 6.0000 Constraint 3 650 8.9177 11.1471 16.7207 6.0000 Constraint 241 559 15.4701 19.3377 29.0065 6.0000 Constraint 114 182 17.5041 21.8802 32.8203 6.0000 Constraint 3 406 16.9196 21.1495 31.7242 6.0000 Constraint 3 298 17.2883 21.6103 32.4155 6.0000 Constraint 9 683 12.0636 15.0795 22.6192 6.0000 Constraint 3 200 16.0174 20.0218 30.0327 6.0000 Constraint 17 472 17.3535 21.6919 32.5378 5.9999 Constraint 106 443 15.8716 19.8395 29.7592 5.9963 Constraint 106 168 14.2219 17.7774 26.6660 5.9963 Constraint 51 465 16.1898 20.2372 30.3559 5.9940 Constraint 66 465 15.4830 19.3538 29.0306 5.9939 Constraint 75 642 16.5730 20.7162 31.0743 5.9939 Constraint 168 310 16.2308 20.2885 30.4327 5.9894 Constraint 283 650 15.7288 19.6609 29.4914 5.9394 Constraint 173 305 16.3044 20.3805 30.5708 5.8001 Constraint 572 650 14.0604 17.5755 26.3632 5.7071 Constraint 283 659 16.7276 20.9094 31.3642 5.4383 Constraint 418 671 15.2329 19.0411 28.5617 5.4383 Constraint 488 659 16.1083 20.1354 30.2031 5.4133 Constraint 456 671 15.7123 19.6403 29.4605 5.4012 Constraint 465 671 16.8039 21.0048 31.5072 5.3370 Constraint 488 671 16.6387 20.7984 31.1975 5.3120 Constraint 283 435 17.0535 21.3168 31.9752 5.2145 Constraint 283 371 14.6863 18.3578 27.5368 5.2145 Constraint 275 603 16.4368 20.5459 30.8189 5.2145 Constraint 275 543 15.8662 19.8327 29.7491 5.2145 Constraint 275 518 15.9567 19.9459 29.9189 5.2145 Constraint 275 509 15.8051 19.7564 29.6346 5.2145 Constraint 275 435 15.3136 19.1420 28.7129 5.2145 Constraint 275 388 16.6844 20.8555 31.2832 5.2145 Constraint 298 443 17.4440 21.8050 32.7075 5.2144 Constraint 323 481 16.1692 20.2115 30.3173 5.2040 Constraint 9 122 16.3387 20.4234 30.6351 5.1999 Constraint 291 671 14.6594 18.3243 27.4864 5.1370 Constraint 572 659 13.5864 16.9830 25.4745 5.1324 Constraint 248 692 16.2522 20.3153 30.4729 5.1000 Constraint 66 650 16.3903 20.4879 30.7319 5.0940 Constraint 3 659 9.1557 11.4446 17.1669 5.0000 Constraint 35 168 16.3815 20.4769 30.7153 5.0000 Constraint 173 335 16.2775 20.3469 30.5204 5.0000 Constraint 213 692 13.7373 17.1716 25.7574 5.0000 Constraint 207 692 11.5525 14.4406 21.6609 5.0000 Constraint 200 692 11.5082 14.3852 21.5778 5.0000 Constraint 194 692 14.2335 17.7918 26.6878 5.0000 Constraint 173 692 15.6523 19.5654 29.3481 5.0000 Constraint 168 692 16.4099 20.5123 30.7685 5.0000 Constraint 24 509 17.0055 21.2568 31.8852 5.0000 Constraint 17 552 16.7508 20.9385 31.4077 5.0000 Constraint 194 683 13.1695 16.4619 24.6928 5.0000 Constraint 200 310 17.0491 21.3114 31.9671 5.0000 Constraint 200 298 16.9900 21.2375 31.8563 5.0000 Constraint 168 683 14.1075 17.6344 26.4516 4.9999 Constraint 3 173 11.8757 14.8446 22.2669 4.9999 Constraint 3 168 15.9106 19.8883 29.8324 4.9999 Constraint 9 518 15.4691 19.3364 29.0046 4.9999 Constraint 9 488 16.1888 20.2361 30.3541 4.9999 Constraint 207 559 16.8244 21.0304 31.5457 4.9965 Constraint 51 481 15.5079 19.3849 29.0773 4.9940 Constraint 75 200 14.2687 17.8359 26.7538 4.9939 Constraint 122 671 16.7012 20.8765 31.3148 4.9736 Constraint 518 671 15.8469 19.8086 29.7129 4.9108 Constraint 526 671 15.1102 18.8877 28.3316 4.5383 Constraint 481 633 16.0496 20.0620 30.0930 4.3761 Constraint 435 683 13.7588 17.1985 25.7977 4.3107 Constraint 534 633 16.1834 20.2292 30.3439 4.2747 Constraint 315 509 16.8316 21.0395 31.5592 4.1929 Constraint 315 488 17.0995 21.3744 32.0616 4.1929 Constraint 207 315 17.1249 21.4061 32.1091 4.1929 Constraint 534 642 17.4193 21.7741 32.6612 4.1393 Constraint 518 659 14.4180 18.0224 27.0337 4.1385 Constraint 182 264 16.6384 20.7980 31.1969 4.1000 Constraint 335 683 14.0406 17.5507 26.3261 4.0999 Constraint 106 625 16.8139 21.0174 31.5261 4.0999 Constraint 106 182 14.3430 17.9287 26.8930 4.0965 Constraint 310 481 17.4249 21.7811 32.6716 4.0005 Constraint 3 122 17.2323 21.5404 32.3106 4.0000 Constraint 24 534 16.8820 21.1025 31.6537 4.0000 Constraint 122 659 15.6063 19.5079 29.2618 4.0000 Constraint 9 692 14.2647 17.8308 26.7462 4.0000 Constraint 3 683 14.7511 18.4389 27.6583 4.0000 Constraint 3 671 12.5161 15.6451 23.4677 4.0000 Constraint 58 168 17.1337 21.4171 32.1256 4.0000 Constraint 173 683 14.1067 17.6334 26.4500 4.0000 Constraint 3 418 17.4835 21.8544 32.7816 4.0000 Constraint 194 335 15.8807 19.8509 29.7763 4.0000 Constraint 106 173 14.0976 17.6220 26.4331 3.9965 Constraint 349 559 15.8367 19.7959 29.6938 3.9965 Constraint 221 559 15.5394 19.4243 29.1364 3.9965 Constraint 97 371 12.6663 15.8329 23.7493 3.9930 Constraint 97 207 14.6016 18.2519 27.3779 3.9930 Constraint 97 194 15.4563 19.3204 28.9806 3.9930 Constraint 97 182 13.1070 16.3837 24.5756 3.9930 Constraint 84 465 12.7421 15.9276 23.8914 3.9879 Constraint 84 207 14.2912 17.8640 26.7960 3.9844 Constraint 92 207 13.5234 16.9042 25.3563 3.9809 Constraint 92 200 12.1021 15.1277 22.6915 3.9809 Constraint 92 194 12.5289 15.6611 23.4916 3.9809 Constraint 92 182 10.0759 12.5948 18.8922 3.9809 Constraint 148 683 15.2932 19.1165 28.6748 3.9737 Constraint 323 683 13.1214 16.4018 24.6027 3.4370 Constraint 194 323 16.3810 20.4763 30.7144 3.4012 Constraint 66 200 14.6907 18.3633 27.5450 3.3951 Constraint 182 323 16.0073 20.0091 30.0137 3.3906 Constraint 465 650 16.2674 20.3342 30.5013 3.3308 Constraint 497 683 14.9272 18.6590 27.9885 3.3107 Constraint 472 683 15.9932 19.9915 29.9873 3.3107 Constraint 305 683 15.5749 19.4686 29.2029 3.3107 Constraint 509 633 15.8953 19.8691 29.8036 3.2748 Constraint 488 683 16.7240 20.9050 31.3574 3.2107 Constraint 399 683 15.1767 18.9708 28.4562 3.2107 Constraint 504 659 15.7777 19.7221 29.5831 3.1385 Constraint 283 671 14.1519 17.6899 26.5348 3.1372 Constraint 114 194 16.5999 20.7499 31.1248 3.1013 Constraint 257 692 15.4397 19.2996 28.9494 3.1000 Constraint 595 692 12.3505 15.4381 23.1572 3.1000 Constraint 380 692 10.4686 13.0858 19.6286 3.1000 Constraint 342 692 13.3376 16.6720 25.0079 3.1000 Constraint 148 692 14.7564 18.4455 27.6682 3.1000 Constraint 134 692 15.9395 19.9243 29.8865 3.1000 Constraint 35 692 11.9334 14.9168 22.3752 3.1000 Constraint 24 692 9.5655 11.9569 17.9353 3.1000 Constraint 194 264 17.3765 21.7206 32.5809 3.1000 Constraint 51 683 15.8804 19.8505 29.7758 3.1000 Constraint 66 671 16.5726 20.7157 31.0735 3.1000 Constraint 106 194 14.1237 17.6546 26.4819 3.0965 Constraint 200 291 16.6949 20.8686 31.3029 3.0000 Constraint 168 291 17.5152 21.8941 32.8411 3.0000 Constraint 168 275 17.2465 21.5581 32.3372 3.0000 Constraint 75 168 17.0245 21.2806 31.9210 3.0000 Constraint 354 559 15.7900 19.7375 29.6063 3.0000 Constraint 603 692 9.8116 12.2645 18.3967 3.0000 Constraint 588 692 14.6485 18.3107 27.4660 3.0000 Constraint 581 692 16.3659 20.4573 30.6860 3.0000 Constraint 526 692 16.2854 20.3567 30.5350 3.0000 Constraint 497 692 13.8444 17.3055 25.9583 3.0000 Constraint 443 692 7.8792 9.8490 14.7735 3.0000 Constraint 435 692 11.2131 14.0163 21.0245 3.0000 Constraint 429 692 10.2378 12.7973 19.1959 3.0000 Constraint 418 692 13.9259 17.4074 26.1111 3.0000 Constraint 406 692 15.7362 19.6703 29.5054 3.0000 Constraint 399 692 13.3538 16.6923 25.0384 3.0000 Constraint 388 692 7.6343 9.5429 14.3143 3.0000 Constraint 44 692 12.4424 15.5530 23.3295 3.0000 Constraint 429 683 13.5572 16.9465 25.4198 3.0000 Constraint 349 509 16.9760 21.2201 31.8301 3.0000 Constraint 291 429 17.3432 21.6790 32.5185 3.0000 Constraint 283 543 15.6112 19.5139 29.2709 3.0000 Constraint 283 509 16.3985 20.4981 30.7471 3.0000 Constraint 283 418 16.4541 20.5676 30.8515 3.0000 Constraint 97 429 16.5594 20.6993 31.0489 3.0000 Constraint 3 497 17.1467 21.4334 32.1501 2.9999 Constraint 3 456 16.7168 20.8960 31.3440 2.9999 Constraint 3 194 12.4991 15.6238 23.4358 2.9999 Constraint 283 388 16.8721 21.0901 31.6351 2.9999 Constraint 275 418 16.5062 20.6327 30.9491 2.9999 Constraint 264 443 16.8170 21.0212 31.5318 2.9999 Constraint 264 429 17.2701 21.5876 32.3814 2.9999 Constraint 17 291 17.5921 21.9901 32.9851 2.9999 Constraint 9 552 17.0277 21.2846 31.9270 2.9999 Constraint 9 504 16.3417 20.4271 30.6406 2.9999 Constraint 9 465 14.6591 18.3239 27.4858 2.9999 Constraint 9 264 17.5713 21.9641 32.9462 2.9999 Constraint 465 659 16.3302 20.4128 30.6192 2.9998 Constraint 92 625 15.0295 18.7869 28.1803 2.9965 Constraint 559 633 17.2099 21.5123 32.2685 2.9965 Constraint 58 182 16.1785 20.2231 30.3347 2.9940 Constraint 75 650 15.7511 19.6889 29.5333 2.9940 Constraint 75 194 14.0259 17.5323 26.2985 2.9940 Constraint 168 323 14.9374 18.6717 28.0076 2.9894 Constraint 84 200 11.2783 14.0979 21.1468 2.9844 Constraint 84 194 13.4284 16.7854 25.1782 2.9844 Constraint 84 182 11.5697 14.4621 21.6931 2.9844 Constraint 134 683 15.4030 19.2538 28.8806 2.9736 Constraint 298 683 13.8806 17.3508 26.0262 2.4370 Constraint 275 683 16.2655 20.3319 30.4979 2.4370 Constraint 418 683 16.1649 20.2062 30.3093 2.3370 Constraint 298 465 16.2562 20.3202 30.4803 2.3250 Constraint 275 488 15.6573 19.5716 29.3574 2.2146 Constraint 275 481 13.7590 17.1987 25.7981 2.2146 Constraint 283 625 17.2484 21.5605 32.3407 2.1393 Constraint 51 692 14.0403 17.5504 26.3256 2.1000 Constraint 17 692 14.6922 18.3652 27.5479 2.1000 Constraint 559 659 15.3746 19.2183 28.8274 2.0372 Constraint 509 659 16.4559 20.5699 30.8549 2.0372 Constraint 572 671 12.4596 15.5745 23.3618 2.0371 Constraint 3 66 17.1190 21.3988 32.0982 2.0000 Constraint 168 335 16.3488 20.4360 30.6541 2.0000 Constraint 51 168 17.3556 21.6944 32.5417 2.0000 Constraint 17 488 17.0962 21.3702 32.0553 2.0000 Constraint 9 291 17.3292 21.6615 32.4922 2.0000 Constraint 3 692 16.0298 20.0373 30.0559 2.0000 Constraint 518 692 14.4981 18.1227 27.1840 2.0000 Constraint 509 692 17.3102 21.6378 32.4567 2.0000 Constraint 504 692 16.4800 20.6000 30.8999 2.0000 Constraint 488 692 13.7799 17.2249 25.8374 2.0000 Constraint 481 692 16.7343 20.9179 31.3769 2.0000 Constraint 472 692 14.2048 17.7560 26.6339 2.0000 Constraint 465 692 13.3561 16.6951 25.0426 2.0000 Constraint 465 683 16.4888 20.6110 30.9164 2.0000 Constraint 456 692 10.5427 13.1784 19.7675 2.0000 Constraint 456 683 14.2869 17.8587 26.7880 2.0000 Constraint 194 310 17.4466 21.8082 32.7123 2.0000 Constraint 194 298 17.0396 21.2995 31.9493 2.0000 Constraint 97 633 12.8732 16.0915 24.1372 1.9965 Constraint 92 633 13.9359 17.4198 26.1298 1.9965 Constraint 97 200 14.3681 17.9601 26.9402 1.9930 Constraint 97 173 8.2953 10.3691 15.5536 1.9930 Constraint 97 168 6.7396 8.4245 12.6368 1.9930 Constraint 92 443 17.4666 21.8332 32.7498 1.9930 Constraint 92 173 5.3838 6.7297 10.0946 1.9930 Constraint 92 168 6.7426 8.4282 12.6423 1.9930 Constraint 92 465 11.9589 14.9486 22.4230 1.9879 Constraint 142 683 16.3674 20.4592 30.6888 1.9737 Constraint 481 659 17.2257 21.5321 32.2982 1.8014 Constraint 552 659 15.8074 19.7593 29.6389 1.7382 Constraint 552 650 15.8152 19.7690 29.6535 1.7322 Constraint 114 173 16.5244 20.6555 30.9833 1.7001 Constraint 481 650 16.9701 21.2127 31.8190 1.6760 Constraint 509 650 16.8852 21.1065 31.6597 1.6119 Constraint 534 659 16.8106 21.0132 31.5198 1.4383 Constraint 315 683 13.0234 16.2792 24.4189 1.4370 Constraint 264 683 16.1327 20.1659 30.2489 1.4370 Constraint 66 194 13.3454 16.6817 25.0226 1.3951 Constraint 588 683 14.9743 18.7178 28.0767 1.3370 Constraint 543 633 14.9889 18.7361 28.1042 1.2748 Constraint 543 642 17.1760 21.4700 32.2050 1.2107 Constraint 518 683 15.5826 19.4782 29.2173 1.2107 Constraint 406 683 14.9639 18.7049 28.0573 1.2107 Constraint 315 456 15.9740 19.9675 29.9513 1.2035 Constraint 310 456 15.6512 19.5640 29.3459 1.2035 Constraint 283 456 15.8540 19.8174 29.7262 1.2035 Constraint 275 456 12.4459 15.5574 23.3360 1.2035 Constraint 335 692 8.1006 10.1258 15.1887 1.1000 Constraint 323 692 11.4665 14.3331 21.4996 1.1000 Constraint 315 692 14.9142 18.6428 27.9642 1.1000 Constraint 310 692 13.5146 16.8933 25.3399 1.1000 Constraint 305 692 12.3975 15.4968 23.2452 1.1000 Constraint 298 692 15.4672 19.3340 29.0009 1.1000 Constraint 291 692 16.0970 20.1213 30.1819 1.1000 Constraint 264 692 16.8330 21.0412 31.5619 1.1000 Constraint 142 692 16.2587 20.3234 30.4851 1.1000 Constraint 122 692 15.7025 19.6281 29.4422 1.1000 Constraint 66 692 17.4521 21.8151 32.7227 1.1000 Constraint 66 659 16.8648 21.0810 31.6214 1.1000 Constraint 106 200 11.1230 13.9038 20.8557 1.0965 Constraint 559 671 12.1000 15.1250 22.6875 1.0372 Constraint 534 671 14.4930 18.1163 27.1744 1.0372 Constraint 509 671 15.3948 19.2435 28.8653 1.0372 Constraint 504 671 13.5347 16.9184 25.3776 1.0372 Constraint 481 671 16.5273 20.6591 30.9886 1.0372 Constraint 572 692 17.1865 21.4832 32.2248 1.0000 Constraint 200 572 16.9409 21.1761 31.7642 1.0000 Constraint 58 692 13.3549 16.6937 25.0405 1.0000 Constraint 75 173 17.0563 21.3204 31.9806 1.0000 Constraint 58 173 17.1744 21.4680 32.2020 1.0000 Constraint 51 173 17.5877 21.9846 32.9770 1.0000 Constraint 114 659 14.5894 18.2367 27.3551 1.0000 Constraint 114 650 14.7940 18.4925 27.7388 1.0000 Constraint 106 659 16.3434 20.4293 30.6439 1.0000 Constraint 106 650 17.2816 21.6020 32.4030 1.0000 Constraint 75 671 15.7691 19.7113 29.5670 1.0000 Constraint 35 481 17.3957 21.7446 32.6169 1.0000 Constraint 24 275 16.8335 21.0418 31.5627 1.0000 Constraint 24 264 15.8593 19.8242 29.7363 1.0000 Constraint 24 114 16.5013 20.6266 30.9399 1.0000 Constraint 17 559 17.2138 21.5173 32.2759 1.0000 Constraint 17 504 17.0874 21.3593 32.0389 1.0000 Constraint 24 92 16.7849 20.9811 31.4716 1.0000 Constraint 194 291 17.5273 21.9092 32.8638 1.0000 Constraint 84 443 16.4827 20.6034 30.9050 1.0000 Constraint 58 683 17.1824 21.4780 32.2170 1.0000 Constraint 3 182 11.2722 14.0902 21.1353 1.0000 Constraint 200 559 16.0986 20.1232 30.1848 0.9965 Constraint 97 659 11.4169 14.2711 21.4066 0.9965 Constraint 97 650 8.8054 11.0067 16.5101 0.9965 Constraint 97 642 5.6372 7.0466 10.5698 0.9965 Constraint 97 625 9.6178 12.0223 18.0334 0.9965 Constraint 92 659 11.7786 14.7232 22.0848 0.9965 Constraint 92 650 8.0663 10.0828 15.1242 0.9965 Constraint 92 642 6.7873 8.4842 12.7263 0.9965 Constraint 84 173 9.2974 11.6217 17.4326 0.9965 Constraint 84 168 9.0722 11.3403 17.0104 0.9965 Constraint 75 182 9.9823 12.4779 18.7168 0.9940 Constraint 66 182 12.9447 16.1809 24.2713 0.9940 Constraint 122 683 17.0420 21.3025 31.9538 0.9737 Constraint 481 683 17.5406 21.9257 32.8886 0.8737 Constraint 173 264 14.4073 18.0092 27.0137 0.8001 Constraint 559 650 14.9943 18.7429 28.1144 0.7382 Constraint 543 650 16.9746 21.2183 31.8275 0.7382 Constraint 534 650 16.2077 20.2597 30.3895 0.7382 Constraint 173 310 16.7097 20.8871 31.3306 0.7001 Constraint 173 291 16.4544 20.5680 30.8521 0.7001 Constraint 173 275 16.8510 21.0637 31.5956 0.7001 Constraint 526 683 11.2153 14.0191 21.0286 0.4370 Constraint 310 683 9.5839 11.9798 17.9698 0.4370 Constraint 291 683 8.9588 11.1985 16.7978 0.4370 Constraint 283 683 11.8876 14.8595 22.2893 0.4370 Constraint 581 683 6.5968 8.2460 12.3690 0.3370 Constraint 572 683 3.9468 4.9334 7.4002 0.3370 Constraint 559 683 5.1083 6.3854 9.5781 0.3370 Constraint 559 642 15.3568 19.1960 28.7940 0.3370 Constraint 552 683 8.0065 10.0081 15.0122 0.3370 Constraint 552 671 8.0360 10.0450 15.0675 0.3370 Constraint 543 683 12.4103 15.5128 23.2692 0.3370 Constraint 543 671 12.1864 15.2330 22.8495 0.3370 Constraint 543 659 14.4461 18.0576 27.0865 0.3370 Constraint 534 683 12.1956 15.2445 22.8668 0.3370 Constraint 509 683 15.0170 18.7712 28.1568 0.3370 Constraint 504 683 13.2884 16.6105 24.9157 0.3370 Constraint 323 465 17.5835 21.9793 32.9690 0.3370 Constraint 291 465 16.8467 21.0583 31.5875 0.3370 Constraint 275 465 15.5082 19.3853 29.0779 0.3370 Constraint 283 692 14.8134 18.5167 27.7750 0.1000 Constraint 275 692 11.1600 13.9500 20.9249 0.1000 Constraint 182 683 16.1719 20.2149 30.3224 0.1000 Constraint 106 683 17.3235 21.6544 32.4816 0.1000 Constraint 66 683 15.8319 19.7899 29.6848 0.1000 Constraint 683 692 0.8000 1.0000 1.5000 0.0000 Constraint 671 692 0.8000 1.0000 1.5000 0.0000 Constraint 671 683 0.8000 1.0000 1.5000 0.0000 Constraint 659 692 0.8000 1.0000 1.5000 0.0000 Constraint 659 683 0.8000 1.0000 1.5000 0.0000 Constraint 659 671 0.8000 1.0000 1.5000 0.0000 Constraint 650 692 0.8000 1.0000 1.5000 0.0000 Constraint 650 683 0.8000 1.0000 1.5000 0.0000 Constraint 650 671 0.8000 1.0000 1.5000 0.0000 Constraint 650 659 0.8000 1.0000 1.5000 0.0000 Constraint 642 692 0.8000 1.0000 1.5000 0.0000 Constraint 642 683 0.8000 1.0000 1.5000 0.0000 Constraint 642 671 0.8000 1.0000 1.5000 0.0000 Constraint 642 659 0.8000 1.0000 1.5000 0.0000 Constraint 642 650 0.8000 1.0000 1.5000 0.0000 Constraint 633 692 0.8000 1.0000 1.5000 0.0000 Constraint 633 683 0.8000 1.0000 1.5000 0.0000 Constraint 633 671 0.8000 1.0000 1.5000 0.0000 Constraint 633 659 0.8000 1.0000 1.5000 0.0000 Constraint 633 650 0.8000 1.0000 1.5000 0.0000 Constraint 633 642 0.8000 1.0000 1.5000 0.0000 Constraint 625 692 0.8000 1.0000 1.5000 0.0000 Constraint 625 683 0.8000 1.0000 1.5000 0.0000 Constraint 625 671 0.8000 1.0000 1.5000 0.0000 Constraint 625 659 0.8000 1.0000 1.5000 0.0000 Constraint 625 650 0.8000 1.0000 1.5000 0.0000 Constraint 625 642 0.8000 1.0000 1.5000 0.0000 Constraint 625 633 0.8000 1.0000 1.5000 0.0000 Constraint 613 692 0.8000 1.0000 1.5000 0.0000 Constraint 613 683 0.8000 1.0000 1.5000 0.0000 Constraint 613 671 0.8000 1.0000 1.5000 0.0000 Constraint 613 659 0.8000 1.0000 1.5000 0.0000 Constraint 613 650 0.8000 1.0000 1.5000 0.0000 Constraint 613 642 0.8000 1.0000 1.5000 0.0000 Constraint 613 633 0.8000 1.0000 1.5000 0.0000 Constraint 613 625 0.8000 1.0000 1.5000 0.0000 Constraint 603 683 0.8000 1.0000 1.5000 0.0000 Constraint 603 671 0.8000 1.0000 1.5000 0.0000 Constraint 603 659 0.8000 1.0000 1.5000 0.0000 Constraint 603 650 0.8000 1.0000 1.5000 0.0000 Constraint 603 642 0.8000 1.0000 1.5000 0.0000 Constraint 603 633 0.8000 1.0000 1.5000 0.0000 Constraint 603 625 0.8000 1.0000 1.5000 0.0000 Constraint 603 613 0.8000 1.0000 1.5000 0.0000 Constraint 595 671 0.8000 1.0000 1.5000 0.0000 Constraint 595 659 0.8000 1.0000 1.5000 0.0000 Constraint 595 650 0.8000 1.0000 1.5000 0.0000 Constraint 595 642 0.8000 1.0000 1.5000 0.0000 Constraint 595 633 0.8000 1.0000 1.5000 0.0000 Constraint 595 625 0.8000 1.0000 1.5000 0.0000 Constraint 595 613 0.8000 1.0000 1.5000 0.0000 Constraint 595 603 0.8000 1.0000 1.5000 0.0000 Constraint 588 659 0.8000 1.0000 1.5000 0.0000 Constraint 588 650 0.8000 1.0000 1.5000 0.0000 Constraint 588 642 0.8000 1.0000 1.5000 0.0000 Constraint 588 633 0.8000 1.0000 1.5000 0.0000 Constraint 588 625 0.8000 1.0000 1.5000 0.0000 Constraint 588 613 0.8000 1.0000 1.5000 0.0000 Constraint 588 603 0.8000 1.0000 1.5000 0.0000 Constraint 588 595 0.8000 1.0000 1.5000 0.0000 Constraint 581 650 0.8000 1.0000 1.5000 0.0000 Constraint 581 642 0.8000 1.0000 1.5000 0.0000 Constraint 581 633 0.8000 1.0000 1.5000 0.0000 Constraint 581 625 0.8000 1.0000 1.5000 0.0000 Constraint 581 613 0.8000 1.0000 1.5000 0.0000 Constraint 581 603 0.8000 1.0000 1.5000 0.0000 Constraint 581 595 0.8000 1.0000 1.5000 0.0000 Constraint 581 588 0.8000 1.0000 1.5000 0.0000 Constraint 572 642 0.8000 1.0000 1.5000 0.0000 Constraint 572 633 0.8000 1.0000 1.5000 0.0000 Constraint 572 625 0.8000 1.0000 1.5000 0.0000 Constraint 572 613 0.8000 1.0000 1.5000 0.0000 Constraint 572 603 0.8000 1.0000 1.5000 0.0000 Constraint 572 595 0.8000 1.0000 1.5000 0.0000 Constraint 572 588 0.8000 1.0000 1.5000 0.0000 Constraint 572 581 0.8000 1.0000 1.5000 0.0000 Constraint 559 692 0.8000 1.0000 1.5000 0.0000 Constraint 559 625 0.8000 1.0000 1.5000 0.0000 Constraint 559 613 0.8000 1.0000 1.5000 0.0000 Constraint 559 603 0.8000 1.0000 1.5000 0.0000 Constraint 559 595 0.8000 1.0000 1.5000 0.0000 Constraint 559 588 0.8000 1.0000 1.5000 0.0000 Constraint 559 581 0.8000 1.0000 1.5000 0.0000 Constraint 559 572 0.8000 1.0000 1.5000 0.0000 Constraint 552 692 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 603 0.8000 1.0000 1.5000 0.0000 Constraint 552 595 0.8000 1.0000 1.5000 0.0000 Constraint 552 588 0.8000 1.0000 1.5000 0.0000 Constraint 552 581 0.8000 1.0000 1.5000 0.0000 Constraint 552 572 0.8000 1.0000 1.5000 0.0000 Constraint 552 559 0.8000 1.0000 1.5000 0.0000 Constraint 543 692 0.8000 1.0000 1.5000 0.0000 Constraint 543 603 0.8000 1.0000 1.5000 0.0000 Constraint 543 595 0.8000 1.0000 1.5000 0.0000 Constraint 543 588 0.8000 1.0000 1.5000 0.0000 Constraint 543 581 0.8000 1.0000 1.5000 0.0000 Constraint 543 572 0.8000 1.0000 1.5000 0.0000 Constraint 543 559 0.8000 1.0000 1.5000 0.0000 Constraint 543 552 0.8000 1.0000 1.5000 0.0000 Constraint 534 692 0.8000 1.0000 1.5000 0.0000 Constraint 534 595 0.8000 1.0000 1.5000 0.0000 Constraint 534 588 0.8000 1.0000 1.5000 0.0000 Constraint 534 581 0.8000 1.0000 1.5000 0.0000 Constraint 534 572 0.8000 1.0000 1.5000 0.0000 Constraint 534 559 0.8000 1.0000 1.5000 0.0000 Constraint 534 552 0.8000 1.0000 1.5000 0.0000 Constraint 534 543 0.8000 1.0000 1.5000 0.0000 Constraint 526 588 0.8000 1.0000 1.5000 0.0000 Constraint 526 581 0.8000 1.0000 1.5000 0.0000 Constraint 526 572 0.8000 1.0000 1.5000 0.0000 Constraint 526 559 0.8000 1.0000 1.5000 0.0000 Constraint 526 552 0.8000 1.0000 1.5000 0.0000 Constraint 526 543 0.8000 1.0000 1.5000 0.0000 Constraint 526 534 0.8000 1.0000 1.5000 0.0000 Constraint 518 581 0.8000 1.0000 1.5000 0.0000 Constraint 518 572 0.8000 1.0000 1.5000 0.0000 Constraint 518 559 0.8000 1.0000 1.5000 0.0000 Constraint 518 552 0.8000 1.0000 1.5000 0.0000 Constraint 518 543 0.8000 1.0000 1.5000 0.0000 Constraint 518 534 0.8000 1.0000 1.5000 0.0000 Constraint 518 526 0.8000 1.0000 1.5000 0.0000 Constraint 509 572 0.8000 1.0000 1.5000 0.0000 Constraint 509 559 0.8000 1.0000 1.5000 0.0000 Constraint 509 552 0.8000 1.0000 1.5000 0.0000 Constraint 509 543 0.8000 1.0000 1.5000 0.0000 Constraint 509 534 0.8000 1.0000 1.5000 0.0000 Constraint 509 526 0.8000 1.0000 1.5000 0.0000 Constraint 509 518 0.8000 1.0000 1.5000 0.0000 Constraint 504 559 0.8000 1.0000 1.5000 0.0000 Constraint 504 552 0.8000 1.0000 1.5000 0.0000 Constraint 504 543 0.8000 1.0000 1.5000 0.0000 Constraint 504 534 0.8000 1.0000 1.5000 0.0000 Constraint 504 526 0.8000 1.0000 1.5000 0.0000 Constraint 504 518 0.8000 1.0000 1.5000 0.0000 Constraint 504 509 0.8000 1.0000 1.5000 0.0000 Constraint 497 559 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 543 0.8000 1.0000 1.5000 0.0000 Constraint 497 534 0.8000 1.0000 1.5000 0.0000 Constraint 497 526 0.8000 1.0000 1.5000 0.0000 Constraint 497 518 0.8000 1.0000 1.5000 0.0000 Constraint 497 509 0.8000 1.0000 1.5000 0.0000 Constraint 497 504 0.8000 1.0000 1.5000 0.0000 Constraint 488 552 0.8000 1.0000 1.5000 0.0000 Constraint 488 543 0.8000 1.0000 1.5000 0.0000 Constraint 488 534 0.8000 1.0000 1.5000 0.0000 Constraint 488 526 0.8000 1.0000 1.5000 0.0000 Constraint 488 518 0.8000 1.0000 1.5000 0.0000 Constraint 488 509 0.8000 1.0000 1.5000 0.0000 Constraint 488 504 0.8000 1.0000 1.5000 0.0000 Constraint 488 497 0.8000 1.0000 1.5000 0.0000 Constraint 481 543 0.8000 1.0000 1.5000 0.0000 Constraint 481 534 0.8000 1.0000 1.5000 0.0000 Constraint 481 526 0.8000 1.0000 1.5000 0.0000 Constraint 481 518 0.8000 1.0000 1.5000 0.0000 Constraint 481 509 0.8000 1.0000 1.5000 0.0000 Constraint 481 504 0.8000 1.0000 1.5000 0.0000 Constraint 481 497 0.8000 1.0000 1.5000 0.0000 Constraint 481 488 0.8000 1.0000 1.5000 0.0000 Constraint 472 534 0.8000 1.0000 1.5000 0.0000 Constraint 472 526 0.8000 1.0000 1.5000 0.0000 Constraint 472 518 0.8000 1.0000 1.5000 0.0000 Constraint 472 509 0.8000 1.0000 1.5000 0.0000 Constraint 472 504 0.8000 1.0000 1.5000 0.0000 Constraint 472 497 0.8000 1.0000 1.5000 0.0000 Constraint 472 488 0.8000 1.0000 1.5000 0.0000 Constraint 472 481 0.8000 1.0000 1.5000 0.0000 Constraint 465 572 0.8000 1.0000 1.5000 0.0000 Constraint 465 526 0.8000 1.0000 1.5000 0.0000 Constraint 465 518 0.8000 1.0000 1.5000 0.0000 Constraint 465 509 0.8000 1.0000 1.5000 0.0000 Constraint 465 504 0.8000 1.0000 1.5000 0.0000 Constraint 465 497 0.8000 1.0000 1.5000 0.0000 Constraint 465 488 0.8000 1.0000 1.5000 0.0000 Constraint 465 481 0.8000 1.0000 1.5000 0.0000 Constraint 465 472 0.8000 1.0000 1.5000 0.0000 Constraint 456 518 0.8000 1.0000 1.5000 0.0000 Constraint 456 509 0.8000 1.0000 1.5000 0.0000 Constraint 456 504 0.8000 1.0000 1.5000 0.0000 Constraint 456 497 0.8000 1.0000 1.5000 0.0000 Constraint 456 488 0.8000 1.0000 1.5000 0.0000 Constraint 456 481 0.8000 1.0000 1.5000 0.0000 Constraint 456 472 0.8000 1.0000 1.5000 0.0000 Constraint 456 465 0.8000 1.0000 1.5000 0.0000 Constraint 443 504 0.8000 1.0000 1.5000 0.0000 Constraint 443 497 0.8000 1.0000 1.5000 0.0000 Constraint 443 488 0.8000 1.0000 1.5000 0.0000 Constraint 443 481 0.8000 1.0000 1.5000 0.0000 Constraint 443 472 0.8000 1.0000 1.5000 0.0000 Constraint 443 465 0.8000 1.0000 1.5000 0.0000 Constraint 443 456 0.8000 1.0000 1.5000 0.0000 Constraint 435 497 0.8000 1.0000 1.5000 0.0000 Constraint 435 488 0.8000 1.0000 1.5000 0.0000 Constraint 435 481 0.8000 1.0000 1.5000 0.0000 Constraint 435 472 0.8000 1.0000 1.5000 0.0000 Constraint 435 465 0.8000 1.0000 1.5000 0.0000 Constraint 435 456 0.8000 1.0000 1.5000 0.0000 Constraint 435 443 0.8000 1.0000 1.5000 0.0000 Constraint 429 488 0.8000 1.0000 1.5000 0.0000 Constraint 429 481 0.8000 1.0000 1.5000 0.0000 Constraint 429 472 0.8000 1.0000 1.5000 0.0000 Constraint 429 465 0.8000 1.0000 1.5000 0.0000 Constraint 429 456 0.8000 1.0000 1.5000 0.0000 Constraint 429 443 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 418 481 0.8000 1.0000 1.5000 0.0000 Constraint 418 472 0.8000 1.0000 1.5000 0.0000 Constraint 418 465 0.8000 1.0000 1.5000 0.0000 Constraint 418 456 0.8000 1.0000 1.5000 0.0000 Constraint 418 443 0.8000 1.0000 1.5000 0.0000 Constraint 418 435 0.8000 1.0000 1.5000 0.0000 Constraint 418 429 0.8000 1.0000 1.5000 0.0000 Constraint 406 465 0.8000 1.0000 1.5000 0.0000 Constraint 406 456 0.8000 1.0000 1.5000 0.0000 Constraint 406 443 0.8000 1.0000 1.5000 0.0000 Constraint 406 435 0.8000 1.0000 1.5000 0.0000 Constraint 406 429 0.8000 1.0000 1.5000 0.0000 Constraint 406 418 0.8000 1.0000 1.5000 0.0000 Constraint 399 456 0.8000 1.0000 1.5000 0.0000 Constraint 399 443 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 418 0.8000 1.0000 1.5000 0.0000 Constraint 399 406 0.8000 1.0000 1.5000 0.0000 Constraint 388 443 0.8000 1.0000 1.5000 0.0000 Constraint 388 435 0.8000 1.0000 1.5000 0.0000 Constraint 388 429 0.8000 1.0000 1.5000 0.0000 Constraint 388 418 0.8000 1.0000 1.5000 0.0000 Constraint 388 406 0.8000 1.0000 1.5000 0.0000 Constraint 388 399 0.8000 1.0000 1.5000 0.0000 Constraint 380 435 0.8000 1.0000 1.5000 0.0000 Constraint 380 429 0.8000 1.0000 1.5000 0.0000 Constraint 380 418 0.8000 1.0000 1.5000 0.0000 Constraint 380 406 0.8000 1.0000 1.5000 0.0000 Constraint 380 399 0.8000 1.0000 1.5000 0.0000 Constraint 380 388 0.8000 1.0000 1.5000 0.0000 Constraint 371 429 0.8000 1.0000 1.5000 0.0000 Constraint 371 418 0.8000 1.0000 1.5000 0.0000 Constraint 371 406 0.8000 1.0000 1.5000 0.0000 Constraint 371 399 0.8000 1.0000 1.5000 0.0000 Constraint 371 388 0.8000 1.0000 1.5000 0.0000 Constraint 371 380 0.8000 1.0000 1.5000 0.0000 Constraint 363 418 0.8000 1.0000 1.5000 0.0000 Constraint 363 406 0.8000 1.0000 1.5000 0.0000 Constraint 363 399 0.8000 1.0000 1.5000 0.0000 Constraint 363 388 0.8000 1.0000 1.5000 0.0000 Constraint 363 380 0.8000 1.0000 1.5000 0.0000 Constraint 363 371 0.8000 1.0000 1.5000 0.0000 Constraint 354 543 0.8000 1.0000 1.5000 0.0000 Constraint 354 406 0.8000 1.0000 1.5000 0.0000 Constraint 354 399 0.8000 1.0000 1.5000 0.0000 Constraint 354 388 0.8000 1.0000 1.5000 0.0000 Constraint 354 380 0.8000 1.0000 1.5000 0.0000 Constraint 354 371 0.8000 1.0000 1.5000 0.0000 Constraint 354 363 0.8000 1.0000 1.5000 0.0000 Constraint 349 543 0.8000 1.0000 1.5000 0.0000 Constraint 349 399 0.8000 1.0000 1.5000 0.0000 Constraint 349 388 0.8000 1.0000 1.5000 0.0000 Constraint 349 380 0.8000 1.0000 1.5000 0.0000 Constraint 349 371 0.8000 1.0000 1.5000 0.0000 Constraint 349 363 0.8000 1.0000 1.5000 0.0000 Constraint 349 354 0.8000 1.0000 1.5000 0.0000 Constraint 342 388 0.8000 1.0000 1.5000 0.0000 Constraint 342 380 0.8000 1.0000 1.5000 0.0000 Constraint 342 371 0.8000 1.0000 1.5000 0.0000 Constraint 342 363 0.8000 1.0000 1.5000 0.0000 Constraint 342 354 0.8000 1.0000 1.5000 0.0000 Constraint 342 349 0.8000 1.0000 1.5000 0.0000 Constraint 335 488 0.8000 1.0000 1.5000 0.0000 Constraint 335 481 0.8000 1.0000 1.5000 0.0000 Constraint 335 465 0.8000 1.0000 1.5000 0.0000 Constraint 335 388 0.8000 1.0000 1.5000 0.0000 Constraint 335 380 0.8000 1.0000 1.5000 0.0000 Constraint 335 371 0.8000 1.0000 1.5000 0.0000 Constraint 335 363 0.8000 1.0000 1.5000 0.0000 Constraint 335 354 0.8000 1.0000 1.5000 0.0000 Constraint 335 349 0.8000 1.0000 1.5000 0.0000 Constraint 335 342 0.8000 1.0000 1.5000 0.0000 Constraint 323 371 0.8000 1.0000 1.5000 0.0000 Constraint 323 363 0.8000 1.0000 1.5000 0.0000 Constraint 323 354 0.8000 1.0000 1.5000 0.0000 Constraint 323 349 0.8000 1.0000 1.5000 0.0000 Constraint 323 342 0.8000 1.0000 1.5000 0.0000 Constraint 323 335 0.8000 1.0000 1.5000 0.0000 Constraint 315 481 0.8000 1.0000 1.5000 0.0000 Constraint 315 465 0.8000 1.0000 1.5000 0.0000 Constraint 315 443 0.8000 1.0000 1.5000 0.0000 Constraint 315 429 0.8000 1.0000 1.5000 0.0000 Constraint 315 363 0.8000 1.0000 1.5000 0.0000 Constraint 315 354 0.8000 1.0000 1.5000 0.0000 Constraint 315 349 0.8000 1.0000 1.5000 0.0000 Constraint 315 342 0.8000 1.0000 1.5000 0.0000 Constraint 315 335 0.8000 1.0000 1.5000 0.0000 Constraint 315 323 0.8000 1.0000 1.5000 0.0000 Constraint 310 465 0.8000 1.0000 1.5000 0.0000 Constraint 310 443 0.8000 1.0000 1.5000 0.0000 Constraint 310 429 0.8000 1.0000 1.5000 0.0000 Constraint 310 354 0.8000 1.0000 1.5000 0.0000 Constraint 310 349 0.8000 1.0000 1.5000 0.0000 Constraint 310 342 0.8000 1.0000 1.5000 0.0000 Constraint 310 335 0.8000 1.0000 1.5000 0.0000 Constraint 310 323 0.8000 1.0000 1.5000 0.0000 Constraint 310 315 0.8000 1.0000 1.5000 0.0000 Constraint 305 354 0.8000 1.0000 1.5000 0.0000 Constraint 305 349 0.8000 1.0000 1.5000 0.0000 Constraint 305 342 0.8000 1.0000 1.5000 0.0000 Constraint 305 335 0.8000 1.0000 1.5000 0.0000 Constraint 305 323 0.8000 1.0000 1.5000 0.0000 Constraint 305 315 0.8000 1.0000 1.5000 0.0000 Constraint 305 310 0.8000 1.0000 1.5000 0.0000 Constraint 298 349 0.8000 1.0000 1.5000 0.0000 Constraint 298 342 0.8000 1.0000 1.5000 0.0000 Constraint 298 335 0.8000 1.0000 1.5000 0.0000 Constraint 298 323 0.8000 1.0000 1.5000 0.0000 Constraint 298 315 0.8000 1.0000 1.5000 0.0000 Constraint 298 310 0.8000 1.0000 1.5000 0.0000 Constraint 298 305 0.8000 1.0000 1.5000 0.0000 Constraint 291 443 0.8000 1.0000 1.5000 0.0000 Constraint 291 342 0.8000 1.0000 1.5000 0.0000 Constraint 291 335 0.8000 1.0000 1.5000 0.0000 Constraint 291 323 0.8000 1.0000 1.5000 0.0000 Constraint 291 315 0.8000 1.0000 1.5000 0.0000 Constraint 291 310 0.8000 1.0000 1.5000 0.0000 Constraint 291 305 0.8000 1.0000 1.5000 0.0000 Constraint 291 298 0.8000 1.0000 1.5000 0.0000 Constraint 283 488 0.8000 1.0000 1.5000 0.0000 Constraint 283 481 0.8000 1.0000 1.5000 0.0000 Constraint 283 465 0.8000 1.0000 1.5000 0.0000 Constraint 283 443 0.8000 1.0000 1.5000 0.0000 Constraint 283 429 0.8000 1.0000 1.5000 0.0000 Constraint 283 335 0.8000 1.0000 1.5000 0.0000 Constraint 283 323 0.8000 1.0000 1.5000 0.0000 Constraint 283 315 0.8000 1.0000 1.5000 0.0000 Constraint 283 310 0.8000 1.0000 1.5000 0.0000 Constraint 283 305 0.8000 1.0000 1.5000 0.0000 Constraint 283 298 0.8000 1.0000 1.5000 0.0000 Constraint 283 291 0.8000 1.0000 1.5000 0.0000 Constraint 275 443 0.8000 1.0000 1.5000 0.0000 Constraint 275 429 0.8000 1.0000 1.5000 0.0000 Constraint 275 323 0.8000 1.0000 1.5000 0.0000 Constraint 275 315 0.8000 1.0000 1.5000 0.0000 Constraint 275 310 0.8000 1.0000 1.5000 0.0000 Constraint 275 305 0.8000 1.0000 1.5000 0.0000 Constraint 275 298 0.8000 1.0000 1.5000 0.0000 Constraint 275 291 0.8000 1.0000 1.5000 0.0000 Constraint 275 283 0.8000 1.0000 1.5000 0.0000 Constraint 264 323 0.8000 1.0000 1.5000 0.0000 Constraint 264 315 0.8000 1.0000 1.5000 0.0000 Constraint 264 310 0.8000 1.0000 1.5000 0.0000 Constraint 264 305 0.8000 1.0000 1.5000 0.0000 Constraint 264 298 0.8000 1.0000 1.5000 0.0000 Constraint 264 291 0.8000 1.0000 1.5000 0.0000 Constraint 264 283 0.8000 1.0000 1.5000 0.0000 Constraint 264 275 0.8000 1.0000 1.5000 0.0000 Constraint 257 315 0.8000 1.0000 1.5000 0.0000 Constraint 257 310 0.8000 1.0000 1.5000 0.0000 Constraint 257 305 0.8000 1.0000 1.5000 0.0000 Constraint 257 298 0.8000 1.0000 1.5000 0.0000 Constraint 257 291 0.8000 1.0000 1.5000 0.0000 Constraint 257 283 0.8000 1.0000 1.5000 0.0000 Constraint 257 275 0.8000 1.0000 1.5000 0.0000 Constraint 257 264 0.8000 1.0000 1.5000 0.0000 Constraint 248 310 0.8000 1.0000 1.5000 0.0000 Constraint 248 305 0.8000 1.0000 1.5000 0.0000 Constraint 248 298 0.8000 1.0000 1.5000 0.0000 Constraint 248 291 0.8000 1.0000 1.5000 0.0000 Constraint 248 283 0.8000 1.0000 1.5000 0.0000 Constraint 248 275 0.8000 1.0000 1.5000 0.0000 Constraint 248 264 0.8000 1.0000 1.5000 0.0000 Constraint 248 257 0.8000 1.0000 1.5000 0.0000 Constraint 241 305 0.8000 1.0000 1.5000 0.0000 Constraint 241 298 0.8000 1.0000 1.5000 0.0000 Constraint 241 291 0.8000 1.0000 1.5000 0.0000 Constraint 241 283 0.8000 1.0000 1.5000 0.0000 Constraint 241 275 0.8000 1.0000 1.5000 0.0000 Constraint 241 264 0.8000 1.0000 1.5000 0.0000 Constraint 241 257 0.8000 1.0000 1.5000 0.0000 Constraint 241 248 0.8000 1.0000 1.5000 0.0000 Constraint 233 298 0.8000 1.0000 1.5000 0.0000 Constraint 233 291 0.8000 1.0000 1.5000 0.0000 Constraint 233 283 0.8000 1.0000 1.5000 0.0000 Constraint 233 275 0.8000 1.0000 1.5000 0.0000 Constraint 233 264 0.8000 1.0000 1.5000 0.0000 Constraint 233 257 0.8000 1.0000 1.5000 0.0000 Constraint 233 248 0.8000 1.0000 1.5000 0.0000 Constraint 233 241 0.8000 1.0000 1.5000 0.0000 Constraint 221 291 0.8000 1.0000 1.5000 0.0000 Constraint 221 283 0.8000 1.0000 1.5000 0.0000 Constraint 221 275 0.8000 1.0000 1.5000 0.0000 Constraint 221 264 0.8000 1.0000 1.5000 0.0000 Constraint 221 257 0.8000 1.0000 1.5000 0.0000 Constraint 221 248 0.8000 1.0000 1.5000 0.0000 Constraint 221 241 0.8000 1.0000 1.5000 0.0000 Constraint 221 233 0.8000 1.0000 1.5000 0.0000 Constraint 213 283 0.8000 1.0000 1.5000 0.0000 Constraint 213 275 0.8000 1.0000 1.5000 0.0000 Constraint 213 264 0.8000 1.0000 1.5000 0.0000 Constraint 213 257 0.8000 1.0000 1.5000 0.0000 Constraint 213 248 0.8000 1.0000 1.5000 0.0000 Constraint 213 241 0.8000 1.0000 1.5000 0.0000 Constraint 213 233 0.8000 1.0000 1.5000 0.0000 Constraint 213 221 0.8000 1.0000 1.5000 0.0000 Constraint 207 283 0.8000 1.0000 1.5000 0.0000 Constraint 207 275 0.8000 1.0000 1.5000 0.0000 Constraint 207 264 0.8000 1.0000 1.5000 0.0000 Constraint 207 257 0.8000 1.0000 1.5000 0.0000 Constraint 207 248 0.8000 1.0000 1.5000 0.0000 Constraint 207 241 0.8000 1.0000 1.5000 0.0000 Constraint 207 233 0.8000 1.0000 1.5000 0.0000 Constraint 207 221 0.8000 1.0000 1.5000 0.0000 Constraint 207 213 0.8000 1.0000 1.5000 0.0000 Constraint 200 315 0.8000 1.0000 1.5000 0.0000 Constraint 200 283 0.8000 1.0000 1.5000 0.0000 Constraint 200 275 0.8000 1.0000 1.5000 0.0000 Constraint 200 264 0.8000 1.0000 1.5000 0.0000 Constraint 200 257 0.8000 1.0000 1.5000 0.0000 Constraint 200 248 0.8000 1.0000 1.5000 0.0000 Constraint 200 241 0.8000 1.0000 1.5000 0.0000 Constraint 200 233 0.8000 1.0000 1.5000 0.0000 Constraint 200 221 0.8000 1.0000 1.5000 0.0000 Constraint 200 213 0.8000 1.0000 1.5000 0.0000 Constraint 200 207 0.8000 1.0000 1.5000 0.0000 Constraint 194 572 0.8000 1.0000 1.5000 0.0000 Constraint 194 559 0.8000 1.0000 1.5000 0.0000 Constraint 194 315 0.8000 1.0000 1.5000 0.0000 Constraint 194 283 0.8000 1.0000 1.5000 0.0000 Constraint 194 275 0.8000 1.0000 1.5000 0.0000 Constraint 194 257 0.8000 1.0000 1.5000 0.0000 Constraint 194 248 0.8000 1.0000 1.5000 0.0000 Constraint 194 241 0.8000 1.0000 1.5000 0.0000 Constraint 194 233 0.8000 1.0000 1.5000 0.0000 Constraint 194 221 0.8000 1.0000 1.5000 0.0000 Constraint 194 213 0.8000 1.0000 1.5000 0.0000 Constraint 194 207 0.8000 1.0000 1.5000 0.0000 Constraint 194 200 0.8000 1.0000 1.5000 0.0000 Constraint 182 692 0.8000 1.0000 1.5000 0.0000 Constraint 182 572 0.8000 1.0000 1.5000 0.0000 Constraint 182 559 0.8000 1.0000 1.5000 0.0000 Constraint 182 335 0.8000 1.0000 1.5000 0.0000 Constraint 182 315 0.8000 1.0000 1.5000 0.0000 Constraint 182 310 0.8000 1.0000 1.5000 0.0000 Constraint 182 298 0.8000 1.0000 1.5000 0.0000 Constraint 182 291 0.8000 1.0000 1.5000 0.0000 Constraint 182 283 0.8000 1.0000 1.5000 0.0000 Constraint 182 275 0.8000 1.0000 1.5000 0.0000 Constraint 182 248 0.8000 1.0000 1.5000 0.0000 Constraint 182 241 0.8000 1.0000 1.5000 0.0000 Constraint 182 233 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 213 0.8000 1.0000 1.5000 0.0000 Constraint 182 207 0.8000 1.0000 1.5000 0.0000 Constraint 182 200 0.8000 1.0000 1.5000 0.0000 Constraint 182 194 0.8000 1.0000 1.5000 0.0000 Constraint 173 572 0.8000 1.0000 1.5000 0.0000 Constraint 173 559 0.8000 1.0000 1.5000 0.0000 Constraint 173 323 0.8000 1.0000 1.5000 0.0000 Constraint 173 315 0.8000 1.0000 1.5000 0.0000 Constraint 173 298 0.8000 1.0000 1.5000 0.0000 Constraint 173 283 0.8000 1.0000 1.5000 0.0000 Constraint 173 241 0.8000 1.0000 1.5000 0.0000 Constraint 173 233 0.8000 1.0000 1.5000 0.0000 Constraint 173 221 0.8000 1.0000 1.5000 0.0000 Constraint 173 213 0.8000 1.0000 1.5000 0.0000 Constraint 173 207 0.8000 1.0000 1.5000 0.0000 Constraint 173 200 0.8000 1.0000 1.5000 0.0000 Constraint 173 194 0.8000 1.0000 1.5000 0.0000 Constraint 173 182 0.8000 1.0000 1.5000 0.0000 Constraint 168 572 0.8000 1.0000 1.5000 0.0000 Constraint 168 559 0.8000 1.0000 1.5000 0.0000 Constraint 168 315 0.8000 1.0000 1.5000 0.0000 Constraint 168 298 0.8000 1.0000 1.5000 0.0000 Constraint 168 283 0.8000 1.0000 1.5000 0.0000 Constraint 168 233 0.8000 1.0000 1.5000 0.0000 Constraint 168 221 0.8000 1.0000 1.5000 0.0000 Constraint 168 213 0.8000 1.0000 1.5000 0.0000 Constraint 168 207 0.8000 1.0000 1.5000 0.0000 Constraint 168 200 0.8000 1.0000 1.5000 0.0000 Constraint 168 194 0.8000 1.0000 1.5000 0.0000 Constraint 168 182 0.8000 1.0000 1.5000 0.0000 Constraint 168 173 0.8000 1.0000 1.5000 0.0000 Constraint 148 200 0.8000 1.0000 1.5000 0.0000 Constraint 148 194 0.8000 1.0000 1.5000 0.0000 Constraint 148 182 0.8000 1.0000 1.5000 0.0000 Constraint 148 173 0.8000 1.0000 1.5000 0.0000 Constraint 148 168 0.8000 1.0000 1.5000 0.0000 Constraint 142 194 0.8000 1.0000 1.5000 0.0000 Constraint 142 182 0.8000 1.0000 1.5000 0.0000 Constraint 142 173 0.8000 1.0000 1.5000 0.0000 Constraint 142 168 0.8000 1.0000 1.5000 0.0000 Constraint 142 148 0.8000 1.0000 1.5000 0.0000 Constraint 134 182 0.8000 1.0000 1.5000 0.0000 Constraint 134 173 0.8000 1.0000 1.5000 0.0000 Constraint 134 168 0.8000 1.0000 1.5000 0.0000 Constraint 134 148 0.8000 1.0000 1.5000 0.0000 Constraint 134 142 0.8000 1.0000 1.5000 0.0000 Constraint 122 168 0.8000 1.0000 1.5000 0.0000 Constraint 122 148 0.8000 1.0000 1.5000 0.0000 Constraint 122 142 0.8000 1.0000 1.5000 0.0000 Constraint 122 134 0.8000 1.0000 1.5000 0.0000 Constraint 114 692 0.8000 1.0000 1.5000 0.0000 Constraint 114 683 0.8000 1.0000 1.5000 0.0000 Constraint 114 671 0.8000 1.0000 1.5000 0.0000 Constraint 114 148 0.8000 1.0000 1.5000 0.0000 Constraint 114 142 0.8000 1.0000 1.5000 0.0000 Constraint 114 134 0.8000 1.0000 1.5000 0.0000 Constraint 114 122 0.8000 1.0000 1.5000 0.0000 Constraint 106 692 0.8000 1.0000 1.5000 0.0000 Constraint 106 671 0.8000 1.0000 1.5000 0.0000 Constraint 106 642 0.8000 1.0000 1.5000 0.0000 Constraint 106 148 0.8000 1.0000 1.5000 0.0000 Constraint 106 142 0.8000 1.0000 1.5000 0.0000 Constraint 106 134 0.8000 1.0000 1.5000 0.0000 Constraint 106 122 0.8000 1.0000 1.5000 0.0000 Constraint 106 114 0.8000 1.0000 1.5000 0.0000 Constraint 97 692 0.8000 1.0000 1.5000 0.0000 Constraint 97 683 0.8000 1.0000 1.5000 0.0000 Constraint 97 671 0.8000 1.0000 1.5000 0.0000 Constraint 97 443 0.8000 1.0000 1.5000 0.0000 Constraint 97 148 0.8000 1.0000 1.5000 0.0000 Constraint 97 142 0.8000 1.0000 1.5000 0.0000 Constraint 97 134 0.8000 1.0000 1.5000 0.0000 Constraint 97 122 0.8000 1.0000 1.5000 0.0000 Constraint 97 114 0.8000 1.0000 1.5000 0.0000 Constraint 97 106 0.8000 1.0000 1.5000 0.0000 Constraint 92 692 0.8000 1.0000 1.5000 0.0000 Constraint 92 683 0.8000 1.0000 1.5000 0.0000 Constraint 92 671 0.8000 1.0000 1.5000 0.0000 Constraint 92 148 0.8000 1.0000 1.5000 0.0000 Constraint 92 142 0.8000 1.0000 1.5000 0.0000 Constraint 92 134 0.8000 1.0000 1.5000 0.0000 Constraint 92 122 0.8000 1.0000 1.5000 0.0000 Constraint 92 114 0.8000 1.0000 1.5000 0.0000 Constraint 92 106 0.8000 1.0000 1.5000 0.0000 Constraint 92 97 0.8000 1.0000 1.5000 0.0000 Constraint 84 692 0.8000 1.0000 1.5000 0.0000 Constraint 84 683 0.8000 1.0000 1.5000 0.0000 Constraint 84 671 0.8000 1.0000 1.5000 0.0000 Constraint 84 659 0.8000 1.0000 1.5000 0.0000 Constraint 84 650 0.8000 1.0000 1.5000 0.0000 Constraint 84 642 0.8000 1.0000 1.5000 0.0000 Constraint 84 142 0.8000 1.0000 1.5000 0.0000 Constraint 84 134 0.8000 1.0000 1.5000 0.0000 Constraint 84 122 0.8000 1.0000 1.5000 0.0000 Constraint 84 114 0.8000 1.0000 1.5000 0.0000 Constraint 84 106 0.8000 1.0000 1.5000 0.0000 Constraint 84 97 0.8000 1.0000 1.5000 0.0000 Constraint 84 92 0.8000 1.0000 1.5000 0.0000 Constraint 75 692 0.8000 1.0000 1.5000 0.0000 Constraint 75 683 0.8000 1.0000 1.5000 0.0000 Constraint 75 659 0.8000 1.0000 1.5000 0.0000 Constraint 75 134 0.8000 1.0000 1.5000 0.0000 Constraint 75 122 0.8000 1.0000 1.5000 0.0000 Constraint 75 114 0.8000 1.0000 1.5000 0.0000 Constraint 75 106 0.8000 1.0000 1.5000 0.0000 Constraint 75 97 0.8000 1.0000 1.5000 0.0000 Constraint 75 92 0.8000 1.0000 1.5000 0.0000 Constraint 75 84 0.8000 1.0000 1.5000 0.0000 Constraint 66 173 0.8000 1.0000 1.5000 0.0000 Constraint 66 168 0.8000 1.0000 1.5000 0.0000 Constraint 66 122 0.8000 1.0000 1.5000 0.0000 Constraint 66 114 0.8000 1.0000 1.5000 0.0000 Constraint 66 106 0.8000 1.0000 1.5000 0.0000 Constraint 66 97 0.8000 1.0000 1.5000 0.0000 Constraint 66 92 0.8000 1.0000 1.5000 0.0000 Constraint 66 84 0.8000 1.0000 1.5000 0.0000 Constraint 66 75 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 114 0.8000 1.0000 1.5000 0.0000 Constraint 58 106 0.8000 1.0000 1.5000 0.0000 Constraint 58 97 0.8000 1.0000 1.5000 0.0000 Constraint 58 92 0.8000 1.0000 1.5000 0.0000 Constraint 58 84 0.8000 1.0000 1.5000 0.0000 Constraint 58 75 0.8000 1.0000 1.5000 0.0000 Constraint 58 66 0.8000 1.0000 1.5000 0.0000 Constraint 51 182 0.8000 1.0000 1.5000 0.0000 Constraint 51 114 0.8000 1.0000 1.5000 0.0000 Constraint 51 106 0.8000 1.0000 1.5000 0.0000 Constraint 51 97 0.8000 1.0000 1.5000 0.0000 Constraint 51 92 0.8000 1.0000 1.5000 0.0000 Constraint 51 84 0.8000 1.0000 1.5000 0.0000 Constraint 51 75 0.8000 1.0000 1.5000 0.0000 Constraint 51 66 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 44 106 0.8000 1.0000 1.5000 0.0000 Constraint 44 97 0.8000 1.0000 1.5000 0.0000 Constraint 44 92 0.8000 1.0000 1.5000 0.0000 Constraint 44 84 0.8000 1.0000 1.5000 0.0000 Constraint 44 75 0.8000 1.0000 1.5000 0.0000 Constraint 44 66 0.8000 1.0000 1.5000 0.0000 Constraint 44 58 0.8000 1.0000 1.5000 0.0000 Constraint 44 51 0.8000 1.0000 1.5000 0.0000 Constraint 35 97 0.8000 1.0000 1.5000 0.0000 Constraint 35 92 0.8000 1.0000 1.5000 0.0000 Constraint 35 84 0.8000 1.0000 1.5000 0.0000 Constraint 35 75 0.8000 1.0000 1.5000 0.0000 Constraint 35 66 0.8000 1.0000 1.5000 0.0000 Constraint 35 58 0.8000 1.0000 1.5000 0.0000 Constraint 35 51 0.8000 1.0000 1.5000 0.0000 Constraint 35 44 0.8000 1.0000 1.5000 0.0000 Constraint 24 481 0.8000 1.0000 1.5000 0.0000 Constraint 24 283 0.8000 1.0000 1.5000 0.0000 Constraint 24 106 0.8000 1.0000 1.5000 0.0000 Constraint 24 97 0.8000 1.0000 1.5000 0.0000 Constraint 24 84 0.8000 1.0000 1.5000 0.0000 Constraint 24 75 0.8000 1.0000 1.5000 0.0000 Constraint 24 66 0.8000 1.0000 1.5000 0.0000 Constraint 24 58 0.8000 1.0000 1.5000 0.0000 Constraint 24 51 0.8000 1.0000 1.5000 0.0000 Constraint 24 44 0.8000 1.0000 1.5000 0.0000 Constraint 24 35 0.8000 1.0000 1.5000 0.0000 Constraint 17 543 0.8000 1.0000 1.5000 0.0000 Constraint 17 534 0.8000 1.0000 1.5000 0.0000 Constraint 17 509 0.8000 1.0000 1.5000 0.0000 Constraint 17 481 0.8000 1.0000 1.5000 0.0000 Constraint 17 465 0.8000 1.0000 1.5000 0.0000 Constraint 17 283 0.8000 1.0000 1.5000 0.0000 Constraint 17 275 0.8000 1.0000 1.5000 0.0000 Constraint 17 264 0.8000 1.0000 1.5000 0.0000 Constraint 17 114 0.8000 1.0000 1.5000 0.0000 Constraint 17 106 0.8000 1.0000 1.5000 0.0000 Constraint 17 97 0.8000 1.0000 1.5000 0.0000 Constraint 17 92 0.8000 1.0000 1.5000 0.0000 Constraint 17 84 0.8000 1.0000 1.5000 0.0000 Constraint 17 75 0.8000 1.0000 1.5000 0.0000 Constraint 17 66 0.8000 1.0000 1.5000 0.0000 Constraint 17 58 0.8000 1.0000 1.5000 0.0000 Constraint 17 51 0.8000 1.0000 1.5000 0.0000 Constraint 17 44 0.8000 1.0000 1.5000 0.0000 Constraint 17 35 0.8000 1.0000 1.5000 0.0000 Constraint 17 24 0.8000 1.0000 1.5000 0.0000 Constraint 9 572 0.8000 1.0000 1.5000 0.0000 Constraint 9 559 0.8000 1.0000 1.5000 0.0000 Constraint 9 543 0.8000 1.0000 1.5000 0.0000 Constraint 9 534 0.8000 1.0000 1.5000 0.0000 Constraint 9 509 0.8000 1.0000 1.5000 0.0000 Constraint 9 481 0.8000 1.0000 1.5000 0.0000 Constraint 9 283 0.8000 1.0000 1.5000 0.0000 Constraint 9 275 0.8000 1.0000 1.5000 0.0000 Constraint 9 114 0.8000 1.0000 1.5000 0.0000 Constraint 9 106 0.8000 1.0000 1.5000 0.0000 Constraint 9 97 0.8000 1.0000 1.5000 0.0000 Constraint 9 92 0.8000 1.0000 1.5000 0.0000 Constraint 9 84 0.8000 1.0000 1.5000 0.0000 Constraint 9 75 0.8000 1.0000 1.5000 0.0000 Constraint 9 66 0.8000 1.0000 1.5000 0.0000 Constraint 9 58 0.8000 1.0000 1.5000 0.0000 Constraint 9 51 0.8000 1.0000 1.5000 0.0000 Constraint 9 44 0.8000 1.0000 1.5000 0.0000 Constraint 9 35 0.8000 1.0000 1.5000 0.0000 Constraint 9 24 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 572 0.8000 1.0000 1.5000 0.0000 Constraint 3 559 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 543 0.8000 1.0000 1.5000 0.0000 Constraint 3 534 0.8000 1.0000 1.5000 0.0000 Constraint 3 526 0.8000 1.0000 1.5000 0.0000 Constraint 3 518 0.8000 1.0000 1.5000 0.0000 Constraint 3 509 0.8000 1.0000 1.5000 0.0000 Constraint 3 504 0.8000 1.0000 1.5000 0.0000 Constraint 3 488 0.8000 1.0000 1.5000 0.0000 Constraint 3 481 0.8000 1.0000 1.5000 0.0000 Constraint 3 472 0.8000 1.0000 1.5000 0.0000 Constraint 3 465 0.8000 1.0000 1.5000 0.0000 Constraint 3 291 0.8000 1.0000 1.5000 0.0000 Constraint 3 283 0.8000 1.0000 1.5000 0.0000 Constraint 3 275 0.8000 1.0000 1.5000 0.0000 Constraint 3 264 0.8000 1.0000 1.5000 0.0000 Constraint 3 142 0.8000 1.0000 1.5000 0.0000 Constraint 3 114 0.8000 1.0000 1.5000 0.0000 Constraint 3 106 0.8000 1.0000 1.5000 0.0000 Constraint 3 97 0.8000 1.0000 1.5000 0.0000 Constraint 3 92 0.8000 1.0000 1.5000 0.0000 Constraint 3 84 0.8000 1.0000 1.5000 0.0000 Constraint 3 75 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 44 0.8000 1.0000 1.5000 0.0000 Constraint 3 35 0.8000 1.0000 1.5000 0.0000 Constraint 3 24 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: