# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0379/ # command:# Making conformation for sequence T0379 numbered 1 through 208 Created new target T0379 from T0379.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0379/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0379//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0379/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0379//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0379/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0379/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0379/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j97A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1j97A expands to /projects/compbio/data/pdb/1j97.pdb.gz 1j97A:Bad short name: BE for alphabet: pdb_atoms Bad short name: F1 for alphabet: pdb_atoms Bad short name: F2 for alphabet: pdb_atoms Bad short name: F3 for alphabet: pdb_atoms # T0379 read from 1j97A/merged-good-all-a2m # 1j97A read from 1j97A/merged-good-all-a2m # adding 1j97A to template set # found chain 1j97A in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1j97A)F12 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1j97A)F12 T0379 2 :IRNIV 1j97A 5 :KKLIL # choosing archetypes in rotamer library T0379 10 :GGVLIHLNR 1j97A 13 :DSTLVNNET T0379 24 :RFKAIGVADIEEMLDPYLQKG 1j97A 22 :IDEIAREAGVEEEVKKITKEA T0379 45 :LFLDLESGRKSEEEFRTELSRY 1j97A 46 :KLNFEQSLRKRVSLLKDLPIEK T0379 77 :YDALLGFL 1j97A 68 :VEKAIKRI T0379 86 :EISAEKFDYIDSLRP 1j97A 76 :TPTEGAEETIKELKN T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1j97A 92 :GYVVAVVSGGFDIAVNKIKEKLG T0379 134 :FDKVYAS 1j97A 115 :LDYAFAN T0379 141 :CQMGKY 1j97A 136 :GEVLKE T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1j97A 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPDN 1j97A 180 :LKIAFCA Number of specific fragments extracted= 11 number of extra gaps= 0 total=11 Number of alignments=1 # 1j97A read from 1j97A/merged-good-all-a2m # found chain 1j97A in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1j97A)F12 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1j97A)F12 T0379 2 :IRNIV 1j97A 5 :KKLIL T0379 10 :GGVLIHLN 1j97A 13 :DSTLVNNE T0379 20 :ESIRRFKAIGV 1j97A 21 :TIDEIAREAGV T0379 31 :ADIE 1j97A 33 :EEVK T0379 44 :GLFLDLESGRKSEEEFRTELSRYIG 1j97A 37 :KITKEAMEGKLNFEQSLRKRVSLLK T0379 70 :ELTYQQVYDALLG 1j97A 62 :DLPIEKVEKAIKR T0379 85 :EEISAEKFDYIDSLR 1j97A 75 :ITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1j97A 91 :RGYVVAVVSGGFDIAVNKIKEKLG T0379 130 :LDSFFDKVYASCQ 1j97A 115 :LDYAFANRLIVKD T0379 145 :KYK 1j97A 142 :NAK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1j97A 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCP 1j97A 180 :LKIAF T0379 192 :NGE 1j97A 185 :CAK T0379 202 :RLLRE 1j97A 188 :PILKE Number of specific fragments extracted= 14 number of extra gaps= 0 total=25 Number of alignments=2 # 1j97A read from 1j97A/merged-good-all-a2m # found chain 1j97A in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1j97A)F12 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1j97A)F12 T0379 1 :MIRNIV 1j97A 4 :KKKLIL T0379 10 :GGVLIHLNRE 1j97A 13 :DSTLVNNETI T0379 25 :FKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRT 1j97A 23 :DEIAREAGVEEEVKKITKEAMEGKLNFEQSLRKRVSL T0379 63 :L 1j97A 60 :L T0379 67 :IGKELTYQQVYD 1j97A 62 :DLPIEKVEKAIK T0379 84 :LEEISAEKFDYIDSLR 1j97A 74 :RITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1j97A 91 :RGYVVAVVSGGFDIAVNKIKE T0379 127 :GRTL 1j97A 112 :KLGL T0379 135 :DKVYA 1j97A 116 :DYAFA T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1j97A 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPD 1j97A 180 :LKIAFC T0379 196 :WIPAITR 1j97A 186 :AKPILKE Number of specific fragments extracted= 12 number of extra gaps= 0 total=37 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c4nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2c4nA expands to /projects/compbio/data/pdb/2c4n.pdb.gz 2c4nA:# T0379 read from 2c4nA/merged-good-all-a2m # 2c4nA read from 2c4nA/merged-good-all-a2m # adding 2c4nA to template set # found chain 2c4nA in template set Warning: unaligning (T0379)I14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c4nA)H16 Warning: unaligning (T0379)H15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c4nA)H16 T0379 1 :M 2c4nA 1 :M T0379 2 :IRNIVFDLGGVL 2c4nA 3 :IKNVICDIDGVL T0379 16 :LNREESIRRFKAIGV 2c4nA 20 :AVPGAAEFLHGIMDK T0379 32 :DIE 2c4nA 35 :GLP T0379 44 :GLFLDLE 2c4nA 44 :YPSQTGQ T0379 54 :KSEEEF 2c4nA 51 :DLANRF T0379 83 :FLEEISAEKFDYIDS 2c4nA 118 :ETRSYNWDMMHKAAY T0379 98 :LRPDYRL 2c4nA 134 :VANGARF T0379 106 :LLSNTNP 2c4nA 141 :IATNPDT T0379 122 :RFLPSGRTLDSFFDKVYASCQMG 2c4nA 148 :HGRGFYPACGALCAGIEKISGRK T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGP 2c4nA 174 :VGKPSPWIIRAALNKMQAHSEETVIVGDNL T0379 175 :ANVATAERLGFHTYCPDNGENWIPAITR 2c4nA 205 :TDILAGFQAGLETILVLSGVSSLDDIDS Number of specific fragments extracted= 12 number of extra gaps= 1 total=49 Number of alignments=4 # 2c4nA read from 2c4nA/merged-good-all-a2m # found chain 2c4nA in template set Warning: unaligning (T0379)I14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c4nA)H16 Warning: unaligning (T0379)H15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c4nA)H16 T0379 1 :M 2c4nA 1 :M T0379 2 :IRNIVFDLGGVL 2c4nA 3 :IKNVICDIDGVL T0379 16 :LN 2c4nA 17 :DN T0379 18 :REESIRRFKAIGVADIEEMLDP 2c4nA 24 :AAEFLHGIMDKGLPLVLLTNYP T0379 70 :ELTYQQVYDALLGFL 2c4nA 46 :SQTGQDLANRFATAG T0379 85 :EEISAEKFDYIDSLR 2c4nA 120 :RSYNWDMMHKAAYFV T0379 100 :PDYR 2c4nA 136 :NGAR T0379 105 :FLLSNTNP 2c4nA 140 :FIATNPDT T0379 122 :RFLPSGRTLDSFFDKVYASCQMG 2c4nA 148 :HGRGFYPACGALCAGIEKISGRK T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGPA 2c4nA 174 :VGKPSPWIIRAALNKMQAHSEETVIVGDNLR T0379 176 :NVATAERLGFHTYCPDNGENWIPAI 2c4nA 206 :DILAGFQAGLETILVLSGVSSLDDI T0379 202 :RLLRE 2c4nA 242 :PSVAE Number of specific fragments extracted= 12 number of extra gaps= 1 total=61 Number of alignments=5 # 2c4nA read from 2c4nA/merged-good-all-a2m # found chain 2c4nA in template set Warning: unaligning (T0379)I14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c4nA)H16 Warning: unaligning (T0379)H15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c4nA)H16 T0379 1 :MIRNIVFDLGGVL 2c4nA 2 :TIKNVICDIDGVL T0379 84 :LEEISAEKFDYIDSLR 2c4nA 17 :DNVAVPGAAEFLHGIM T0379 100 :PDYRLFLLSN 2c4nA 34 :KGLPLVLLTN T0379 110 :TNPYVLDLAMS 2c4nA 47 :QTGQDLANRFA T0379 127 :GRTL 2c4nA 58 :TAGV T0379 131 :DSF 2c4nA 65 :DSV T0379 137 :VYASCQM 2c4nA 68 :FYTSAMA T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGP 2c4nA 174 :VGKPSPWIIRAALNKMQAHSEETVIVGDNL T0379 175 :ANVATAERLGFHTYCPDNGENWIPAI 2c4nA 205 :TDILAGFQAGLETILVLSGVSSLDDI Number of specific fragments extracted= 9 number of extra gaps= 1 total=70 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gfhA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gfhA expands to /projects/compbio/data/pdb/2gfh.pdb.gz 2gfhA:Skipped atom 62, because occupancy 0.5 <= existing 0.500 in 2gfhA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 70, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 72, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 74, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 76, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 78, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 789, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 793, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 795, because occupancy 0.500 <= existing 0.500 in 2gfhA # T0379 read from 2gfhA/merged-good-all-a2m # 2gfhA read from 2gfhA/merged-good-all-a2m # adding 2gfhA to template set # found chain 2gfhA in template set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfhA)D12 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfhA)D12 Warning: unaligning (T0379)E50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfhA)C67 T0379 2 :IRNIV 2gfhA 6 :VRAVF T0379 9 :LGGVLIHLNREESIRRFKAIGVA 2gfhA 13 :LDNTLIDTAGASRRGMLEVIKLL T0379 32 :DIEEMLDPYLQKGLF 2gfhA 40 :HYKEEAEIICDKVQV T0379 51 :SGRKSEEEFRTELSRYI 2gfhA 68 :ITDVRTSHWEEAIQETK T0379 68 :GKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRF 2gfhA 91 :KLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACA T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGP 2gfhA 147 :CQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTL T0379 175 :ANVATAERLGF 2gfhA 193 :TDIQGGLNAGL T0379 186 :HTYCPDNGENWIP 2gfhA 205 :ATVWINKSGRVPL T0379 199 :AITRLLRE 2gfhA 232 :ELPALLQS Number of specific fragments extracted= 9 number of extra gaps= 1 total=79 Number of alignments=7 # 2gfhA read from 2gfhA/merged-good-all-a2m # found chain 2gfhA in template set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfhA)D12 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfhA)D12 Warning: unaligning (T0379)K54 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfhA)C67 T0379 2 :IRNIV 2gfhA 6 :VRAVF T0379 9 :LGGVLIHLN 2gfhA 13 :LDNTLIDTA T0379 18 :REESIRRFKAI 2gfhA 28 :MLEVIKLLQSK T0379 29 :GVA 2gfhA 40 :HYK T0379 44 :GLF 2gfhA 43 :EEA T0379 55 :SEEEFRTELSRYIG 2gfhA 68 :ITDVRTSHWEEAIQ T0379 69 :KELTYQ 2gfhA 86 :GADNRK T0379 75 :QVYDALLGFL 2gfhA 95 :ECYFLWKSTR T0379 85 :EEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRF 2gfhA 108 :MILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACA T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPA 2gfhA 147 :CQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLE T0379 176 :NVATAERLGF 2gfhA 194 :DIQGGLNAGL T0379 186 :HTYCPDNGENWIPAI 2gfhA 205 :ATVWINKSGRVPLTS Number of specific fragments extracted= 12 number of extra gaps= 1 total=91 Number of alignments=8 # 2gfhA read from 2gfhA/merged-good-all-a2m # found chain 2gfhA in template set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfhA)D12 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfhA)D12 Warning: unaligning (T0379)E50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfhA)C67 T0379 1 :MIRNIV 2gfhA 5 :RVRAVF T0379 9 :LGGVLIHLNREESIRRFKAIG 2gfhA 13 :LDNTLIDTAGASRRGMLEVIK T0379 30 :VADIEEMLDPYLQKGLFLDL 2gfhA 38 :KYHYKEEAEIICDKVQVKLS T0379 51 :SGRKSEEEFRTELSRY 2gfhA 68 :ITDVRTSHWEEAIQET T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMS 2gfhA 90 :RKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIE T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGP 2gfhA 144 :ACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTL T0379 175 :ANVATAERLGFHTYCPDNGEN 2gfhA 193 :TDIQGGLNAGLKATVWINKSG Number of specific fragments extracted= 7 number of extra gaps= 1 total=98 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wr8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1wr8A/merged-good-all-a2m # 1wr8A read from 1wr8A/merged-good-all-a2m # found chain 1wr8A in training set T0379 2 :IRNIVFDLGGVLI 1wr8A 3 :IKAISIDIDGTIT T0379 16 :LNREESIRRFKAI 1wr8A 21 :IHEKALEAIRRAE T0379 30 :VADIE 1wr8A 34 :SLGIP T0379 45 :LFLDLESGRKSEEEF 1wr8A 43 :TGNTVQFAEAASILI T0379 61 :TEL 1wr8A 84 :DEE T0379 71 :LTYQQVYDALLGFL 1wr8A 87 :WILWNEIRKRFPNA T0379 86 :EISAEK 1wr8A 101 :RTSYTM T0379 110 :TNPYVLDLAMSPRF 1wr8A 120 :INVETVREIINELN T0379 130 :LD 1wr8A 134 :LN T0379 134 :FDKVYASCQMGKYK 1wr8A 141 :SGFAIHVKKPWINK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1wr8A 155 :GSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVG T0379 186 :HTYCPDNGENWIP 1wr8A 190 :YKVAVAQAPKILK T0379 199 :AITRLLRE 1wr8A 220 :AIYHILEK Number of specific fragments extracted= 13 number of extra gaps= 0 total=111 Number of alignments=10 # 1wr8A read from 1wr8A/merged-good-all-a2m # found chain 1wr8A in training set T0379 2 :IRNIVFDLGGVLIHLN 1wr8A 3 :IKAISIDIDGTITYPN T0379 85 :EEISAEKFDYIDSLR 1wr8A 19 :RMIHEKALEAIRRAE T0379 100 :PDYRLFLLSN 1wr8A 35 :LGIPIMLVTG T0379 110 :TNPYVLDLAMSPRF 1wr8A 120 :INVETVREIINELN T0379 130 :LD 1wr8A 134 :LN T0379 134 :FDKVYASCQMGKYK 1wr8A 141 :SGFAIHVKKPWINK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1wr8A 155 :GSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVG T0379 186 :HTYCPDNGENWIPAI 1wr8A 190 :YKVAVAQAPKILKEN T0379 201 :TRLLRE 1wr8A 221 :IYHILE Number of specific fragments extracted= 9 number of extra gaps= 0 total=120 Number of alignments=11 # 1wr8A read from 1wr8A/merged-good-all-a2m # found chain 1wr8A in training set T0379 1 :MIRNIVFDLGGVLI 1wr8A 2 :KIKAISIDIDGTIT T0379 82 :GFLEEISAEKFDYIDSLR 1wr8A 16 :YPNRMIHEKALEAIRRAE T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1wr8A 35 :LGIPIMLVTGNTVQFAEAASI T0379 127 :GRTL 1wr8A 56 :LIGT T0379 135 :DKVYASCQMG 1wr8A 60 :SGPVVAEDGG T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTY 1wr8A 155 :GSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVA T0379 193 :GENWIPAITR 1wr8A 194 :VAQAPKILKE Number of specific fragments extracted= 7 number of extra gaps= 0 total=127 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qyiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qyiA expands to /projects/compbio/data/pdb/1qyi.pdb.gz 1qyiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0379 read from 1qyiA/merged-good-all-a2m # 1qyiA read from 1qyiA/merged-good-all-a2m # adding 1qyiA to template set # found chain 1qyiA in template set T0379 1 :M 1qyiA 1 :M T0379 3 :RNIVFDLGGVLI 1qyiA 2 :KKILFDVDGVFL T0379 16 :LNREESIRRFKAIGVA 1qyiA 14 :SEERCFDVSALTVYEL T0379 32 :DIE 1qyiA 37 :GLH T0379 35 :EMLD 1qyiA 42 :IDWE T0379 46 :FLDLESGRKSEEEF 1qyiA 46 :TLTDNDIQDIRNRI T0379 60 :RTELSRYIGKELTYQQVYDALLGFL 1qyiA 174 :WTLAQEVYQEWYLGSKLYEDVEKKI T0379 85 :EE 1qyiA 201 :TT T0379 87 :ISAEKFDYIDSLRP 1qyiA 216 :PVDEVKVLLNDLKG T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1qyiA 231 :GFELGIATGRPYTETVVPFENLG T0379 130 :LDSFF 1qyiA 254 :LLPYF T0379 135 :DKVYASCQM 1qyiA 261 :DFIATASDV T0379 144 :GK 1qyiA 277 :PQ T0379 146 :YKPNEDIFLEMIA 1qyiA 283 :GKPNPFSYIAALY T0379 161 :G 1qyiA 296 :G T0379 162 :MKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLREQ 1qyiA 313 :VNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHH Number of specific fragments extracted= 16 number of extra gaps= 0 total=143 Number of alignments=13 # 1qyiA read from 1qyiA/merged-good-all-a2m # found chain 1qyiA in template set T0379 1 :M 1qyiA 1 :M T0379 3 :RNIVFDLGGVLIHLN 1qyiA 2 :KKILFDVDGVFLSEE T0379 18 :REESIRRFKAIGVADIEEML 1qyiA 62 :KDKILNKLKSLGLNSNWDML T0379 47 :LDLESGRKSEEEFRTELSR 1qyiA 89 :LIDILKKLSHDEIEAFMYQ T0379 66 :YIG 1qyiA 136 :FLD T0379 69 :KELTYQQVYDALLGFL 1qyiA 140 :VKVGKNNIYAALEEFA T0379 85 :EEISAEKFDYIDSLR 1qyiA 214 :LRPVDEVKVLLNDLK T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1qyiA 230 :AGFELGIATGRPYTETVVPFENLG T0379 130 :LDSFF 1qyiA 254 :LLPYF T0379 135 :DKVYA 1qyiA 261 :DFIAT T0379 150 :EDIFLEMIADS 1qyiA 266 :ASDVLEAENMY T0379 162 :MKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1qyiA 313 :VNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAA T0379 202 :RLLREQ 1qyiA 352 :GELEAH Number of specific fragments extracted= 13 number of extra gaps= 0 total=156 Number of alignments=14 # 1qyiA read from 1qyiA/merged-good-all-a2m # found chain 1qyiA in template set T0379 3 :RNIVFDLGGVLIHLNREESIRRFKAIGVAD 1qyiA 2 :KKILFDVDGVFLSEERCFDVSALTVYELLM T0379 33 :IEEMLDPYLQKGLFLDLESGRKSEEEFRTELSRY 1qyiA 44 :WETLTDNDIQDIRNRIFQKDKILNKLKSLGLNSN T0379 67 :IGKELTYQQVYDALLGFLEEIS 1qyiA 181 :YQEWYLGSKLYEDVEKKIARTT T0379 89 :AEKFDYIDSLR 1qyiA 218 :DEVKVLLNDLK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1qyiA 230 :AGFELGIATGRPYTETVVPFE T0379 127 :GRTLDSFF 1qyiA 251 :NLGLLPYF T0379 135 :DKVYASCQMG 1qyiA 261 :DFIATASDVL T0379 145 :KYKPNEDIFLEMIA 1qyiA 282 :LGKPNPFSYIAALY T0379 162 :MKPEETLFIDDGPANVATAERLGFHTYCPDN 1qyiA 313 :VNKDDVFIVGDSLADLLSAQKIGATFIGTLT T0379 193 :GENWIPAITRL 1qyiA 347 :GKDAAGELEAH Number of specific fragments extracted= 10 number of extra gaps= 0 total=166 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rqlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rqlA expands to /projects/compbio/data/pdb/1rql.pdb.gz 1rqlA:# T0379 read from 1rqlA/merged-good-all-a2m # 1rqlA read from 1rqlA/merged-good-all-a2m # adding 1rqlA to template set # found chain 1rqlA in template set T0379 2 :IRNIVFDLGGVLIHL 1rqlA 6 :IEAVIFDWAGTTVDY T0379 17 :NREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSE 1rqlA 22 :CFAPLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALT T0379 57 :EEF 1rqlA 64 :PRI T0379 60 :RTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRP 1rqlA 77 :LPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRE T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1rqlA 119 :GIKIGSTTGYTREMMDIVAKEAA T0379 130 :LDSF 1rqlA 142 :LQGY T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1rqlA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 163 :KPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1rqlA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELG Number of specific fragments extracted= 8 number of extra gaps= 0 total=174 Number of alignments=16 # 1rqlA read from 1rqlA/merged-good-all-a2m # found chain 1rqlA in template set T0379 2 :IRNIVFDLGGVLIHLN 1rqlA 6 :IEAVIFDWAGTTVDYG T0379 18 :REESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEE 1rqlA 26 :LEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALTEMPR T0379 59 :FRTELSRYIGKELT 1rqlA 66 :IASEWNRVFRQLPT T0379 73 :YQQVYDALLGFL 1rqlA 83 :IQEMYEEFEEIL T0379 85 :EEISAEKFDYIDSLR 1rqlA 102 :ASPINAVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1rqlA 118 :RGIKIGSTTGYTREMMDIVAKEAA T0379 130 :LDSF 1rqlA 142 :LQGY T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1rqlA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 163 :KPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1rqlA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGLT Number of specific fragments extracted= 9 number of extra gaps= 0 total=183 Number of alignments=17 # 1rqlA read from 1rqlA/merged-good-all-a2m # found chain 1rqlA in template set T0379 1 :MIRNIVFDLGGVLIHLN 1rqlA 5 :KIEAVIFDWAGTTVDYG T0379 18 :REESIRRFKAIGVADIEEMLDPYLQ 1rqlA 23 :FAPLEVFMEIFHKRGVAITAEEARK T0379 43 :KGLFLDLESGRKSEEEFRTELSRY 1rqlA 54 :IDHVRALTEMPRIASEWNRVFRQL T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 1rqlA 84 :QEMYEEFEEILFAILPRYASPINAVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1rqlA 118 :RGIKIGSTTGYTREMMDIVAK T0379 127 :GRTLDSFF 1rqlA 139 :EAALQGYK T0379 135 :DKVYASCQMGKYKPNEDIFLEMIADSGMKP 1rqlA 148 :DFLVTPDDVPAGRPYPWMCYKNAMELGVYP T0379 165 :EETLFIDDGPANVATAERLGFHTYCPDNG 1rqlA 179 :NHMIKVGDTVSDMKEGRNAGMWTVGVILG T0379 196 :WIPAITRLLRE 1rqlA 214 :TEEEVENMDSV Number of specific fragments extracted= 9 number of extra gaps= 0 total=192 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ek1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ek1A expands to /projects/compbio/data/pdb/1ek1.pdb.gz 1ek1A:# T0379 read from 1ek1A/merged-good-all-a2m # 1ek1A read from 1ek1A/merged-good-all-a2m # adding 1ek1A to template set # found chain 1ek1A in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1ek1A)R4 Warning: unaligning (T0379)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)G48 Warning: unaligning (T0379)K54 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ek1A)Q90 Warning: unaligning (T0379)F83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)Q90 T0379 4 :NIVFDLGGVLI 1ek1A 5 :VAAFDLDGVLA T0379 39 :PYLQKG 1ek1A 49 :PTEQLM T0379 45 :LFLDLESGR 1ek1A 57 :KITFSQWVP T0379 84 :L 1ek1A 91 :I T0379 85 :E 1ek1A 93 :S T0379 87 :ISAEKFDYIDSLRP 1ek1A 101 :INRPMLQAAIALKK T0379 101 :DYRLFLLSNTN 1ek1A 116 :GFTTCIVTNNW T0379 112 :PYVLDLAMSP 1ek1A 133 :RDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENW 1ek1A 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASA Number of specific fragments extracted= 9 number of extra gaps= 0 total=201 Number of alignments=19 # 1ek1A read from 1ek1A/merged-good-all-a2m # found chain 1ek1A in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1ek1A)R4 Warning: unaligning (T0379)G44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)G48 Warning: unaligning (T0379)S55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ek1A)Q90 T0379 4 :NIVFDLGGVLIHLN 1ek1A 5 :VAAFDLDGVLALPS T0379 45 :LFLDLESGRK 1ek1A 49 :PTEQLMKGKI T0379 85 :EEISAEKFDYIDSLR 1ek1A 99 :RSINRPMLQAAIALK T0379 100 :PDYRLFLLSN 1ek1A 115 :KGFTTCIVTN T0379 110 :TNPYVLDLAMSP 1ek1A 131 :DKRDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1ek1A 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASALREL Number of specific fragments extracted= 6 number of extra gaps= 0 total=207 Number of alignments=20 # 1ek1A read from 1ek1A/merged-good-all-a2m # found chain 1ek1A in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1ek1A)R4 Warning: unaligning (T0379)R18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ek1A)G48 Warning: unaligning (T0379)L47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)G48 Warning: unaligning (T0379)R65 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ek1A)Q90 T0379 4 :NIVFDLGGVLIHLN 1ek1A 5 :VAAFDLDGVLALPS T0379 48 :DLESGRKSEEEFRTELS 1ek1A 49 :PTEQLMKGKITFSQWVP T0379 81 :LGFLEEISAEKFDYIDSLR 1ek1A 95 :AMAARSINRPMLQAAIALK T0379 100 :PDYRLFLLSNTN 1ek1A 115 :KGFTTCIVTNNW T0379 112 :PYVLDLAMS 1ek1A 133 :RDSLAQMMC T0379 129 :TLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1ek1A 142 :ELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNT T0379 194 :ENWIPAITRL 1ek1A 208 :SALRELEKVT Number of specific fragments extracted= 7 number of extra gaps= 0 total=214 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nnlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1nnlA/merged-good-all-a2m # 1nnlA read from 1nnlA/merged-good-all-a2m # found chain 1nnlA in training set Warning: unaligning (T0379)L37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1nnlA)P57 Warning: unaligning (T0379)E50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1nnlA)P57 T0379 2 :IRNIVFDLGGVLIHLNR 1nnlA 14 :ADAVCFDVDSTVIREEG T0379 24 :RFKAIGVADIEEM 1nnlA 31 :IDELAKICGVEDA T0379 51 :SGRKSEEEF 1nnlA 58 :FKAALTERL T0379 68 :GKELTYQQVYDALLGFL 1nnlA 67 :ALIQPSREQVQRLIAEQ T0379 85 :EEISAEKFDYIDSLRP 1nnlA 85 :PHLTPGIRELVSRLQE T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1nnlA 102 :NVQVFLISGGFRSIVEHVASKLN T0379 130 :LDSFF 1nnlA 125 :IPATN T0379 137 :VYAS 1nnlA 130 :VFAN T0379 141 :CQMGKY 1nnlA 136 :KFYFNG T0379 150 :EDIFLEMIADS 1nnlA 155 :SGGKGKVIKLL T0379 163 :KPEETLFIDDGPANVA 1nnlA 170 :HFKKIIMIGDGATDME T0379 184 :GF 1nnlA 189 :PA T0379 186 :HTYCPDNGENWIP 1nnlA 192 :AFIGFGGNVIRQQ Number of specific fragments extracted= 13 number of extra gaps= 0 total=227 Number of alignments=22 # 1nnlA read from 1nnlA/merged-good-all-a2m # found chain 1nnlA in training set Warning: unaligning (T0379)E34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1nnlA)P57 Warning: unaligning (T0379)S55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1nnlA)P57 T0379 2 :IRNIVFDLGGVLIHLN 1nnlA 14 :ADAVCFDVDSTVIREE T0379 21 :SIRRFKAI 1nnlA 30 :GIDELAKI T0379 29 :GVADI 1nnlA 39 :GVEDA T0379 56 :EEEFRTELSRYI 1nnlA 58 :FKAALTERLALI T0379 70 :ELTYQQVYDALLGFLEEISAEKFDYIDSLR 1nnlA 70 :QPSREQVQRLIAEQPPHLTPGIRELVSRLQ T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1nnlA 101 :RNVQVFLISGGFRSIVEHVASKLN T0379 130 :LD 1nnlA 125 :IP T0379 134 :FDKVYASCQMG 1nnlA 127 :ATNVFANRLKF T0379 145 :KYK 1nnlA 156 :GGK T0379 150 :EDIFLEMIADS 1nnlA 159 :GKVIKLLKEKF T0379 163 :KPEETLFIDDGPANVATAERLG 1nnlA 170 :HFKKIIMIGDGATDMEACPPAD T0379 186 :HTYCP 1nnlA 192 :AFIGF T0379 192 :NGENWIPAI 1nnlA 197 :GGNVIRQQV Number of specific fragments extracted= 13 number of extra gaps= 0 total=240 Number of alignments=23 # 1nnlA read from 1nnlA/merged-good-all-a2m # found chain 1nnlA in training set Warning: unaligning (T0379)L37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1nnlA)P57 Warning: unaligning (T0379)E50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1nnlA)P57 T0379 2 :IRNIVFDLGGVLIHLNRE 1nnlA 14 :ADAVCFDVDSTVIREEGI T0379 25 :FKAIGVADIEEM 1nnlA 32 :DELAKICGVEDA T0379 51 :SGRKSEEEFRTELSRY 1nnlA 58 :FKAALTERLALIQPSR T0379 75 :QVYDALLGFLE 1nnlA 74 :EQVQRLIAEQP T0379 86 :EISAEKFDYIDSLR 1nnlA 86 :HLTPGIRELVSRLQ T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1nnlA 101 :RNVQVFLISGGFRSIVEHVAS T0379 127 :GRTLDS 1nnlA 122 :KLNIPA T0379 151 :DIFLEMIADS 1nnlA 160 :KVIKLLKEKF T0379 163 :KPEETLFIDDGPANV 1nnlA 170 :HFKKIIMIGDGATDM T0379 186 :HTYCPDNG 1nnlA 192 :AFIGFGGN T0379 195 :NWIPAITR 1nnlA 200 :VIRQQVKD Number of specific fragments extracted= 11 number of extra gaps= 0 total=251 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zd3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zd3A expands to /projects/compbio/data/pdb/1zd3.pdb.gz 1zd3A:# T0379 read from 1zd3A/merged-good-all-a2m # 1zd3A read from 1zd3A/merged-good-all-a2m # adding 1zd3A to template set # found chain 1zd3A in template set T0379 2 :IRNIVFDLGGVLIHL 1zd3A 3 :LRAAVFDLDGVLALP T0379 19 :EESIRRFKAIGVADIEEM 1zd3A 18 :AVFGVLGRTEEALALPRG T0379 37 :L 1zd3A 37 :L T0379 38 :DPYLQKGLFLDLESGRKSEEEFRTELSRY 1zd3A 50 :TTRLMKGEITLSQWIPLMEENCRKCSETA T0379 68 :G 1zd3A 79 :K T0379 73 :YQQVYDALLGFL 1zd3A 88 :IKEIFDKAISAR T0379 86 :EISAEKFDYIDSLRP 1zd3A 100 :KINRPMLQAALMLRK T0379 101 :DYRLFLLSNTN 1zd3A 116 :GFTTAILTNTW T0379 112 :PYVLDLAMSP 1zd3A 133 :RDGLAQLMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENW 1zd3A 143 :LKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTA T0379 200 :ITRLLR 1zd3A 210 :LKELEK Number of specific fragments extracted= 11 number of extra gaps= 0 total=262 Number of alignments=25 # 1zd3A read from 1zd3A/merged-good-all-a2m # found chain 1zd3A in template set T0379 2 :IRNIVFDLGGVLIHLN 1zd3A 3 :LRAAVFDLDGVLALPA T0379 18 :REESIRRFKAIGVAD 1zd3A 20 :FGVLGRTEEALALPR T0379 33 :IEEMLDPY 1zd3A 40 :AFQKGGPE T0379 44 :GLFLDLESGRKSEEEFRTELSR 1zd3A 48 :GATTRLMKGEITLSQWIPLMEE T0379 69 :KELTYQQV 1zd3A 84 :KNFSIKEI T0379 77 :YDALLG 1zd3A 93 :DKAISA T0379 85 :EEISAEKFDYIDSLR 1zd3A 99 :RKINRPMLQAALMLR T0379 100 :PDYRLFLLSN 1zd3A 115 :KGFTTAILTN T0379 110 :TNPYVLDLAMSP 1zd3A 131 :AERDGLAQLMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1zd3A 143 :LKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKEL Number of specific fragments extracted= 10 number of extra gaps= 0 total=272 Number of alignments=26 # 1zd3A read from 1zd3A/merged-good-all-a2m # found chain 1zd3A in template set T0379 1 :MIRNIVFDLGGVLIHLNRE 1zd3A 2 :TLRAAVFDLDGVLALPAVF T0379 22 :IRRFKAIGVADIEEMLDPYLQKG 1zd3A 21 :GVLGRTEEALALPRGLLNDAFQK T0379 45 :LFLDLESGRKSEEEFRTELSRY 1zd3A 49 :ATTRLMKGEITLSQWIPLMEEN T0379 67 :IGKELTYQQVYDALLGFL 1zd3A 82 :LPKNFSIKEIFDKAISAR T0379 86 :EISAEKFDYIDSLR 1zd3A 100 :KINRPMLQAALMLR T0379 100 :PDYRLFLLSNTN 1zd3A 115 :KGFTTAILTNTW T0379 112 :PYVLDLA 1zd3A 133 :RDGLAQL T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRL 1zd3A 140 :MCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKV Number of specific fragments extracted= 8 number of extra gaps= 0 total=280 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l7mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1l7mA/merged-good-all-a2m # 1l7mA read from 1l7mA/merged-good-all-a2m # found chain 1l7mA in training set T0379 2 :IRNIVFDLGGVLIHLNR 1l7mA 5 :KKLILFDFDSTLVNNET T0379 24 :RFKAIGVADIEEMLDPYLQKG 1l7mA 22 :IDEIAREAGVEEEVKKITKEA T0379 45 :LFLDLESGRKSEEEFRTELSRY 1l7mA 46 :KLNFEQSLRKRVSLLKDLPIEK T0379 77 :YDALLGFL 1l7mA 68 :VEKAIKRI T0379 86 :EISAEKFDYIDSLRP 1l7mA 76 :TPTEGAEETIKELKN T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1l7mA 92 :GYVVAVVSGGFDIAVNKIKEKLG T0379 134 :FDKVYAS 1l7mA 115 :LDYAFAN T0379 141 :CQMGK 1l7mA 136 :GEVLK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1l7mA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPDN 1l7mA 180 :LKIAFCA Number of specific fragments extracted= 10 number of extra gaps= 0 total=290 Number of alignments=28 # 1l7mA read from 1l7mA/merged-good-all-a2m # found chain 1l7mA in training set T0379 2 :IRNIVFDLGGVLIHLN 1l7mA 5 :KKLILFDFDSTLVNNE T0379 18 :REESI 1l7mA 32 :EEEVK T0379 44 :GLFLDLESGRKSEEEFRTELSRYIG 1l7mA 37 :KITKEAMEGKLNFEQSLRKRVSLLK T0379 70 :ELTYQQVYDALLG 1l7mA 62 :DLPIEKVEKAIKR T0379 85 :EEISAEKFDYIDSLR 1l7mA 75 :ITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1l7mA 91 :RGYVVAVVSGGFDIAVNKIKEKLG T0379 130 :LDSFFDKVYASCQM 1l7mA 115 :LDYAFANRLIVKDG T0379 145 :KYK 1l7mA 142 :NAK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1l7mA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCP 1l7mA 180 :LKIAF T0379 192 :NGE 1l7mA 185 :CAK T0379 202 :RLLRE 1l7mA 188 :PILKE Number of specific fragments extracted= 12 number of extra gaps= 0 total=302 Number of alignments=29 # 1l7mA read from 1l7mA/merged-good-all-a2m # found chain 1l7mA in training set T0379 1 :MIRNIVFDLGGVLIHLNRE 1l7mA 4 :KKKLILFDFDSTLVNNETI T0379 25 :FKAIGVADIEEMLDPYLQKGLFLDLESGRKSEE 1l7mA 23 :DEIAREAGVEEEVKKITKEAMEGKLNFEQSLRK T0379 59 :FRTELS 1l7mA 56 :RVSLLK T0379 67 :IGKELTYQQVYD 1l7mA 62 :DLPIEKVEKAIK T0379 84 :LEEISAEKFDYIDSLR 1l7mA 74 :RITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1l7mA 91 :RGYVVAVVSGGFDIAVNKIKE T0379 127 :GRTL 1l7mA 112 :KLGL T0379 135 :DKVYA 1l7mA 116 :DYAFA T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1l7mA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPD 1l7mA 180 :LKIAFC T0379 196 :WIPAITRL 1l7mA 186 :AKPILKEK Number of specific fragments extracted= 11 number of extra gaps= 0 total=313 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cqzA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cqzA expands to /projects/compbio/data/pdb/1cqz.pdb.gz 1cqzA:# T0379 read from 1cqzA/merged-good-all-a2m # 1cqzA read from 1cqzA/merged-good-all-a2m # adding 1cqzA to template set # found chain 1cqzA in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cqzA)R4 Warning: unaligning (T0379)R18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cqzA)G48 T0379 4 :NIVFDLGGVLIHLN 1cqzA 5 :VAAFDLDGVLALPS T0379 78 :DALLGF 1cqzA 94 :QAMAAR T0379 86 :EISAEKFDYIDSLRP 1cqzA 100 :SINRPMLQAAIALKK T0379 101 :DYRLFLLSN 1cqzA 116 :GFTTCIVTN T0379 110 :TNPYVLDLAMSP 1cqzA 131 :DKRDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1cqzA 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTAS T0379 202 :RLL 1cqzA 209 :ALR Number of specific fragments extracted= 7 number of extra gaps= 0 total=320 Number of alignments=31 # 1cqzA read from 1cqzA/merged-good-all-a2m # found chain 1cqzA in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cqzA)R4 Warning: unaligning (T0379)R53 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cqzA)Q90 T0379 4 :NIVFDLGGVLIHLN 1cqzA 5 :VAAFDLDGVLALPS T0379 54 :KSE 1cqzA 91 :IFS T0379 78 :DALLG 1cqzA 94 :QAMAA T0379 85 :EEISAEKFDYIDSLR 1cqzA 99 :RSINRPMLQAAIALK T0379 100 :PDYRLFLLSN 1cqzA 115 :KGFTTCIVTN T0379 110 :TNPYVLDLAMSP 1cqzA 131 :DKRDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPA 1cqzA 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASALRE Number of specific fragments extracted= 7 number of extra gaps= 0 total=327 Number of alignments=32 # 1cqzA read from 1cqzA/merged-good-all-a2m # found chain 1cqzA in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cqzA)R4 Warning: unaligning (T0379)R18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cqzA)G48 Warning: unaligning (T0379)L47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cqzA)G48 Warning: unaligning (T0379)E62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cqzA)Q90 Warning: unaligning (T0379)I67 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cqzA)Q90 T0379 4 :NIVFDLGGVLIHLN 1cqzA 5 :VAAFDLDGVLALPS T0379 48 :DLESGRKSEEEFRT 1cqzA 49 :PTEQLMKGKITFSQ T0379 68 :GKELTY 1cqzA 91 :IFSQAM T0379 83 :FLEEISAEKFDYIDSLR 1cqzA 97 :AARSINRPMLQAAIALK T0379 100 :PDYRLFLLSN 1cqzA 115 :KGFTTCIVTN T0379 110 :TNPYVLDLAMS 1cqzA 131 :DKRDSLAQMMC T0379 129 :TLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1cqzA 142 :ELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNT T0379 194 :ENWIPAITRLLREQK 1cqzA 208 :SALRELEKVTGTQFP Number of specific fragments extracted= 8 number of extra gaps= 0 total=335 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wviA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wviA expands to /projects/compbio/data/pdb/1wvi.pdb.gz 1wviA:# T0379 read from 1wviA/merged-good-all-a2m # 1wviA read from 1wviA/merged-good-all-a2m # adding 1wviA to template set # found chain 1wviA in template set T0379 2 :IRNIVFDLGGVLIH 1wviA 1003 :YKGYLIDLDGTIYK T0379 16 :LNREESIRRFKAIGVA 1wviA 1020 :RIPAGEDFVKRLQERQ T0379 32 :DIEEMLDPYLQK 1wviA 1044 :NTTRTPEMVQEM T0379 55 :SEEEF 1wviA 1056 :LATSF T0379 71 :LTYQQVYDAL 1wviA 1095 :TGLKKAVAEA T0379 83 :FLEEISAEKFDYIDSLRP 1wviA 1120 :LDTNLTYEKLTLATLAIQ T0379 101 :DYRL 1wviA 1139 :GAVF T0379 106 :LLSNTNP 1wviA 1143 :IGTNPDL T0379 113 :YVLDLAMSPRF 1wviA 1166 :FLLEKATRVKP T0379 138 :YA 1wviA 1177 :II T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGP 1wviA 1179 :IGKPEAVIMNKALDRLGVKRHEAIMVGDNY T0379 175 :ANVATAERLGFHTYCPDNGENWIPAITR 1wviA 1210 :TDITAGIKNDIATLLVTTGFTKPEEVPA Number of specific fragments extracted= 12 number of extra gaps= 0 total=347 Number of alignments=34 # 1wviA read from 1wviA/merged-good-all-a2m # found chain 1wviA in template set T0379 2 :IRNIVFDLGGVLIHLN 1wviA 1003 :YKGYLIDLDGTIYKGK T0379 18 :REESIRRFKAIGVADIEEMLDP 1wviA 1024 :GEDFVKRLQERQLPYILVTNNT T0379 53 :RKSEEEFRTELSRYIGKELTY 1wviA 1046 :TRTPEMVQEMLATSFNIKTPL T0379 74 :QQVYDALLGFL 1wviA 1095 :TGLKKAVAEAG T0379 85 :EEISAEKFDYIDSLR 1wviA 1122 :TNLTYEKLTLATLAI T0379 100 :PDYR 1wviA 1138 :KGAV T0379 105 :FLLSN 1wviA 1142 :FIGTN T0379 110 :TNPYVLDLAMSPRF 1wviA 1160 :GAGAILFLLEKATR T0379 130 :LD 1wviA 1174 :VK T0379 134 :F 1wviA 1176 :P T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGPA 1wviA 1179 :IGKPEAVIMNKALDRLGVKRHEAIMVGDNYL T0379 176 :NVATAERLGFHTYCPDNGENWIPAI 1wviA 1211 :DITAGIKNDIATLLVTTGFTKPEEV Number of specific fragments extracted= 12 number of extra gaps= 0 total=359 Number of alignments=35 # 1wviA read from 1wviA/merged-good-all-a2m # found chain 1wviA in template set T0379 1 :MIRNIVFDLGGVLIH 1wviA 1002 :TYKGYLIDLDGTIYK T0379 84 :LEEISAEKFDYIDSLR 1wviA 1017 :GKDRIPAGEDFVKRLQ T0379 100 :PDYRLFLLSN 1wviA 1034 :RQLPYILVTN T0379 110 :TNPYVLDLAMSPR 1wviA 1047 :RTPEMVQEMLATS T0379 124 :LPS 1wviA 1060 :FNI T0379 127 :GRTLDSFFDKVYASCQMG 1wviA 1079 :YMNDMKRGKTAYVIGETG T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGP 1wviA 1179 :IGKPEAVIMNKALDRLGVKRHEAIMVGDNY T0379 175 :ANVATAERLGFHTYCPDNGENWIPAI 1wviA 1210 :TDITAGIKNDIATLLVTTGFTKPEEV Number of specific fragments extracted= 8 number of extra gaps= 0 total=367 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zjjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zjjA expands to /projects/compbio/data/pdb/1zjj.pdb.gz 1zjjA:# T0379 read from 1zjjA/merged-good-all-a2m # 1zjjA read from 1zjjA/merged-good-all-a2m # adding 1zjjA to template set # found chain 1zjjA in template set T0379 3 :RNIVFDLGGVLIH 1zjjA 2 :VAIIFDMDGVLYR T0379 16 :LNRE 1zjjA 18 :AIPG T0379 21 :SIRRFKAIGVADIE 1zjjA 22 :VRELIEFLKERGIP T0379 35 :EMLDPYLQKGLF 1zjjA 45 :KTPEMYREKLLK T0379 83 :FLEEISAEKFDYIDSLRP 1zjjA 126 :LDPDLTYEKLKYATLAIR T0379 101 :DYRL 1zjjA 145 :GATF T0379 106 :LLSNTNP 1zjjA 149 :IGTNPDA T0379 113 :YVLDLAMSPRF 1zjjA 172 :AALKVATNVEP T0379 138 :YAS 1zjjA 183 :III T0379 146 :YKPNEDIFLEMIADSG 1zjjA 186 :GKPNEPMYEVVREMFP T0379 164 :PEETLFIDDGP 1zjjA 202 :GEELWMVGDRL T0379 175 :ANVATAERLGFHTYCPDNGENWIP 1zjjA 214 :TDIAFAKKFGMKAIMVLTGVSSLE T0379 199 :AITRLL 1zjjA 252 :SVYELI Number of specific fragments extracted= 13 number of extra gaps= 0 total=380 Number of alignments=37 # 1zjjA read from 1zjjA/merged-good-all-a2m # found chain 1zjjA in template set T0379 3 :RNIVFDLGGVLIHLN 1zjjA 2 :VAIIFDMDGVLYRGN T0379 18 :REESIRRFKAIGVADIEEMLDPY 1zjjA 22 :VRELIEFLKERGIPFAFLTNNST T0379 54 :KSEEEFRTELSR 1zjjA 45 :KTPEMYREKLLK T0379 85 :EEISAEKFDYIDSLR 1zjjA 128 :PDLTYEKLKYATLAI T0379 100 :PDYR 1zjjA 144 :NGAT T0379 105 :FLLSN 1zjjA 148 :FIGTN T0379 110 :TNPYVLDLAMSPRF 1zjjA 166 :GAGSIIAALKVATN T0379 130 :LD 1zjjA 180 :VE T0379 134 :FDKV 1zjjA 182 :PIII T0379 146 :YKPNEDIFLEMIADS 1zjjA 186 :GKPNEPMYEVVREMF T0379 161 :G 1zjjA 202 :G T0379 165 :EETLFIDDGPA 1zjjA 203 :EELWMVGDRLD T0379 176 :NVATAERLGFHTYCPDNGENWIPAI 1zjjA 215 :DIAFAKKFGMKAIMVLTGVSSLEDI T0379 201 :TRLL 1zjjA 257 :IDYL Number of specific fragments extracted= 14 number of extra gaps= 0 total=394 Number of alignments=38 # 1zjjA read from 1zjjA/merged-good-all-a2m # found chain 1zjjA in template set T0379 3 :RNIVFDLGGVLIH 1zjjA 2 :VAIIFDMDGVLYR T0379 84 :LEEISAEKFDYIDSLR 1zjjA 15 :GNRAIPGVRELIEFLK T0379 100 :PDYRLFLLSN 1zjjA 32 :RGIPFAFLTN T0379 110 :TNPYVLDLAMSPRFLPSGRTL 1zjjA 45 :KTPEMYREKLLKMGIDVSSSI T0379 137 :VYASCQMG 1zjjA 66 :IITSGLAT T0379 145 :KYKPN 1zjjA 185 :IGKPN T0379 151 :DIFLEMIADS 1zjjA 190 :EPMYEVVREM T0379 165 :EETLFIDDGP 1zjjA 203 :EELWMVGDRL T0379 175 :ANVATAERLGFHTYCPDNGENWIPAITR 1zjjA 214 :TDIAFAKKFGMKAIMVLTGVSSLEDIKK Number of specific fragments extracted= 9 number of extra gaps= 0 total=403 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2go7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2go7A expands to /projects/compbio/data/pdb/2go7.pdb.gz 2go7A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0379 read from 2go7A/merged-good-all-a2m # 2go7A read from 2go7A/merged-good-all-a2m # adding 2go7A to template set # found chain 2go7A in template set Warning: unaligning (T0379)I2 because first residue in template chain is (2go7A)K3 Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)D9 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)D9 Warning: unaligning (T0379)L106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)Y106 Warning: unaligning (T0379)L107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)Y106 T0379 3 :RNIV 2go7A 4 :TAFI T0379 9 :LGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKG 2go7A 10 :LDGTLLDSYEAILSGIEETFAQFSIPYDKEKVREFI T0379 45 :LFLDLESGRKSEEE 2go7A 47 :KYSVQDLLVRVAED T0379 62 :ELSR 2go7A 61 :RNLD T0379 70 :ELTYQQVYDALLGFLEE 2go7A 65 :VEVLNQVRAQSLAEKNA T0379 87 :ISAEKFDYIDSLRP 2go7A 85 :LMPGAREVLAWADE T0379 101 :DYRLF 2go7A 100 :GIQQF T0379 108 :SNTNP 2go7A 107 :THKGN T0379 114 :VLDLAMSPRF 2go7A 112 :NAFTILKDLG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENW 2go7A 122 :VESYFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSINFLESTYE T0379 199 :AITRLL 2go7A 198 :DISRIF Number of specific fragments extracted= 11 number of extra gaps= 2 total=414 Number of alignments=40 # 2go7A read from 2go7A/merged-good-all-a2m # found chain 2go7A in template set Warning: unaligning (T0379)I2 because first residue in template chain is (2go7A)K3 Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)D9 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)D9 Warning: unaligning (T0379)L106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)Y106 Warning: unaligning (T0379)L107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)Y106 T0379 3 :RNIV 2go7A 4 :TAFI T0379 9 :LGGVLIHLN 2go7A 10 :LDGTLLDSY T0379 18 :REESIRRFKAI 2go7A 21 :ILSGIEETFAQ T0379 29 :GVADI 2go7A 33 :SIPYD T0379 44 :GLFLDLESGRKSEEEFRTELSRYI 2go7A 38 :KEKVREFIFKYSVQDLLVRVAEDR T0379 70 :ELTYQQVYDALLGFL 2go7A 62 :NLDVEVLNQVRAQSL T0379 85 :EEISAEKFDYIDSLR 2go7A 83 :VVLMPGAREVLAWAD T0379 100 :PDYRLF 2go7A 99 :SGIQQF T0379 108 :SNTNPY 2go7A 107 :THKGNN T0379 115 :LDLAMSPRF 2go7A 113 :AFTILKDLG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGE 2go7A 122 :VESYFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSINFLEST Number of specific fragments extracted= 11 number of extra gaps= 2 total=425 Number of alignments=41 # 2go7A read from 2go7A/merged-good-all-a2m # found chain 2go7A in template set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)D9 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)D9 Warning: unaligning (T0379)L106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)Y106 Warning: unaligning (T0379)L107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)Y106 T0379 3 :RNIV 2go7A 4 :TAFI T0379 9 :LGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRT 2go7A 10 :LDGTLLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAEDRN T0379 68 :GKELTYQQVYDALLGF 2go7A 63 :LDVEVLNQVRAQSLAE T0379 84 :LEEISAEKFDYIDSLR 2go7A 82 :QVVLMPGAREVLAWAD T0379 100 :PDYRLF 2go7A 99 :SGIQQF T0379 108 :SNTNPYVLDLAMS 2go7A 107 :THKGNNAFTILKD T0379 128 :RTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGE 2go7A 120 :LGVESYFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSINFLEST Number of specific fragments extracted= 7 number of extra gaps= 2 total=432 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ys9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0379/1ys9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0379/1ys9A/merged-good-all-a2m.gz for input Trying 1ys9A/merged-good-all-a2m Error: Couldn't open file 1ys9A/merged-good-all-a2m or 1ys9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yv9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0379/1yv9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0379/1yv9A/merged-good-all-a2m.gz for input Trying 1yv9A/merged-good-all-a2m Error: Couldn't open file 1yv9A/merged-good-all-a2m or 1yv9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rdfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rdfA expands to /projects/compbio/data/pdb/1rdf.pdb.gz 1rdfA:# T0379 read from 1rdfA/merged-good-all-a2m # 1rdfA read from 1rdfA/merged-good-all-a2m # adding 1rdfA to template set # found chain 1rdfA in template set Warning: unaligning (T0379)K163 because of BadResidue code BAD_PEPTIDE at template residue (1rdfA)P177 T0379 2 :IRNIVFDLGGVLIHL 1rdfA 6 :IEAVIFDWAGTTVDY T0379 17 :NREESIRRFKAIGVADIEEMLDPYLQ 1rdfA 22 :CFAPLEVFMEIFHKRGVAITAEEARK T0379 43 :KGLFLDLESGRKSEEEF 1rdfA 58 :RALTEMPRIASEWNRVF T0379 60 :RTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRP 1rdfA 77 :LPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRE T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1rdfA 119 :GIKIGSTTGYTREMMDIVAKEAA T0379 130 :LDSF 1rdfA 142 :LQGY T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1rdfA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 164 :PEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1rdfA 178 :MNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELG T0379 200 :ITRLLRE 1rdfA 226 :LREKIEV Number of specific fragments extracted= 9 number of extra gaps= 1 total=441 Number of alignments=43 # 1rdfA read from 1rdfA/merged-good-all-a2m # found chain 1rdfA in template set Warning: unaligning (T0379)K163 because of BadResidue code BAD_PEPTIDE at template residue (1rdfA)P177 T0379 2 :IRNIVFDLGGVLIHLN 1rdfA 6 :IEAVIFDWAGTTVDYG T0379 18 :REESIRRFKAIGVADIEEMLDPYLQ 1rdfA 26 :LEVFMEIFHKRGVAITAEEARKPMP T0379 44 :GLFLDLESGRKSEEEFRTELSRYIGKELTYQ 1rdfA 51 :LLKIDHVRALTEMPRIASEWNRVFRQLPTEA T0379 75 :QVYDALLGFL 1rdfA 89 :EFEEILFAIL T0379 85 :EEISAEKFDYIDSLR 1rdfA 102 :ASPINAVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1rdfA 118 :RGIKIGSTTGYTREMMDIVAKEAA T0379 130 :LDSF 1rdfA 142 :LQGY T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1rdfA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 164 :PEETLFIDDGPANVATAERLGFHTYCPDNG 1rdfA 178 :MNHMIKVGDTVSDMKEGRNAGMWTVGVILG Number of specific fragments extracted= 9 number of extra gaps= 1 total=450 Number of alignments=44 # 1rdfA read from 1rdfA/merged-good-all-a2m # found chain 1rdfA in template set Warning: unaligning (T0379)K163 because of BadResidue code BAD_PEPTIDE at template residue (1rdfA)P177 T0379 1 :MIRNIVFDLGGVLIHLN 1rdfA 5 :KIEAVIFDWAGTTVDYG T0379 18 :REESIRRFKAIGVADIEEMLDPYLQ 1rdfA 23 :FAPLEVFMEIFHKRGVAITAEEARK T0379 43 :KGLFLDLESGRKSEEEFRTELSRY 1rdfA 54 :IDHVRALTEMPRIASEWNRVFRQL T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 1rdfA 84 :QEMYEEFEEILFAILPRYASPINAVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1rdfA 118 :RGIKIGSTTGYTREMMDIVAK T0379 127 :GRTLDSFF 1rdfA 139 :EAALQGYK T0379 135 :DKVYASCQMGKYKPNEDIFLEMIADSGM 1rdfA 148 :DFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 164 :PEETLFIDDGPANVATAERLGFHTYCPD 1rdfA 178 :MNHMIKVGDTVSDMKEGRNAGMWTVGVI Number of specific fragments extracted= 8 number of extra gaps= 1 total=458 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fdrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fdrA expands to /projects/compbio/data/pdb/2fdr.pdb.gz 2fdrA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 600, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 608, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 610, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 612, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 614, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 616, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 709, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 711, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 713, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 715, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 717, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 719, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 721, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 723, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 725, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 751, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 753, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 755, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 757, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 759, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 761, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 763, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 765, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 769, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 771, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 773, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 775, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 777, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 779, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 781, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 783, because occupancy 0.500 <= existing 0.500 in 2fdrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1330, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1332, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1334, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1336, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1338, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1340, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1342, because occupancy 0.500 <= existing 0.500 in 2fdrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0379 read from 2fdrA/merged-good-all-a2m # 2fdrA read from 2fdrA/merged-good-all-a2m # adding 2fdrA to template set # found chain 2fdrA in template set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fdrA)D10 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fdrA)D10 T0379 2 :IRNIV 2fdrA 4 :FDLII T0379 9 :LGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKG 2fdrA 11 :CDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERF T0379 45 :LFLDLESGRKSEEEF 2fdrA 48 :GMTWKNILLQVESEA T0379 61 :TELS 2fdrA 63 :SIPL T0379 66 :YIGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 2fdrA 67 :SASLLDKSEKLLDMRLERDVKIIDGVKFALSRLT T0379 102 :YRLFLLSNTNPYVLDLAMSPRF 2fdrA 101 :TPRCICSNSSSHRLDMMLTKVG T0379 130 :LDSFF 2fdrA 123 :LKPYF T0379 135 :DKVYASCQMGK 2fdrA 129 :PHIYSAKDLGA T0379 146 :YKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 2fdrA 142 :VKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYP Number of specific fragments extracted= 9 number of extra gaps= 1 total=467 Number of alignments=46 # 2fdrA read from 2fdrA/merged-good-all-a2m # found chain 2fdrA in template set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fdrA)D10 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fdrA)D10 T0379 2 :IRNIV 2fdrA 4 :FDLII T0379 9 :LGGVLIHLN 2fdrA 11 :CDGVLVDSE T0379 18 :REESIRRFKAIGVADIE 2fdrA 23 :AQVESRLLTEAGYPISV T0379 44 :GLFLDLESGRKSEE 2fdrA 40 :EEMGERFAGMTWKN T0379 59 :FRTELSRYIGKELT 2fdrA 54 :ILLQVESEASIPLS T0379 73 :YQQVYDALLGFL 2fdrA 71 :LDKSEKLLDMRL T0379 85 :EEISAEKFDYIDSLR 2fdrA 86 :VKIIDGVKFALSRLT T0379 102 :YRLFLLSNTNPYVLDLAMSPRF 2fdrA 101 :TPRCICSNSSSHRLDMMLTKVG T0379 130 :LDSFF 2fdrA 123 :LKPYF T0379 135 :DKVYASCQMG 2fdrA 129 :PHIYSAKDLG T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLLRE 2fdrA 141 :RVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPSHADRLTD Number of specific fragments extracted= 11 number of extra gaps= 1 total=478 Number of alignments=47 # 2fdrA read from 2fdrA/merged-good-all-a2m # found chain 2fdrA in template set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fdrA)D10 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fdrA)D10 T0379 1 :MIRNIV 2fdrA 3 :GFDLII T0379 9 :LGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRTE 2fdrA 11 :CDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVESEASI T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 2fdrA 68 :ASLLDKSEKLLDMRLERDVKIIDGVKFALSRLT T0379 103 :RLFLLSNTNPYVLDLAMS 2fdrA 102 :PRCICSNSSSHRLDMMLT T0379 127 :GRTLDSFF 2fdrA 120 :KVGLKPYF T0379 135 :DKVYASCQMGK 2fdrA 129 :PHIYSAKDLGA T0379 146 :YKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRL 2fdrA 142 :VKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPSHADR Number of specific fragments extracted= 7 number of extra gaps= 1 total=485 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lvhA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lvhA expands to /projects/compbio/data/pdb/1lvh.pdb.gz 1lvhA:Bad short name: P for alphabet: pdb_atoms Bad short name: OP1 for alphabet: pdb_atoms Bad short name: OP2 for alphabet: pdb_atoms Bad short name: OP3 for alphabet: pdb_atoms # T0379 read from 1lvhA/merged-good-all-a2m # 1lvhA read from 1lvhA/merged-good-all-a2m # adding 1lvhA to template set # found chain 1lvhA in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1lvhA)L9 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1lvhA)L9 T0379 1 :MIRNIV 1lvhA 1 :MFKAVL T0379 10 :GGVLIHLNREESIRRFKAIGVADIE 1lvhA 10 :DGVITDTAEYHFRAWKALAEEIGIN T0379 35 :EMLDPYLQKGLFLDLESGRKSEEEF 1lvhA 36 :VDRQFNEQLKGVSREDSLQKILDLA T0379 61 :T 1lvhA 61 :D T0379 62 :ELSRYIGKELTYQQVYDALLGFL 1lvhA 65 :SAEEFKELAKRKNDNYVKMIQDV T0379 85 :E 1lvhA 90 :A T0379 87 :ISAEKFDYIDSLRP 1lvhA 92 :VYPGILQLLKDLRS T0379 101 :DYRLFLLSNT 1lvhA 107 :KIKIALASAS T0379 113 :YVLDLAMSPRF 1lvhA 117 :KNGPFLLERMN T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1lvhA 128 :LTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGD T0379 199 :AITRLLREQ 1lvhA 211 :FLKEVWLQK Number of specific fragments extracted= 11 number of extra gaps= 0 total=496 Number of alignments=49 # 1lvhA read from 1lvhA/merged-good-all-a2m # found chain 1lvhA in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1lvhA)L9 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1lvhA)L9 T0379 1 :MIRNIV 1lvhA 1 :MFKAVL T0379 10 :GGVLIHLN 1lvhA 10 :DGVITDTA T0379 18 :REESIRRFKAIGVADIE 1lvhA 21 :FRAWKALAEEIGINGVD T0379 44 :GLFLDLESGRKSEE 1lvhA 38 :RQFNEQLKGVSRED T0379 59 :FRTELSRYIGKELTYQ 1lvhA 52 :SLQKILDLADKKVSAE T0379 75 :QVYDALLGFL 1lvhA 71 :ELAKRKNDNY T0379 85 :EEISAEKFDYIDSLR 1lvhA 90 :ADVYPGILQLLKDLR T0379 100 :PDYRLFLLSNT 1lvhA 106 :NKIKIALASAS T0379 113 :YVLDLAMSPRF 1lvhA 117 :KNGPFLLERMN T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1lvhA 128 :LTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDI T0379 201 :TRLLRE 1lvhA 209 :LEFLKE Number of specific fragments extracted= 11 number of extra gaps= 0 total=507 Number of alignments=50 # 1lvhA read from 1lvhA/merged-good-all-a2m # found chain 1lvhA in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1lvhA)L9 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1lvhA)L9 T0379 1 :MIRNIV 1lvhA 1 :MFKAVL T0379 10 :GGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEIS 1lvhA 10 :DGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVS T0379 89 :AEKFDYIDSLR 1lvhA 94 :PGILQLLKDLR T0379 100 :PDYRLFLLSNTNP 1lvhA 106 :NKIKIALASASKN T0379 115 :LDLAMS 1lvhA 119 :GPFLLE T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1lvhA 125 :RMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGD Number of specific fragments extracted= 6 number of extra gaps= 0 total=513 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5sA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f5sA expands to /projects/compbio/data/pdb/1f5s.pdb.gz 1f5sA:Skipped atom 82, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 84, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 86, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 88, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 90, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 92, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 1f5sA # T0379 read from 1f5sA/merged-good-all-a2m # 1f5sA read from 1f5sA/merged-good-all-a2m # adding 1f5sA to template set # found chain 1f5sA in template set T0379 2 :IRNIVFDLGGVLIHLNR 1f5sA 5 :KKLILFDFDSTLVNNET T0379 24 :RFKAIGVADIEEMLDPYLQKG 1f5sA 22 :IDEIAREAGVEEEVKKITKEA T0379 45 :LFLDLESGRKSEEEFRTELSRY 1f5sA 46 :KLNFEQSLRKRVSLLKDLPIEK T0379 77 :YDALLGFL 1f5sA 68 :VEKAIKRI T0379 86 :EISAEKFDYIDSLRP 1f5sA 76 :TPTEGAEETIKELKN T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1f5sA 92 :GYVVAVVSGGFDIAVNKIKEKLG T0379 134 :FDKVYAS 1f5sA 115 :LDYAFAN T0379 141 :CQMGKY 1f5sA 136 :GEVLKE T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1f5sA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPDN 1f5sA 180 :LKIAFCA Number of specific fragments extracted= 10 number of extra gaps= 0 total=523 Number of alignments=52 # 1f5sA read from 1f5sA/merged-good-all-a2m # found chain 1f5sA in template set T0379 2 :IRNIVFDLGGVLIHLN 1f5sA 5 :KKLILFDFDSTLVNNE T0379 20 :ESIRRFKAIGV 1f5sA 21 :TIDEIAREAGV T0379 31 :ADIE 1f5sA 33 :EEVK T0379 44 :GLFLDLESGRKSEEEFRTELSRYIG 1f5sA 37 :KITKEAMEGKLNFEQSLRKRVSLLK T0379 70 :ELTYQQVYDALLG 1f5sA 62 :DLPIEKVEKAIKR T0379 85 :EEISAEKFDYIDSLR 1f5sA 75 :ITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1f5sA 91 :RGYVVAVVSGGFDIAVNKIKEKLG T0379 130 :LDSFFDKVYASCQ 1f5sA 115 :LDYAFANRLIVKD T0379 145 :KYK 1f5sA 142 :NAK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1f5sA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCP 1f5sA 180 :LKIAF T0379 192 :NGE 1f5sA 185 :CAK T0379 202 :RLLRE 1f5sA 188 :PILKE Number of specific fragments extracted= 13 number of extra gaps= 0 total=536 Number of alignments=53 # 1f5sA read from 1f5sA/merged-good-all-a2m # found chain 1f5sA in template set T0379 1 :MIRNIVFDLGGVLIHLNRE 1f5sA 4 :KKKLILFDFDSTLVNNETI T0379 25 :FKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRT 1f5sA 23 :DEIAREAGVEEEVKKITKEAMEGKLNFEQSLRKRVSL T0379 63 :L 1f5sA 60 :L T0379 67 :IGKELTYQQVYD 1f5sA 62 :DLPIEKVEKAIK T0379 84 :LEEISAEKFDYIDSLR 1f5sA 74 :RITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1f5sA 91 :RGYVVAVVSGGFDIAVNKIKE T0379 127 :GRTL 1f5sA 112 :KLGL T0379 135 :DKVYA 1f5sA 116 :DYAFA T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1f5sA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPD 1f5sA 180 :LKIAFC T0379 196 :WIPAITR 1f5sA 186 :AKPILKE Number of specific fragments extracted= 11 number of extra gaps= 0 total=547 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vj5A expands to /projects/compbio/data/pdb/1vj5.pdb.gz 1vj5A:# T0379 read from 1vj5A/merged-good-all-a2m # 1vj5A read from 1vj5A/merged-good-all-a2m # adding 1vj5A to template set # found chain 1vj5A in template set T0379 2 :IRNIVFDLGGVLIHL 1vj5A 3 :LRAAVFDLDGVLALP T0379 19 :EESIRRFKAIGVADIEEM 1vj5A 18 :AVFGVLGRTEEALALPRG T0379 37 :LDPYLQKGLF 1vj5A 37 :LNDAFQKGGP T0379 47 :LDLESGRKSEEEFRTELSRY 1vj5A 59 :TLSQWIPLMEENCRKCSETA T0379 68 :GK 1vj5A 79 :KV T0379 73 :YQQVYDALLGFLEE 1vj5A 88 :IKEIFDKAISARKI T0379 88 :SAEKFDYIDSLRP 1vj5A 102 :NRPMLQAALMLRK T0379 101 :DYRLFLLSNTN 1vj5A 116 :GFTTAILTNTW T0379 112 :PYVLDLAMSP 1vj5A 133 :RDGLAQLMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENW 1vj5A 143 :LKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTA T0379 200 :ITRLLR 1vj5A 210 :LKELEK Number of specific fragments extracted= 11 number of extra gaps= 0 total=558 Number of alignments=55 # 1vj5A read from 1vj5A/merged-good-all-a2m # found chain 1vj5A in template set T0379 2 :IRNIVFDLGGVLIHLN 1vj5A 3 :LRAAVFDLDGVLALPA T0379 18 :REESIRRFKAIGVADIEEMLDPYLQ 1vj5A 20 :FGVLGRTEEALALPRGLLNDAFQKG T0379 43 :KGLFLDLESGRKSEEEFRTELSR 1vj5A 47 :EGATTRLMKGEITLSQWIPLMEE T0379 69 :KELTYQQV 1vj5A 84 :KNFSIKEI T0379 77 :YDALLG 1vj5A 93 :DKAISA T0379 85 :EEISAEKFDYIDSLR 1vj5A 99 :RKINRPMLQAALMLR T0379 100 :PDYRLFLLSN 1vj5A 115 :KGFTTAILTN T0379 110 :TNPYVLDLAMSP 1vj5A 131 :AERDGLAQLMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1vj5A 143 :LKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKEL Number of specific fragments extracted= 9 number of extra gaps= 0 total=567 Number of alignments=56 # 1vj5A read from 1vj5A/merged-good-all-a2m # found chain 1vj5A in template set T0379 1 :MIRNIVFDLGGVLIHLNRE 1vj5A 2 :TLRAAVFDLDGVLALPAVF T0379 22 :IRRFKAIGVADIEEMLDPYLQKG 1vj5A 21 :GVLGRTEEALALPRGLLNDAFQK T0379 45 :LFLDLESGRKSEEEFRTELSRY 1vj5A 49 :ATTRLMKGEITLSQWIPLMEEN T0379 67 :IGKELTYQQVYDALLGFL 1vj5A 82 :LPKNFSIKEIFDKAISAR T0379 86 :EISAEKFDYIDSLR 1vj5A 100 :KINRPMLQAALMLR T0379 100 :PDYRLFLLSNTN 1vj5A 115 :KGFTTAILTNTW T0379 112 :PYVLDLAM 1vj5A 133 :RDGLAQLM T0379 128 :RTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRL 1vj5A 141 :CELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKV Number of specific fragments extracted= 8 number of extra gaps= 0 total=575 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o08A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1o08A/merged-good-all-a2m # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o08A)D1008 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o08A)D1008 T0379 1 :MIRNIV 1o08A 1001 :MFKAVL T0379 9 :LGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKG 1o08A 1009 :LDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQL T0379 45 :LFLDLESGRKSEEEF 1o08A 1046 :GVSREDSLQKILDLA T0379 62 :ELSRYIGKELTYQQVYDALLGFL 1o08A 1065 :SAEEFKELAKRKNDNYVKMIQDV T0379 85 :EEISAEKFDYIDSLRP 1o08A 1090 :ADVYPGILQLLKDLRS T0379 101 :DYRLFLLSNT 1o08A 1107 :KIKIALASAS T0379 113 :YVLDLAMSPRF 1o08A 1117 :KNGPFLLERMN T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1o08A 1128 :LTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGD T0379 199 :AITRLLR 1o08A 1211 :FLKEVWL Number of specific fragments extracted= 9 number of extra gaps= 1 total=584 Number of alignments=58 # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o08A)D1008 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o08A)D1008 T0379 1 :MIRNIV 1o08A 1001 :MFKAVL T0379 9 :LGGVLIHLN 1o08A 1009 :LDGVITDTA T0379 18 :REESIRRFKAIGVADI 1o08A 1021 :FRAWKALAEEIGINGV T0379 44 :GLFLDLESGRKSEEEFRTELSRYIGKELTYQQ 1o08A 1037 :DRQFNEQLKGVSREDSLQKILDLADKKVSAEE T0379 76 :VYDALLGFL 1o08A 1072 :LAKRKNDNY T0379 85 :EEISAEKFDYIDSLR 1o08A 1090 :ADVYPGILQLLKDLR T0379 100 :PDYRLFLLSNT 1o08A 1106 :NKIKIALASAS T0379 113 :YVLDLAMSPRF 1o08A 1117 :KNGPFLLERMN T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1o08A 1128 :LTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDI T0379 201 :TRLLRE 1o08A 1209 :LEFLKE Number of specific fragments extracted= 10 number of extra gaps= 1 total=594 Number of alignments=59 # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o08A)D1008 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o08A)D1008 T0379 1 :MIRNIV 1o08A 1001 :MFKAVL T0379 9 :LGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEE 1o08A 1009 :LDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQD T0379 87 :ISAEKFDYIDSLR 1o08A 1092 :VYPGILQLLKDLR T0379 100 :PDYRLFLLSNTNP 1o08A 1106 :NKIKIALASASKN T0379 115 :LDLAMS 1o08A 1119 :GPFLLE T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1o08A 1125 :RMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGD Number of specific fragments extracted= 6 number of extra gaps= 1 total=600 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ah5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2ah5A expands to /projects/compbio/data/pdb/2ah5.pdb.gz 2ah5A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0379 read from 2ah5A/merged-good-all-a2m # 2ah5A read from 2ah5A/merged-good-all-a2m # adding 2ah5A to template set # found chain 2ah5A in template set Warning: unaligning (T0379)N109 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ah5A)K108 Warning: unaligning (T0379)T110 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ah5A)K108 T0379 1 :M 2ah5A 1 :M T0379 2 :IRNIVFDLGGVLIHLNREESIRRFKAIGVADIE 2ah5A 4 :ITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVP T0379 35 :EMLDPYLQKGLFLDLESGRKSEEE 2ah5A 38 :PDAKTIRGFMGPPLESSFATCLSK T0379 64 :SRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLS 2ah5A 62 :DQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYITT T0379 111 :NPYVLDLAMSPRF 2ah5A 109 :DTSTAQDMAKNLE T0379 130 :LDSFFDKVYASCQMGKYK 2ah5A 122 :IHHFFDGIYGSSPEAPHK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITR 2ah5A 140 :ADVIHQALQTHQLAPEQAIIIGDTKFDMLGARETGIQKLAITWGFGEQADLLN Number of specific fragments extracted= 7 number of extra gaps= 1 total=607 Number of alignments=61 # 2ah5A read from 2ah5A/merged-good-all-a2m # found chain 2ah5A in template set Warning: unaligning (T0379)N109 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ah5A)K108 Warning: unaligning (T0379)T110 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ah5A)K108 T0379 1 :M 2ah5A 1 :M T0379 2 :IRNIVFDLGGVLIHLN 2ah5A 4 :ITAIFFDLDGTLVDSS T0379 18 :REESIRRFKAI 2ah5A 22 :IHNAFTYTFKE T0379 29 :GVADIE 2ah5A 34 :GVPSPD T0379 44 :GLFLDLESGRK 2ah5A 40 :AKTIRGFMGPP T0379 59 :FRTELSRYIG 2ah5A 51 :LESSFATCLS T0379 70 :ELTYQQVYDALLGFL 2ah5A 61 :KDQISEAVQIYRSYY T0379 85 :EEISAEKFDYIDSLRPDYRLFLLS 2ah5A 83 :AQLFPQIIDLLEELSSSYPLYITT T0379 111 :NPYVLDLAMSPRF 2ah5A 109 :DTSTAQDMAKNLE T0379 130 :LDSFFDKVYASCQMGKYK 2ah5A 122 :IHHFFDGIYGSSPEAPHK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 2ah5A 140 :ADVIHQALQTHQLAPEQAIIIGDTKFDMLGARETGIQKLAITWGFGEQADL Number of specific fragments extracted= 11 number of extra gaps= 1 total=618 Number of alignments=62 # 2ah5A read from 2ah5A/merged-good-all-a2m # found chain 2ah5A in template set Warning: unaligning (T0379)N109 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ah5A)K108 Warning: unaligning (T0379)T110 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ah5A)K108 T0379 2 :IRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKS 2ah5A 4 :ITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRGFMGPPLESSFAT T0379 62 :ELSRY 2ah5A 58 :CLSKD T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLS 2ah5A 65 :SEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYITT T0379 111 :NPYVLDLAMS 2ah5A 109 :DTSTAQDMAK T0379 127 :GRTLDSFFDKVYASCQMGKYK 2ah5A 119 :NLEIHHFFDGIYGSSPEAPHK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAITRLL 2ah5A 140 :ADVIHQALQTHQLAPEQAIIIGDTKFDMLGARETGIQKLAITWGFGEQADLLNYQ Number of specific fragments extracted= 6 number of extra gaps= 1 total=624 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g80A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0379/2g80A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0379/2g80A/merged-good-all-a2m.gz for input Trying 2g80A/merged-good-all-a2m Error: Couldn't open file 2g80A/merged-good-all-a2m or 2g80A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zs9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zs9A expands to /projects/compbio/data/pdb/1zs9.pdb.gz 1zs9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0379 read from 1zs9A/merged-good-all-a2m # 1zs9A read from 1zs9A/merged-good-all-a2m # adding 1zs9A to template set # found chain 1zs9A in template set Warning: unaligning (T0379)L63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zs9A)K106 Warning: unaligning (T0379)R65 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zs9A)K106 T0379 2 :IRNIVFDLGGVLIH 1zs9A 10 :VTVILLDIEGTTTP T0379 16 :LNREESIRRFKAIGVA 1zs9A 31 :LFPYIEENVKEYLQTH T0379 32 :DIE 1zs9A 48 :EEE T0379 47 :LDLESGRKSEEEF 1zs9A 51 :ECQQDVSLLRKQA T0379 60 :RTE 1zs9A 101 :MSL T0379 66 :YIGKELTYQQVYDALLGFL 1zs9A 107 :TTALKQLQGHMWRAAFTAG T0379 85 :EEISAEKFDYIDSLRP 1zs9A 129 :AEFFADVVPAVRKWRE T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1zs9A 146 :GMKVYIYSSGSVEAQKLLFGHST T0379 127 :GRTLDSFFDKVY 1zs9A 169 :EGDILELVDGHF T0379 141 :CQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWI 1zs9A 181 :DTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAG T0379 200 :ITRLLRE 1zs9A 238 :LTDDEKT Number of specific fragments extracted= 11 number of extra gaps= 0 total=635 Number of alignments=64 # 1zs9A read from 1zs9A/merged-good-all-a2m # found chain 1zs9A in template set T0379 2 :IRNIVFDLGGVLIHLN 1zs9A 10 :VTVILLDIEGTTTPIA T0379 56 :EEEFRTELSR 1zs9A 52 :CQQDVSLLRK T0379 69 :KELTYQQVYDALLGFL 1zs9A 79 :SGNGVDDLQQMIQAVV T0379 85 :EEISAEKFDYIDSLR 1zs9A 129 :AEFFADVVPAVRKWR T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRFLPS 1zs9A 145 :AGMKVYIYSSGSVEAQKLLFGHSTEGD T0379 130 :LDSFFDKVYA 1zs9A 172 :ILELVDGHFD T0379 142 :QMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1zs9A 182 :TKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGN T0379 198 :PAITRL 1zs9A 236 :AGLTDD Number of specific fragments extracted= 8 number of extra gaps= 0 total=643 Number of alignments=65 # 1zs9A read from 1zs9A/merged-good-all-a2m # found chain 1zs9A in template set T0379 2 :IRNIVFDLGGVLIHLNRE 1zs9A 10 :VTVILLDIEGTTTPIAFV T0379 30 :VADIEEMLDPYLQKGLFLDL 1zs9A 28 :KDILFPYIEENVKEYLQTHW T0379 50 :ESGRKSEEEFRTELSRY 1zs9A 50 :EECQQDVSLLRKQAEED T0379 67 :IGKELTYQQVYDALLGFLE 1zs9A 108 :TALKQLQGHMWRAAFTAGR T0379 86 :EISAEKFDYIDSLR 1zs9A 130 :EFFADVVPAVRKWR T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1zs9A 145 :AGMKVYIYSSGSVEAQKLLFG T0379 124 :LPSGRTLDSFFDKVYA 1zs9A 166 :HSTEGDILELVDGHFD T0379 142 :QMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGE 1zs9A 182 :TKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPG Number of specific fragments extracted= 8 number of extra gaps= 0 total=651 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x42A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1x42A expands to /projects/compbio/data/pdb/1x42.pdb.gz 1x42A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0379 read from 1x42A/merged-good-all-a2m # 1x42A read from 1x42A/merged-good-all-a2m # adding 1x42A to template set # found chain 1x42A in template set T0379 1 :MIRNIVFDLGGVLI 1x42A 1 :MIRAVFFDFVGTLL T0379 16 :LNREESIRRFKAIGVA 1x42A 15 :SVEGEAKTHLKIMEEV T0379 32 :DIEEMLDPYLQKG 1x42A 33 :DYPLNPKTLLDEY T0379 49 :LESGRKSEEEF 1x42A 46 :EKLTREAFSNY T0379 60 :RTELSRYIGKELT 1x42A 65 :RDIEEEVMRKLAE T0379 73 :YQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRF 1x42A 87 :FWEIHLRMHQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLDALG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGP 1x42A 138 :IKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNP T0379 175 :ANVATAERLGFHTYCPDNGENWIP 1x42A 184 :KDCGGSKNLGMTSILLDRKGEKRE T0379 199 :AITRLLRE 1x42A 221 :EVIKIVDE Number of specific fragments extracted= 9 number of extra gaps= 0 total=660 Number of alignments=67 # 1x42A read from 1x42A/merged-good-all-a2m # found chain 1x42A in template set T0379 1 :MIRNIVFDLGGVLIHLN 1x42A 1 :MIRAVFFDFVGTLLSVE T0379 18 :REESIRRFKAI 1x42A 38 :PKTLLDEYEKL T0379 44 :GLFLDLESGRK 1x42A 50 :REAFSNYAGKP T0379 55 :SEEEFRTELSRYIGKELT 1x42A 67 :IEEEVMRKLAEKYGFKYP T0379 73 :YQQVYDALLGF 1x42A 88 :WEIHLRMHQRY T0379 85 :EEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRF 1x42A 99 :GELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLDALG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPA 1x42A 138 :IKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPV T0379 176 :NVATAERLGFHTYCPDNGENWIPAI 1x42A 185 :DCGGSKNLGMTSILLDRKGEKREFW T0379 201 :TRLLREQ 1x42A 223 :IKIVDEL Number of specific fragments extracted= 9 number of extra gaps= 0 total=669 Number of alignments=68 # 1x42A read from 1x42A/merged-good-all-a2m # found chain 1x42A in template set T0379 1 :MIRNIVFDLGGVLIHLNREESIRRFKAIGVAD 1x42A 1 :MIRAVFFDFVGTLLSVEGEAKTHLKIMEEVLG T0379 33 :IEEMLDPYLQKGLFLDLESGRKSEEEFRTELSRY 1x42A 45 :YEKLTREAFSNYAGKPYRPIRDIEEEVMRKLAEK T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMS 1x42A 81 :FKYPENFWEIHLRMHQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLD T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGP 1x42A 135 :ALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNP T0379 175 :ANVATAERLGFHTYCPDNGENWIPAI 1x42A 184 :KDCGGSKNLGMTSILLDRKGEKREFW Number of specific fragments extracted= 5 number of extra gaps= 0 total=674 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b0cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b0cA expands to /projects/compbio/data/pdb/2b0c.pdb.gz 2b0cA:# T0379 read from 2b0cA/merged-good-all-a2m # 2b0cA read from 2b0cA/merged-good-all-a2m # adding 2b0cA to template set # found chain 2b0cA in template set Warning: unaligning (T0379)Q207 because last residue in template chain is (2b0cA)V204 T0379 3 :RNIVFDLGGVLIHLNRE 2b0cA 8 :MLYIFDLGNVIVDIDFN T0379 22 :IRRFKAIGVA 2b0cA 25 :RVLGAWSDLT T0379 34 :EEMLDPYLQKGLFLDLESGRK 2b0cA 35 :RIPLASLKKSFHMGEAFHQHE T0379 55 :SEEEFRTELSRYIGK 2b0cA 60 :SDEAFAEALCHEMAL T0379 70 :E 2b0cA 78 :Y T0379 75 :QVYDALLGFL 2b0cA 79 :EQFSHGWQAV T0379 85 :EEISAEKFDYIDSLRP 2b0cA 90 :VALRPEVIAIMHKLRE T0379 101 :DYRLFLLSNTNP 2b0cA 107 :GHRVVVLSNTNR T0379 119 :MSPRFLP 2b0cA 119 :LHTTFWP T0379 126 :SGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 2b0cA 127 :EYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTT T0379 200 :ITRLLRE 2b0cA 197 :IPDYFAK Number of specific fragments extracted= 11 number of extra gaps= 0 total=685 Number of alignments=70 # 2b0cA read from 2b0cA/merged-good-all-a2m # found chain 2b0cA in template set T0379 3 :RNIVFDLGGVLIHLNREESIRRFKAI 2b0cA 8 :MLYIFDLGNVIVDIDFNRVLGAWSDL T0379 29 :GVADIEEMLDPYLQ 2b0cA 35 :RIPLASLKKSFHMG T0379 44 :GLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 2b0cA 49 :EAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLR T0379 100 :PDYRLFLLSNTNP 2b0cA 106 :QGHRVVVLSNTNR T0379 119 :MSPRFLPSGR 2b0cA 119 :LHTTFWPEEY T0379 129 :TLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWI 2b0cA 130 :EIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIP T0379 202 :RLL 2b0cA 199 :DYF Number of specific fragments extracted= 7 number of extra gaps= 0 total=692 Number of alignments=71 # 2b0cA read from 2b0cA/merged-good-all-a2m # found chain 2b0cA in template set T0379 4 :NIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 2b0cA 9 :LYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLR T0379 100 :PDYRLFLLSNTNPYV 2b0cA 106 :QGHRVVVLSNTNRLH T0379 120 :SPRFLPSGRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAIT 2b0cA 121 :TTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFA Number of specific fragments extracted= 3 number of extra gaps= 0 total=695 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1swvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1swvA expands to /projects/compbio/data/pdb/1swv.pdb.gz 1swvA:# T0379 read from 1swvA/merged-good-all-a2m # 1swvA read from 1swvA/merged-good-all-a2m # adding 1swvA to template set # found chain 1swvA in template set T0379 2 :IRNIVFDLGGVLIHL 1swvA 6 :IEAVIFAWAGTTVDY T0379 17 :NREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEF 1swvA 22 :CFAPLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALTEMP T0379 60 :RTEL 1swvA 71 :NRVF T0379 64 :SRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRP 1swvA 81 :ADIQEMYEEFEEILFAILPRYASPINGVKEVIASLRE T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1swvA 119 :GIKIGSTTGYTREMMDIVAKEAA T0379 130 :LDSF 1swvA 142 :LQGY T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1swvA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 163 :KPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1swvA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELG T0379 200 :ITRLLRE 1swvA 226 :LREKIEV Number of specific fragments extracted= 9 number of extra gaps= 0 total=704 Number of alignments=73 # 1swvA read from 1swvA/merged-good-all-a2m # found chain 1swvA in template set T0379 2 :IRNIVFDLGGVLIHLN 1swvA 6 :IEAVIFAWAGTTVDYG T0379 18 :REESIRRFKAIGVADIEEMLDPYLQ 1swvA 26 :LEVFMEIFHKRGVAITAEEARKPMG T0379 44 :GLFLDLESGRKSEEEFRTELSRYIGKELTYQ 1swvA 51 :LLKIDHVRALTEMPRIASEWNRVFRQLPTEA T0379 75 :QVYDALLGFL 1swvA 85 :EMYEEFEEIL T0379 85 :EEISAEKFDYIDSLR 1swvA 102 :ASPINGVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1swvA 118 :RGIKIGSTTGYTREMMDIVAK T0379 121 :PRF 1swvA 142 :LQG T0379 130 :LD 1swvA 145 :YK T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1swvA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 163 :KPEETLFIDDGPANVATAERLGFHTYCPDNG 1swvA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILG Number of specific fragments extracted= 10 number of extra gaps= 0 total=714 Number of alignments=74 # 1swvA read from 1swvA/merged-good-all-a2m # found chain 1swvA in template set T0379 1 :MIRNIVFDLGGVLIHLN 1swvA 5 :KIEAVIFAWAGTTVDYG T0379 20 :ESIRRFKAIGVADIEEMLDPYLQ 1swvA 25 :PLEVFMEIFHKRGVAITAEEARK T0379 43 :KGLFLDLESGRKSEEEFRTELSRY 1swvA 54 :IDHVRALTEMPRIASEWNRVFRQL T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 1swvA 84 :QEMYEEFEEILFAILPRYASPINGVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1swvA 118 :RGIKIGSTTGYTREMMDIVAK T0379 127 :GRTLDSFF 1swvA 139 :EAALQGYK T0379 135 :DKVYASCQMGKYKPNEDIFLEMIADSGMKP 1swvA 148 :DFLVTPDDVPAGRPYPWMCYKNAMELGVYP T0379 165 :EETLFIDDGPANVATAERLGFHTYCPDNG 1swvA 179 :NHMIKVGDTVSDMKEGRNAGMWTVGVILG T0379 197 :IPAITRLLRE 1swvA 215 :EEEVENMDSV Number of specific fragments extracted= 9 number of extra gaps= 0 total=723 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jud/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jud expands to /projects/compbio/data/pdb/1jud.pdb.gz 1jud:Warning: there is no chain 1jud will retry with 1judA # T0379 read from 1jud/merged-good-all-a2m # 1jud read from 1jud/merged-good-all-a2m # adding 1jud to template set # found chain 1jud in template set Warning: unaligning (T0379)Q207 because last residue in template chain is (1jud)F222 T0379 2 :IRNIVFDLGGVLIHLNREESIRRFK 1jud 4 :IKGIAFDLYGTLFDVHSVVGRCDEA T0379 33 :IEEMLDPYLQKGLFLDLESGRKSEEEF 1jud 29 :FPGRGREISALWRQKQLEYTWLRSLMN T0379 60 :RTELSRYIGK 1jud 68 :LRFTCRHLGL T0379 70 :ELTYQQVYDALLGFL 1jud 80 :DARTRSTLCDAYLRL T0379 86 :EISAEKFDYIDSLRP 1jud 95 :APFSEVPDSLRELKR T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1jud 111 :GLKLAILSNGSPQSIDAVVSHAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1jud 134 :LRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRTGNVFE T0379 199 :AITRLLRE 1jud 214 :SLRAVVEL Number of specific fragments extracted= 8 number of extra gaps= 0 total=731 Number of alignments=76 # 1jud read from 1jud/merged-good-all-a2m # found chain 1jud in template set T0379 2 :IRNIVFDLGGVLIHLN 1jud 4 :IKGIAFDLYGTLFDVH T0379 18 :REESIRRFKAI 1jud 33 :GREISALWRQK T0379 44 :GLFLDLESGRK 1jud 47 :YTWLRSLMNRY T0379 55 :SEEEFRTELSRYIGKELTYQQ 1jud 63 :ATEDALRFTCRHLGLDLDART T0379 77 :YDALLGFL 1jud 84 :RSTLCDAY T0379 85 :EEISAEKFDYIDSLR 1jud 94 :LAPFSEVPDSLRELK T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1jud 110 :RGLKLAILSNGSPQSIDAVVSHAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1jud 134 :LRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRTGNVFEEM T0379 201 :TRLLREQK 1jud 215 :LRAVVELF Number of specific fragments extracted= 9 number of extra gaps= 0 total=740 Number of alignments=77 # 1jud read from 1jud/merged-good-all-a2m # found chain 1jud in template set T0379 1 :MIRNIVFDLGGVLIHLNREESIRR 1jud 3 :YIKGIAFDLYGTLFDVHSVVGRCD T0379 26 :KAIGVAD 1jud 27 :EAFPGRG T0379 33 :IEEMLDPYLQKGLFLDLESG 1jud 36 :ISALWRQKQLEYTWLRSLMN T0379 53 :RKSEEEFRTE 1jud 61 :QQATEDALRF T0379 67 :IGKELTYQQVYDA 1jud 78 :DLDARTRSTLCDA T0379 82 :GFLEEISAEKFDYIDSLR 1jud 91 :YLRLAPFSEVPDSLRELK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1jud 110 :RGLKLAILSNGSPQSIDAVVS T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1jud 131 :HAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRTGN Number of specific fragments extracted= 8 number of extra gaps= 0 total=748 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vjrA expands to /projects/compbio/data/pdb/1vjr.pdb.gz 1vjrA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 172, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 173, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 177, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 178, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 180, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 181, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 183, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 184, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 186, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 187, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 237, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 241, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 243, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 245, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 247, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 249, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 271, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 275, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 277, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 279, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 281, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 283, because occupancy 0.500 <= existing 0.500 in 1vjrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1601, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1605, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1607, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1609, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1611, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1613, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1616, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1620, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1622, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1624, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1626, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1628, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1630, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1632, because occupancy 0.500 <= existing 0.500 in 1vjrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1868, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1872, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1874, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1876, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1878, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1880, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1912, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1914, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1916, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1918, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1920, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1922, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1930, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1934, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1936, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1938, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1940, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1942, because occupancy 0.500 <= existing 0.500 in 1vjrA # T0379 read from 1vjrA/merged-good-all-a2m # 1vjrA read from 1vjrA/merged-good-all-a2m # adding 1vjrA to template set # found chain 1vjrA in template set T0379 2 :IRNIVFDLGGVLI 1vjrA 5 :IELFILDMDGTFY T0379 16 :LNRE 1vjrA 22 :LLPG T0379 21 :SIRRFKAIGVADIE 1vjrA 26 :SLEFLETLKEKNKR T0379 44 :GLFLDLESGRKSEEEF 1vjrA 47 :SSLGAQDYVRKLRNMG T0379 60 :RTELSRYIGK 1vjrA 78 :AEHMLKRFGR T0379 70 :ELTYQQVYDAL 1vjrA 95 :TPQLKKVFEAY T0379 84 :LEEISAEKFDYIDSLRP 1vjrA 122 :DKTLTYERLKKACILLR T0379 101 :DYRL 1vjrA 140 :GKFY T0379 106 :LLSNTNP 1vjrA 144 :IATHPDI T0379 113 :YVLDLAMSPRF 1vjrA 164 :SIMAAIEASTG T0379 130 :LD 1vjrA 175 :RK T0379 134 :FDKV 1vjrA 177 :PDLI T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGP 1vjrA 181 :AGKPNPLVVDVISEKFGVPKERMAMVGDRL T0379 175 :ANVATAERLGFHTYCPDNGENWIP 1vjrA 212 :TDVKLGKNAGIVSILVLTGETTPE T0379 199 :AITRLLRE 1vjrA 250 :NLGELAKA Number of specific fragments extracted= 15 number of extra gaps= 0 total=763 Number of alignments=79 # 1vjrA read from 1vjrA/merged-good-all-a2m # found chain 1vjrA in template set T0379 2 :IRNIVFDLGGVLIHLN 1vjrA 5 :IELFILDMDGTFYLDD T0379 18 :REESIRRFKAIGVADIEEMLDPY 1vjrA 26 :SLEFLETLKEKNKRFVFFTNNSS T0379 54 :KSEEEFRTELSR 1vjrA 49 :LGAQDYVRKLRN T0379 73 :YQQVYDALLGFL 1vjrA 95 :TPQLKKVFEAYG T0379 85 :EEISAEKFDYIDSLR 1vjrA 123 :KTLTYERLKKACILL T0379 100 :PDYR 1vjrA 139 :KGKF T0379 105 :FLLSN 1vjrA 143 :YIATH T0379 110 :TNPYVLDLAMSPRF 1vjrA 161 :DAGSIMAAIEASTG T0379 130 :LD 1vjrA 175 :RK T0379 134 :FDKVY 1vjrA 177 :PDLIA T0379 146 :YKPNEDIFLEMIADSGMKPEETLFIDDGPA 1vjrA 182 :GKPNPLVVDVISEKFGVPKERMAMVGDRLY T0379 176 :NVATAERLGFHTYCPDNGENWIPAI 1vjrA 213 :DVKLGKNAGIVSILVLTGETTPEDL T0379 201 :TRLLRE 1vjrA 248 :FKNLGE Number of specific fragments extracted= 13 number of extra gaps= 0 total=776 Number of alignments=80 # 1vjrA read from 1vjrA/merged-good-all-a2m # found chain 1vjrA in template set T0379 2 :IRNIVFDLGGVLIH 1vjrA 5 :IELFILDMDGTFYL T0379 84 :LEEISAEKFDYIDSLR 1vjrA 19 :DDSLLPGSLEFLETLK T0379 100 :PDYRLFLLSN 1vjrA 36 :KNKRFVFFTN T0379 110 :TNPYVLDLAMS 1vjrA 49 :LGAQDYVRKLR T0379 127 :GRTLD 1vjrA 60 :NMGVD T0379 134 :F 1vjrA 65 :V T0379 135 :DKVYASCQMG 1vjrA 68 :DAVVTSGEIT T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGP 1vjrA 181 :AGKPNPLVVDVISEKFGVPKERMAMVGDRL T0379 175 :ANVATAERLGFHTYCPDNGENWIPAITRL 1vjrA 212 :TDVKLGKNAGIVSILVLTGETTPEDLERA Number of specific fragments extracted= 9 number of extra gaps= 0 total=785 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zrn/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zrn expands to /projects/compbio/data/pdb/1zrn.pdb.gz 1zrn:Warning: there is no chain 1zrn will retry with 1zrnA # T0379 read from 1zrn/merged-good-all-a2m # 1zrn read from 1zrn/merged-good-all-a2m # adding 1zrn to template set # found chain 1zrn in template set T0379 2 :IRNIVFDLGGVLIHLNRE 1zrn 4 :IKGIAFDLYGTLFDVHSV T0379 20 :ESIRRFKAIGV 1zrn 33 :GREISALWRQK T0379 36 :MLDPYLQKGLFLDLESGRKSEEEFRTELSRYIGK 1zrn 44 :QLEYTWLRSLMNRYVNFQQATEDALRFTCRHLGL T0379 70 :ELTYQQVYDALLGFL 1zrn 80 :DARTRSTLCDAYLRL T0379 86 :EISAEKFDYIDSLRP 1zrn 95 :APFSEVPDSLRELKR T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1zrn 111 :GLKLAILSNGSPQSIDAVVSHAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1zrn 134 :LRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVASNAWDATGARYFGFPTCWINRTGNVFE T0379 199 :AITRLLRE 1zrn 214 :SLRAVVEL Number of specific fragments extracted= 8 number of extra gaps= 0 total=793 Number of alignments=82 # 1zrn read from 1zrn/merged-good-all-a2m # found chain 1zrn in template set T0379 2 :IRNIVFDLGGVLIHLN 1zrn 4 :IKGIAFDLYGTLFDVH T0379 18 :REESIRRFKAI 1zrn 33 :GREISALWRQK T0379 44 :GLFLDLESGRK 1zrn 47 :YTWLRSLMNRY T0379 55 :SEEEFRTELSRYIGKELTYQQ 1zrn 63 :ATEDALRFTCRHLGLDLDART T0379 77 :YDALLGFL 1zrn 84 :RSTLCDAY T0379 85 :EEISAEKFDYIDSLR 1zrn 94 :LAPFSEVPDSLRELK T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1zrn 110 :RGLKLAILSNGSPQSIDAVVSHAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1zrn 134 :LRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVASNAWDATGARYFGFPTCWINRTGNVFEEM T0379 201 :TRLLREQ 1zrn 215 :LRAVVEL Number of specific fragments extracted= 9 number of extra gaps= 0 total=802 Number of alignments=83 # 1zrn read from 1zrn/merged-good-all-a2m # found chain 1zrn in template set T0379 1 :MIRNIVFDLGGVLIHLNREESIRRFKAIGVAD 1zrn 3 :YIKGIAFDLYGTLFDVHSVVGRCDEAFPGRGR T0379 33 :IEEMLDPYLQKGLFLDLES 1zrn 36 :ISALWRQKQLEYTWLRSLM T0379 52 :GRKSEEEFRTELSRY 1zrn 60 :FQQATEDALRFTCRH T0379 67 :IGKELTYQQVYDA 1zrn 78 :DLDARTRSTLCDA T0379 82 :GFLEEISAEKFDYIDSLR 1zrn 91 :YLRLAPFSEVPDSLRELK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1zrn 110 :RGLKLAILSNGSPQSIDAVVS T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1zrn 131 :HAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVASNAWDATGARYFGFPTCWINRTGN Number of specific fragments extracted= 7 number of extra gaps= 0 total=809 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pw5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0379/1pw5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0379/1pw5A/merged-good-all-a2m.gz for input Trying 1pw5A/merged-good-all-a2m Error: Couldn't open file 1pw5A/merged-good-all-a2m or 1pw5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u7pA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1u7pA expands to /projects/compbio/data/pdb/1u7p.pdb.gz 1u7pA:# T0379 read from 1u7pA/merged-good-all-a2m # 1u7pA read from 1u7pA/merged-good-all-a2m # adding 1u7pA to template set # found chain 1u7pA in template set T0379 1 :M 1u7pA 1 :M T0379 2 :IRNIVFDLGGVLIHLNR 1u7pA 5 :PKLAVFDLDYTLWPFWV T0379 30 :VADIEEM 1u7pA 22 :DTHVDPP T0379 61 :T 1u7pA 35 :G T0379 82 :GFL 1u7pA 40 :RRG T0379 85 :EEISAEKFDYIDSLRP 1u7pA 45 :IQLYPEVPEVLGRLQS T0379 101 :DYRLFLLSN 1u7pA 62 :GVPVAAASR T0379 110 :TNPYVLDLAMSPRF 1u7pA 72 :SEIQGANQLLELFD T0379 130 :LDSFFDKVYA 1u7pA 86 :LGKYFIQREI T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1u7pA 96 :YPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDG T0379 195 :NWIPAITRLLRE 1u7pA 145 :MSLQTLTQGLET Number of specific fragments extracted= 11 number of extra gaps= 0 total=820 Number of alignments=85 # 1u7pA read from 1u7pA/merged-good-all-a2m # found chain 1u7pA in template set T0379 1 :M 1u7pA 1 :M T0379 2 :IRNIVFDLGGVLIHLN 1u7pA 5 :PKLAVFDLDYTLWPFW T0379 30 :VADIE 1u7pA 29 :FHKSS T0379 44 :GLFLDLESGRK 1u7pA 34 :DGTVRDRRGQN T0379 85 :EEISAEKFDYIDSLR 1u7pA 45 :IQLYPEVPEVLGRLQ T0379 100 :PDYRLFLLSN 1u7pA 61 :LGVPVAAASR T0379 110 :TNPYVLDLAMSPRF 1u7pA 72 :SEIQGANQLLELFD T0379 130 :LDSFFDKVYA 1u7pA 86 :LGKYFIQREI T0379 143 :MGKYK 1u7pA 96 :YPGSK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1u7pA 101 :VTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDG T0379 195 :NWIPAI 1u7pA 145 :MSLQTL Number of specific fragments extracted= 11 number of extra gaps= 0 total=831 Number of alignments=86 # 1u7pA read from 1u7pA/merged-good-all-a2m # found chain 1u7pA in template set T0379 2 :IRNIVFDLGGVLIHLNRE 1u7pA 5 :PKLAVFDLDYTLWPFWVD T0379 65 :RY 1u7pA 23 :TH T0379 85 :EEISAEKFDYIDSLR 1u7pA 45 :IQLYPEVPEVLGRLQ T0379 100 :PDYRLFLLSN 1u7pA 61 :LGVPVAAASR T0379 110 :TNPYVLDLAMS 1u7pA 72 :SEIQGANQLLE T0379 127 :GRTLDSFFDKVYA 1u7pA 83 :LFDLGKYFIQREI T0379 145 :KYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1u7pA 96 :YPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDG T0379 194 :ENWIP 1u7pA 151 :TQGLE Number of specific fragments extracted= 8 number of extra gaps= 0 total=839 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rkuA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1rkuA/merged-good-all-a2m # 1rkuA read from 1rkuA/merged-good-all-a2m # found chain 1rkuA in training set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rkuA)D7 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rkuA)D7 T0379 1 :M 1rkuA 1 :M T0379 3 :RNIV 1rkuA 2 :EIAC T0379 9 :LGGVLIH 1rkuA 8 :LEGVLVP T0379 22 :IRRFKAIGVADIEEMLDP 1rkuA 15 :EIWIAFAEKTGIDALKAT T0379 42 :QKGLFLDLESGRKSEEEFRTELSRYIG 1rkuA 33 :TRDIPDYDVLMKQRLRILDEHGLKLGD T0379 77 :YDALLGFL 1rkuA 60 :IQEVIATL T0379 86 :EISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRFL 1rkuA 68 :KPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGF T0379 130 :LD 1rkuA 107 :PT T0379 137 :VYAS 1rkuA 109 :LLCH T0379 145 :KYK 1rkuA 128 :RQK T0379 151 :DIFLEMIADS 1rkuA 131 :DPKRQSVIAF T0379 161 :GM 1rkuA 144 :YY T0379 166 :ETLFIDDGPANVATAERLG 1rkuA 146 :RVIAAGDSYNDTTMLSEAH T0379 186 :HTYCPDNGENWIP 1rkuA 165 :AGILFHAPENVIR T0379 200 :ITRLLR 1rkuA 188 :YEDLKR Number of specific fragments extracted= 15 number of extra gaps= 1 total=854 Number of alignments=88 # 1rkuA read from 1rkuA/merged-good-all-a2m # found chain 1rkuA in training set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rkuA)D7 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rkuA)D7 T0379 1 :M 1rkuA 1 :M T0379 3 :RNIV 1rkuA 2 :EIAC T0379 9 :LGGVLIHL 1rkuA 8 :LEGVLVPE T0379 21 :SIRRFKAI 1rkuA 16 :IWIAFAEK T0379 29 :GVADIEEM 1rkuA 25 :GIDALKAT T0379 50 :ESGRKSEEEFRTELSRYIG 1rkuA 33 :TRDIPDYDVLMKQRLRILD T0379 69 :KELTYQQVYDALLG 1rkuA 53 :HGLKLGDIQEVIAT T0379 85 :EEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMSPRF 1rkuA 67 :LKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLG T0379 130 :LDSFFDKVYASCQMG 1rkuA 106 :FPTLLCHKLEIDDSD T0379 145 :KYK 1rkuA 128 :RQK T0379 151 :DIFLEMIADS 1rkuA 131 :DPKRQSVIAF T0379 161 :GM 1rkuA 144 :YY T0379 166 :ETLFIDDGPANVATAERLG 1rkuA 146 :RVIAAGDSYNDTTMLSEAH T0379 186 :HTYCPDNGENWIPAI 1rkuA 165 :AGILFHAPENVIREF T0379 201 :TRLL 1rkuA 188 :YEDL Number of specific fragments extracted= 15 number of extra gaps= 1 total=869 Number of alignments=89 # 1rkuA read from 1rkuA/merged-good-all-a2m # found chain 1rkuA in training set Warning: unaligning (T0379)F7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rkuA)D7 Warning: unaligning (T0379)D8 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rkuA)D7 T0379 3 :RNIV 1rkuA 2 :EIAC T0379 9 :LGGVLIHLN 1rkuA 8 :LEGVLVPEI T0379 24 :RFKAIGVADIEEMLDP 1rkuA 17 :WIAFAEKTGIDALKAT T0379 46 :FLDLESGRKSEEEFRTELSRYIGKELTYQQVY 1rkuA 33 :TRDIPDYDVLMKQRLRILDEHGLKLGDIQEVI T0379 83 :FLEEISAEKFDYIDSLRPDYRLFLLSNTNPYVLDLAMS 1rkuA 65 :ATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMR T0379 127 :GRTL 1rkuA 103 :QLGF T0379 145 :KYKPNEDIFLEMIA 1rkuA 129 :QKDPKRQSVIAFKS T0379 160 :SGM 1rkuA 143 :LYY T0379 166 :ETLFIDDGPANVATAERLG 1rkuA 146 :RVIAAGDSYNDTTMLSEAH T0379 186 :HTYCPDNGENWIPAITRL 1rkuA 165 :AGILFHAPENVIREFPQF Number of specific fragments extracted= 10 number of extra gaps= 1 total=879 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cr6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cr6A expands to /projects/compbio/data/pdb/1cr6.pdb.gz 1cr6A:# T0379 read from 1cr6A/merged-good-all-a2m # 1cr6A read from 1cr6A/merged-good-all-a2m # adding 1cr6A to template set # found chain 1cr6A in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cr6A)R4 Warning: unaligning (T0379)G68 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr6A)Q90 T0379 4 :NIVFDLGGVLI 1cr6A 5 :VAAFDLDGVLA T0379 69 :KELT 1cr6A 91 :IFSQ T0379 79 :A 1cr6A 95 :A T0379 81 :LGFL 1cr6A 96 :MAAR T0379 86 :EISAEKFDYIDSLRP 1cr6A 100 :SINRPMLQAAIALKK T0379 101 :DYRLFLLSN 1cr6A 116 :GFTTCIVTN T0379 110 :TNPYVLDLAMSP 1cr6A 131 :DKRDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1cr6A 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNT T0379 200 :ITRLLRE 1cr6A 207 :ASALREL Number of specific fragments extracted= 9 number of extra gaps= 0 total=888 Number of alignments=91 # 1cr6A read from 1cr6A/merged-good-all-a2m # found chain 1cr6A in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cr6A)R4 Warning: unaligning (T0379)E70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr6A)Q90 T0379 4 :NIVFDLGGVLIHLN 1cr6A 5 :VAAFDLDGVLALPS T0379 71 :LTYQQVYD 1cr6A 91 :IFSQAMAA T0379 85 :EEISAEKFDYIDSLR 1cr6A 99 :RSINRPMLQAAIALK T0379 100 :PDYRLFLLSN 1cr6A 115 :KGFTTCIVTN T0379 110 :TNPYVLDLAMSP 1cr6A 131 :DKRDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1cr6A 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASALREL Number of specific fragments extracted= 6 number of extra gaps= 0 total=894 Number of alignments=92 # 1cr6A read from 1cr6A/merged-good-all-a2m # found chain 1cr6A in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cr6A)R4 Warning: unaligning (T0379)R18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr6A)G48 Warning: unaligning (T0379)L47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr6A)G48 Warning: unaligning (T0379)E62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr6A)Q90 Warning: unaligning (T0379)G68 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr6A)Q90 T0379 4 :NIVFDLGGVLIHLN 1cr6A 5 :VAAFDLDGVLALPS T0379 48 :DLESGRKSEEEFRT 1cr6A 49 :PTEQLMKGKITFSQ T0379 69 :KELTYQ 1cr6A 91 :IFSQAM T0379 83 :FLEEISAEKFDYIDSLR 1cr6A 97 :AARSINRPMLQAAIALK T0379 100 :PDYRLFLLSN 1cr6A 115 :KGFTTCIVTN T0379 110 :TNPYVLDLAMS 1cr6A 131 :DKRDSLAQMMC T0379 129 :TLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1cr6A 142 :ELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNT T0379 194 :ENWIPAITRLLREQ 1cr6A 208 :SALRELEKVTGTQF Number of specific fragments extracted= 8 number of extra gaps= 0 total=902 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1te2A/merged-good-all-a2m # 1te2A read from 1te2A/merged-good-all-a2m # found chain 1te2A in training set Warning: unaligning (T0379)P121 because of BadResidue code BAD_PEPTIDE in next template residue (1te2A)F129 Warning: unaligning (T0379)R122 because of BadResidue code BAD_PEPTIDE at template residue (1te2A)F129 T0379 2 :IRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEM 1te2A 7 :ILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDIS T0379 37 :LDPYLQKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRP 1te2A 43 :RNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKE T0379 101 :DYRLFLLSNTNPYVLDLAMS 1te2A 108 :GLLVGLASASPLHMLEKVLT T0379 123 :F 1te2A 130 :D T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1te2A 131 :LRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQND T0379 200 :ITRLLR 1te2A 209 :LSSLTE Number of specific fragments extracted= 6 number of extra gaps= 1 total=908 Number of alignments=94 # 1te2A read from 1te2A/merged-good-all-a2m # found chain 1te2A in training set Warning: unaligning (T0379)P121 because of BadResidue code BAD_PEPTIDE in next template residue (1te2A)F129 Warning: unaligning (T0379)R122 because of BadResidue code BAD_PEPTIDE at template residue (1te2A)F129 T0379 2 :IRNIVFDLGGVLIHLN 1te2A 7 :ILAAIFDMDGLLIDSE T0379 18 :REESIRRFKAIGVADIEEMLDPY 1te2A 26 :DRAELDVMASLGVDISRRNELPD T0379 50 :ESGRKSEE 1te2A 49 :TLGLRIDM T0379 59 :FRTELSRYIG 1te2A 57 :VVDLWYARQP T0379 69 :KELTYQQVYDALLGFL 1te2A 68 :NGPSRQEVVERVIARA T0379 85 :EEISAEKFDYIDSLR 1te2A 91 :RPLLPGVREAVALCK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1te2A 107 :QGLLVGLASASPLHMLEKVLT T0379 123 :F 1te2A 130 :D T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPD 1te2A 131 :LRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVP T0379 192 :NGENWIPAI 1te2A 194 :PEAQNDPRF T0379 201 :TRLLREQK 1te2A 209 :LSSLTELT Number of specific fragments extracted= 11 number of extra gaps= 1 total=919 Number of alignments=95 # 1te2A read from 1te2A/merged-good-all-a2m # found chain 1te2A in training set Warning: unaligning (T0379)G127 because of BadResidue code BAD_PEPTIDE in next template residue (1te2A)F129 Warning: unaligning (T0379)R128 because of BadResidue code BAD_PEPTIDE at template residue (1te2A)F129 T0379 1 :MIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLD 1te2A 6 :QILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLR T0379 52 :GRKSEEEFRTELSRY 1te2A 54 :IDMVVDLWYARQPWN T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 1te2A 73 :QEVVERVIARAISLVEETRPLLPGVREAVALCK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1te2A 107 :QGLLVGLASASPLHMLEKVLT T0379 129 :TLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNG 1te2A 130 :DLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAP Number of specific fragments extracted= 5 number of extra gaps= 1 total=924 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fezA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fezA expands to /projects/compbio/data/pdb/1fez.pdb.gz 1fezA:# T0379 read from 1fezA/merged-good-all-a2m # 1fezA read from 1fezA/merged-good-all-a2m # adding 1fezA to template set # found chain 1fezA in template set T0379 2 :IRNIVFDLGGVLIHL 1fezA 6 :IEAVIFDWAGTTVDY T0379 17 :NREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEF 1fezA 22 :CFAPLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALTEMP T0379 60 :RTELSRYIGKELTYQQVYDALLGFLEEISAEKFDYIDSLRP 1fezA 77 :LPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRE T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1fezA 119 :GIKIGSTTGYTREMMDIVAKEAA T0379 130 :LDSF 1fezA 142 :LQGY T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1fezA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 163 :KPEETLFIDDGPANVATAERLGFHTYCPDNGENWIP 1fezA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELG T0379 199 :AITRLLREQ 1fezA 225 :ELREKIEVV Number of specific fragments extracted= 8 number of extra gaps= 0 total=932 Number of alignments=97 # 1fezA read from 1fezA/merged-good-all-a2m # found chain 1fezA in template set T0379 2 :IRNIVFDLGGVLIHLN 1fezA 6 :IEAVIFDWAGTTVDYG T0379 18 :REESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEE 1fezA 26 :LEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRALTEMPR T0379 59 :FRTELSRYIGKELT 1fezA 66 :IASEWNRVFRQLPT T0379 73 :YQQVYDALLGFL 1fezA 83 :IQEMYEEFEEIL T0379 85 :EEISAEKFDYIDSLR 1fezA 102 :ASPINAVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1fezA 118 :RGIKIGSTTGYTREMMDIVAK T0379 121 :PRF 1fezA 142 :LQG T0379 130 :LD 1fezA 145 :YK T0379 134 :FDKVYASCQMGKYKPNEDIFLEMIADSGM 1fezA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0379 163 :KPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 1fezA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGLT T0379 201 :TRL 1fezA 230 :IEV Number of specific fragments extracted= 11 number of extra gaps= 0 total=943 Number of alignments=98 # 1fezA read from 1fezA/merged-good-all-a2m # found chain 1fezA in template set T0379 1 :MIRNIVFDLGGVLIHLN 1fezA 5 :KIEAVIFDWAGTTVDYG T0379 18 :REESIRRFKAIGVADIEEMLDPYLQ 1fezA 23 :FAPLEVFMEIFHKRGVAITAEEARK T0379 43 :KGLFLDLESGRKSEEEFRTELSRY 1fezA 54 :IDHVRALTEMPRIASEWNRVFRQL T0379 67 :IGKELTYQQVYDALLGFLEEISAEKFDYIDSLR 1fezA 84 :QEMYEEFEEILFAILPRYASPINAVKEVIASLR T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1fezA 118 :RGIKIGSTTGYTREMMDIVAK T0379 127 :GRTLDSFF 1fezA 139 :EAALQGYK T0379 135 :DKVYASCQMGKYKPNEDIFLEMIADSGMKP 1fezA 148 :DFLVTPDDVPAGRPYPWMCYKNAMELGVYP T0379 165 :EETLFIDDGPANVATAERLGFHTYCPD 1fezA 179 :NHMIKVGDTVSDMKEGRNAGMWTVGVI Number of specific fragments extracted= 8 number of extra gaps= 0 total=951 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cr6B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cr6B expands to /projects/compbio/data/pdb/1cr6.pdb.gz 1cr6B:# T0379 read from 1cr6B/merged-good-all-a2m # 1cr6B read from 1cr6B/merged-good-all-a2m # adding 1cr6B to template set # found chain 1cr6B in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cr6B)R4 T0379 4 :NIVFDLGGVLI 1cr6B 5 :VAAFDLDGVLA T0379 17 :NREESIRRFKAIGVA 1cr6B 16 :LPSIAGAFRRSEEAL T0379 32 :DIEEMLDPYL 1cr6B 45 :FPEGPTEQLM T0379 43 :KGLFLDLESGRKSEEEFRTEL 1cr6B 55 :KGKITFSQWVPLMDESYRKSS T0379 73 :YQQVYDALLGFL 1cr6B 88 :ISQIFSQAMAAR T0379 86 :EISAEKFDYIDSLRP 1cr6B 100 :SINRPMLQAAIALKK T0379 101 :DYRLFLLSNTN 1cr6B 116 :GFTTCIVTNNW T0379 112 :PYVLDLAMSP 1cr6B 133 :RDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENW 1cr6B 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASA Number of specific fragments extracted= 9 number of extra gaps= 0 total=960 Number of alignments=100 # 1cr6B read from 1cr6B/merged-good-all-a2m # found chain 1cr6B in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cr6B)R4 T0379 4 :NIVFDLGGVLIHLNREESIRRFKAI 1cr6B 5 :VAAFDLDGVLALPSIAGAFRRSEEA T0379 29 :GVADIEEMLDPYLQ 1cr6B 31 :ALPRDFLLGAYQTE T0379 43 :KGLFLDLESGRKSEEEFRTELSRYIG 1cr6B 47 :EGPTEQLMKGKITFSQWVPLMDESYR T0379 69 :KELT 1cr6B 80 :ANLP T0379 73 :YQQVYDALLG 1cr6B 89 :SQIFSQAMAA T0379 85 :EEISAEKFDYIDSLR 1cr6B 99 :RSINRPMLQAAIALK T0379 100 :PDYRLFLLSN 1cr6B 115 :KGFTTCIVTN T0379 112 :PYVLDLAMSP 1cr6B 133 :RDSLAQMMCE T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENWIPA 1cr6B 143 :LSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASALRE Number of specific fragments extracted= 9 number of extra gaps= 0 total=969 Number of alignments=101 # 1cr6B read from 1cr6B/merged-good-all-a2m # found chain 1cr6B in template set Warning: unaligning (T0379)R3 because first residue in template chain is (1cr6B)R4 T0379 4 :NIVFDLGGVLIHLNRE 1cr6B 5 :VAAFDLDGVLALPSIA T0379 22 :IRRFKAIGVADIEEM 1cr6B 21 :GAFRRSEEALALPRD T0379 39 :PYLQKGLFLDLESGRKSEEEFRTELSRY 1cr6B 47 :EGPTEQLMKGKITFSQWVPLMDESYRKS T0379 67 :IGKELTYQQVYDALLGF 1cr6B 82 :LPENFSISQIFSQAMAA T0379 85 :EEISAEKFDYIDSLR 1cr6B 99 :RSINRPMLQAAIALK T0379 100 :PDYRLFLLSNTN 1cr6B 115 :KGFTTCIVTNNW T0379 112 :PYVLDLAMS 1cr6B 133 :RDSLAQMMC T0379 129 :TLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGE 1cr6B 142 :ELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTA Number of specific fragments extracted= 8 number of extra gaps= 0 total=977 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l7pA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l7pA expands to /projects/compbio/data/pdb/1l7p.pdb.gz 1l7pA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0379 read from 1l7pA/merged-good-all-a2m # 1l7pA read from 1l7pA/merged-good-all-a2m # adding 1l7pA to template set # found chain 1l7pA in template set T0379 2 :IRNIVFDLGGVLIHLNR 1l7pA 5 :KKLILFNFDSTLVNNET T0379 24 :RFKAIGVADIEEMLDPYLQKG 1l7pA 22 :IDEIAREAGVEEEVKKITKEA T0379 45 :LFLDLESGRKSEEEFRTELSRY 1l7pA 46 :KLNFEQSLRKRVSLLKDLPIEK T0379 77 :YDALLGFL 1l7pA 68 :VEKAIKRI T0379 86 :EISAEKFDYIDSLRP 1l7pA 76 :TPTEGAEETIKELKN T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1l7pA 92 :GYVVAVVSGGFDIAVNKIKEKLG T0379 134 :FDKVYAS 1l7pA 115 :LDYAFAN T0379 141 :CQMGKY 1l7pA 136 :GEVLKE T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1l7pA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPD 1l7pA 180 :LKIAFC Number of specific fragments extracted= 10 number of extra gaps= 0 total=987 Number of alignments=103 # 1l7pA read from 1l7pA/merged-good-all-a2m # found chain 1l7pA in template set T0379 2 :IRNIVFDLGGVLIHLN 1l7pA 5 :KKLILFNFDSTLVNNE T0379 20 :ESIRRFKAIGV 1l7pA 21 :TIDEIAREAGV T0379 31 :ADIE 1l7pA 33 :EEVK T0379 44 :GLFLDLESGRKSEEEFRTELSRYIG 1l7pA 37 :KITKEAMEGKLNFEQSLRKRVSLLK T0379 70 :ELTYQQVYDALLG 1l7pA 62 :DLPIEKVEKAIKR T0379 85 :EEISAEKFDYIDSLR 1l7pA 75 :ITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1l7pA 91 :RGYVVAVVSGGFDIAVNKIKEKLG T0379 130 :LDSFFDKVYASCQMG 1l7pA 115 :LDYAFANRLIVKDGK T0379 145 :KYK 1l7pA 142 :NAK T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1l7pA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCP 1l7pA 180 :LKIAF T0379 192 :NGE 1l7pA 185 :CAK T0379 202 :RLLRE 1l7pA 188 :PILKE Number of specific fragments extracted= 13 number of extra gaps= 0 total=1000 Number of alignments=104 # 1l7pA read from 1l7pA/merged-good-all-a2m # found chain 1l7pA in template set T0379 1 :MIRNIVFDLGGVLIHLNRE 1l7pA 4 :KKKLILFNFDSTLVNNETI T0379 25 :FKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRT 1l7pA 23 :DEIAREAGVEEEVKKITKEAMEGKLNFEQSLRKRVSL T0379 66 :Y 1l7pA 60 :L T0379 67 :IGKELTYQQVYD 1l7pA 62 :DLPIEKVEKAIK T0379 84 :LEEISAEKFDYIDSLR 1l7pA 74 :RITPTEGAEETIKELK T0379 100 :PDYRLFLLSNTNPYVLDLAMS 1l7pA 91 :RGYVVAVVSGGFDIAVNKIKE T0379 127 :GRTL 1l7pA 112 :KLGL T0379 135 :DKVYA 1l7pA 116 :DYAFA T0379 150 :EDIFLEMIADSGMKPEETLFIDDGPANVATAERLG 1l7pA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0379 186 :HTYCPD 1l7pA 180 :LKIAFC T0379 196 :WIPAITRL 1l7pA 186 :AKPILKEK Number of specific fragments extracted= 11 number of extra gaps= 0 total=1011 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1qq5A/merged-good-all-a2m # 1qq5A read from 1qq5A/merged-good-all-a2m # found chain 1qq5A in training set T0379 1 :MIRNIVFDLGGVLIH 1qq5A 1 :MIKAVVFDAYGTLFD T0379 18 :REESIRRFKA 1qq5A 32 :EYITQVWRQK T0379 36 :MLDPYLQKGLFLDLESGRKSEEEFRTELSRYIGK 1qq5A 42 :QLEYSWLRALMGRYADFWSVTREALAYTLGTLGL T0379 70 :ELT 1qq5A 79 :ESF T0379 77 :YDALLGFL 1qq5A 82 :LADMAQAY T0379 85 :EEISAEKFDYIDSLR 1qq5A 92 :LTPYPDAAQCLAELA T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1qq5A 107 :PLKRAILSNGAPDMLQALVANAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1qq5A 130 :LTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=1019 Number of alignments=106 # 1qq5A read from 1qq5A/merged-good-all-a2m # found chain 1qq5A in training set T0379 1 :MIRNIVFDLGGVLIHLN 1qq5A 1 :MIKAVVFDAYGTLFDVQ T0379 18 :REESIRRFKA 1qq5A 35 :TQVWRQKQLE T0379 44 :GLFLDLESGRKSE 1qq5A 45 :YSWLRALMGRYAD T0379 57 :EEFRTELSRYIGKELTYQQVYDALLGFL 1qq5A 63 :REALAYTLGTLGLEPDESFLADMAQAYN T0379 85 :EEISAEKFDYIDSL 1qq5A 92 :LTPYPDAAQCLAEL T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1qq5A 106 :APLKRAILSNGAPDMLQALVANAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1qq5A 130 :LTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=1026 Number of alignments=107 # 1qq5A read from 1qq5A/merged-good-all-a2m # found chain 1qq5A in training set T0379 1 :MIRNIVFDLGGVLIHLNRE 1qq5A 1 :MIKAVVFDAYGTLFDVQSV T0379 22 :IRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEE 1qq5A 20 :ADATERAYPGRGEYITQVWRQKQLEYSWLRALMGRYA T0379 63 :LSRY 1qq5A 57 :DFWS T0379 67 :IGKELTYQQVYDA 1qq5A 76 :EPDESFLADMAQA T0379 82 :GFLEEISAEKFDYIDSLR 1qq5A 89 :YNRLTPYPDAAQCLAELA T0379 101 :DYRLFLLSNTNPYVLDLAMS 1qq5A 107 :PLKRAILSNGAPDMLQALVA T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1qq5A 127 :NAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=1033 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fi1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fi1A expands to /projects/compbio/data/pdb/2fi1.pdb.gz 2fi1A:# T0379 read from 2fi1A/merged-good-all-a2m # 2fi1A read from 2fi1A/merged-good-all-a2m # adding 2fi1A to template set # found chain 2fi1A in template set T0379 1 :M 2fi1A 4 :M T0379 2 :IRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEF 2fi1A 6 :YHDYIWDLGGTLLDNYETSTAAFVETLALYGITQDHDSVYQALKVSTPFAIETFAPNL T0379 67 :IGKELTYQQVYDALLGFL 2fi1A 64 :ENFLEKYKENEARELEHP T0379 86 :EISAEKFDYIDSLRP 2fi1A 82 :ILFEGVSDLLEDISN T0379 101 :DYRLFLLSNTNPY 2fi1A 98 :GGRHFLVSHRNDQ T0379 115 :LDLAMSPRF 2fi1A 111 :VLEILEKTS T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMK 2fi1A 120 :IAAYFTEVVTSSSGFKRKPNPESMLYLREKYQIS T0379 166 :ETLFIDDGPANVATAERLGFHTYCPDN 2fi1A 154 :SGLVIGDRPIDIEAGQAAGLDTHLFTS T0379 200 :ITRLLRE 2fi1A 181 :IVNLRQV Number of specific fragments extracted= 9 number of extra gaps= 0 total=1042 Number of alignments=109 # 2fi1A read from 2fi1A/merged-good-all-a2m # found chain 2fi1A in template set T0379 1 :M 2fi1A 4 :M T0379 2 :IRNIVFDLGGVLIHLN 2fi1A 6 :YHDYIWDLGGTLLDNY T0379 18 :REESIRRFKAIGVADIE 2fi1A 25 :TAAFVETLALYGITQDH T0379 44 :GLFLDLES 2fi1A 42 :DSVYQALK T0379 54 :KSEEEFRTELSRYI 2fi1A 50 :VSTPFAIETFAPNL T0379 70 :ELTYQQVYDALLGFL 2fi1A 64 :ENFLEKYKENEAREL T0379 85 :EEISAEKFDYIDSLR 2fi1A 81 :PILFEGVSDLLEDIS T0379 100 :PDYRLFLLSNTNPY 2fi1A 97 :QGGRHFLVSHRNDQ T0379 115 :LDLAMSPRF 2fi1A 111 :VLEILEKTS T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGM 2fi1A 120 :IAAYFTEVVTSSSGFKRKPNPESMLYLREKYQI T0379 165 :EETLFIDDGPANVATAERLGFHTYCPDNGENW 2fi1A 153 :SSGLVIGDRPIDIEAGQAAGLDTHLFTSIVNL Number of specific fragments extracted= 11 number of extra gaps= 0 total=1053 Number of alignments=110 # 2fi1A read from 2fi1A/merged-good-all-a2m # found chain 2fi1A in template set T0379 1 :MIRNIVFDLGGVLIHLNREESIRRFKAIGVADIEEMLDPYLQKG 2fi1A 5 :KYHDYIWDLGGTLLDNYETSTAAFVETLALYGITQDHDSVYQAL T0379 53 :RKSEEEFRTELSRY 2fi1A 49 :KVSTPFAIETFAPN T0379 67 :IGKELTYQQVYDALLG 2fi1A 64 :ENFLEKYKENEARELE T0379 84 :LEEISAEKFDYIDSLR 2fi1A 80 :HPILFEGVSDLLEDIS T0379 100 :PDYRLFLLSNTNPYVLDLAMS 2fi1A 97 :QGGRHFLVSHRNDQVLEILEK T0379 128 :RTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGM 2fi1A 118 :TSIAAYFTEVVTSSSGFKRKPNPESMLYLREKYQI T0379 165 :EETLFIDDGPANVATAERLGFHTYCPDNGENWIPAI 2fi1A 153 :SSGLVIGDRPIDIEAGQAAGLDTHLFTSIVNLRQVL Number of specific fragments extracted= 7 number of extra gaps= 0 total=1060 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0379 read from 1q92A/merged-good-all-a2m # 1q92A read from 1q92A/merged-good-all-a2m # found chain 1q92A in training set Warning: unaligning (T0379)A27 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F61 Warning: unaligning (T0379)I28 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F61 Warning: unaligning (T0379)L37 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)E70 Warning: unaligning (T0379)D38 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)E70 Warning: unaligning (T0379)G44 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)G74 Warning: unaligning (T0379)L45 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)G74 Warning: unaligning (T0379)R53 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)R83 Warning: unaligning (T0379)K54 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)R83 Warning: unaligning (T0379)S88 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)P109 Warning: unaligning (T0379)A89 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)P109 Warning: unaligning (T0379)L98 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A119 Warning: unaligning (T0379)R99 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A119 Warning: unaligning (T0379)R122 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F151 Warning: unaligning (T0379)F123 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F151 Warning: unaligning (T0379)F185 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)E190 Warning: unaligning (T0379)H186 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)E190 Warning: unaligning (T0379)D191 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A196 T0379 4 :NIVFDLGGVLIHLNREESIRRFK 1q92A 37 :RVLVDMDGVLADFEGGFLRKFRA T0379 29 :GVADI 1q92A 62 :PDQPF T0379 34 :E 1q92A 68 :A T0379 39 :P 1q92A 71 :D T0379 43 :K 1q92A 72 :R T0379 46 :FLDLESG 1q92A 75 :FWVSEQY T0379 55 :SEEEFRTELSRYIGK 1q92A 84 :LRPGLSEKAISIWES T0379 80 :LLGF 1q92A 101 :FFFE T0379 85 :EEI 1q92A 105 :LEP T0379 90 :EKFDYIDS 1q92A 110 :GAVEAVKE T0379 100 :P 1q92A 120 :S T0379 101 :DYRLFLLSN 1q92A 123 :NTDVFICTS T0379 110 :TNPYVLDLAMSP 1q92A 138 :YCPYEKYAWVEK T0379 130 :LDSFFDKVYASCQMGKYKPN 1q92A 152 :GPDFLEQIVLTRDKTVVSAD T0379 168 :LFIDDGP 1q92A 172 :LLIDDRP T0379 184 :G 1q92A 188 :S T0379 187 :TYCP 1q92A 191 :HVLF T0379 192 :NGENWIP 1q92A 197 :CHNQHLQ T0379 199 :AITRLLR 1q92A 217 :DWKAILD Number of specific fragments extracted= 19 number of extra gaps= 9 total=1079 Number of alignments=112 # 1q92A read from 1q92A/merged-good-all-a2m # found chain 1q92A in training set Warning: unaligning (T0379)I28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F61 Warning: unaligning (T0379)E35 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)E70 Warning: unaligning (T0379)M36 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)E70 Warning: unaligning (T0379)P39 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)G74 Warning: unaligning (T0379)Y40 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)G74 Warning: unaligning (T0379)S64 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)R83 Warning: unaligning (T0379)R65 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)R83 Warning: unaligning (T0379)S88 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)P109 Warning: unaligning (T0379)A89 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)P109 Warning: unaligning (T0379)L98 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A119 Warning: unaligning (T0379)R99 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A119 Warning: unaligning (T0379)R122 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F151 Warning: unaligning (T0379)F123 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F151 Warning: unaligning (T0379)F185 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)E190 Warning: unaligning (T0379)H186 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)E190 Warning: unaligning (T0379)D191 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A196 Warning: unaligning (T0379)N192 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A196 T0379 4 :NIVFDLGGVLIHL 1q92A 37 :RVLVDMDGVLADF T0379 18 :REESIRRFKA 1q92A 50 :EGGFLRKFRA T0379 29 :GVADIE 1q92A 63 :DQPFIA T0379 37 :LD 1q92A 71 :DR T0379 41 :LQ 1q92A 75 :FW T0379 59 :FRTEL 1q92A 77 :VSEQY T0379 66 :YIG 1q92A 84 :LRP T0379 71 :LTYQQ 1q92A 87 :GLSEK T0379 80 :LLGFL 1q92A 92 :AISIW T0379 85 :EEI 1q92A 105 :LEP T0379 90 :EKFDYIDS 1q92A 110 :GAVEAVKE T0379 100 :PDYRLFLLSN 1q92A 122 :QNTDVFICTS T0379 110 :TNPYVLDLAMSP 1q92A 138 :YCPYEKYAWVEK T0379 130 :LDSFFDKVYASCQMGKYKPN 1q92A 152 :GPDFLEQIVLTRDKTVVSAD T0379 168 :LFIDDGPA 1q92A 172 :LLIDDRPD T0379 187 :TYCP 1q92A 191 :HVLF T0379 193 :GENWIPAI 1q92A 197 :CHNQHLQL Number of specific fragments extracted= 17 number of extra gaps= 9 total=1096 Number of alignments=113 # 1q92A read from 1q92A/merged-good-all-a2m # found chain 1q92A in training set Warning: unaligning (T0379)A27 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F61 Warning: unaligning (T0379)I28 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F61 Warning: unaligning (T0379)I33 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)E70 Warning: unaligning (T0379)E34 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)E70 Warning: unaligning (T0379)L37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)G74 Warning: unaligning (T0379)L45 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)R83 Warning: unaligning (T0379)F46 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)R83 Warning: unaligning (T0379)S88 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)P109 Warning: unaligning (T0379)A89 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)P109 Warning: unaligning (T0379)L98 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A119 Warning: unaligning (T0379)R99 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A119 Warning: unaligning (T0379)P125 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F151 Warning: unaligning (T0379)S126 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F151 Warning: unaligning (T0379)F185 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)E190 Warning: unaligning (T0379)H186 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)E190 Warning: unaligning (T0379)D191 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A196 Warning: unaligning (T0379)N192 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A196 T0379 4 :NIVFDLGGVLIHLNREESIRRFK 1q92A 37 :RVLVDMDGVLADFEGGFLRKFRA T0379 29 :GVAD 1q92A 62 :PDQP T0379 35 :EM 1q92A 71 :DR T0379 38 :DPYLQKG 1q92A 75 :FWVSEQY T0379 47 :LDLESGRKSEEEFRTEL 1q92A 84 :LRPGLSEKAISIWESKN T0379 81 :LGFLEEI 1q92A 101 :FFFELEP T0379 90 :EKFDYIDS 1q92A 110 :GAVEAVKE T0379 100 :PDYRLFLLSN 1q92A 122 :QNTDVFICTS T0379 110 :TNPYVLDLAMS 1q92A 138 :YCPYEKYAWVE T0379 124 :L 1q92A 149 :K T0379 127 :GRTLDSF 1q92A 152 :GPDFLEQ T0379 137 :VYASCQMGKYKPN 1q92A 159 :IVLTRDKTVVSAD T0379 168 :LFIDDGP 1q92A 172 :LLIDDRP T0379 184 :G 1q92A 188 :S T0379 187 :TYCP 1q92A 191 :HVLF Number of specific fragments extracted= 15 number of extra gaps= 9 total=1111 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ydfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0379/1ydfA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0379/1ydfA/merged-good-all-a2m.gz for input Trying 1ydfA/merged-good-all-a2m Error: Couldn't open file 1ydfA/merged-good-all-a2m or 1ydfA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qq7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qq7A expands to /projects/compbio/data/pdb/1qq7.pdb.gz 1qq7A:Bad short name: C2 for alphabet: pdb_atoms Bad short name: C1 for alphabet: pdb_atoms Bad short name: O1 for alphabet: pdb_atoms Bad short name: O2 for alphabet: pdb_atoms Skipped atom 191, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 193, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 195, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 197, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 199, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 201, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 203, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 763, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 765, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 882, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 884, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 886, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 888, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 890, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1206, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1208, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1459, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1461, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1619, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1621, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1623, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1625, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1627, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1629, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1631, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1633, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1635, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1637, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1639, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1641, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1643, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1645, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1647, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1649, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1651, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1653, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1655, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1657, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1659, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1661, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1663, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1665, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1667, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1669, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1671, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1673, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1675, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1677, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1679, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1681, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1683, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1685, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1687, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1689, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1691, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1693, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1695, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1697, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1699, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1701, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1703, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1705, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1707, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1709, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1748, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1750, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1752, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1754, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1789, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1791, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1793, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1816, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1818, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1820, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1822, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1824, because occupancy 0.500 <= existing 0.500 in 1qq7A # T0379 read from 1qq7A/merged-good-all-a2m # 1qq7A read from 1qq7A/merged-good-all-a2m # adding 1qq7A to template set # found chain 1qq7A in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qq7A)A9 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qq7A)A9 T0379 1 :MIRNIV 1qq7A 1 :MIKAVV T0379 10 :GGVLIHLN 1qq7A 10 :YGTLFDVQ T0379 18 :REESIRR 1qq7A 20 :ADATERA T0379 25 :FKAIGV 1qq7A 36 :QVWRQK T0379 36 :MLDPYLQKGLFLDLESGRKSEEEFRTELSRYIGK 1qq7A 42 :QLEYSWLRALMGRYADFWSVTREALAYTLGTLGL T0379 70 :E 1qq7A 79 :E T0379 75 :QVYDALLGFL 1qq7A 80 :SFLADMAQAY T0379 85 :EEISAEKFDYIDSLR 1qq7A 92 :LTPYPDAAQCLAELA T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1qq7A 107 :PLKRAILSNGAPDMLQALVANAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1qq7A 130 :LTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 10 number of extra gaps= 0 total=1121 Number of alignments=115 # 1qq7A read from 1qq7A/merged-good-all-a2m # found chain 1qq7A in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qq7A)A9 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qq7A)A9 T0379 1 :MIRNIV 1qq7A 1 :MIKAVV T0379 10 :GGVLIHLN 1qq7A 10 :YGTLFDVQ T0379 18 :REESIRRFKA 1qq7A 35 :TQVWRQKQLE T0379 44 :GLFLDLESGRK 1qq7A 45 :YSWLRALMGRY T0379 55 :SEEEFRTELSRYIGKELTYQQVYDALLGFL 1qq7A 61 :VTREALAYTLGTLGLEPDESFLADMAQAYN T0379 85 :EEISAEKFDYIDSL 1qq7A 92 :LTPYPDAAQCLAEL T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1qq7A 106 :APLKRAILSNGAPDMLQALVANAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1qq7A 130 :LTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=1129 Number of alignments=116 # 1qq7A read from 1qq7A/merged-good-all-a2m # found chain 1qq7A in template set Warning: unaligning (T0379)F7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qq7A)A9 Warning: unaligning (T0379)L9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qq7A)A9 T0379 1 :MIRNIV 1qq7A 1 :MIKAVV T0379 10 :GGVLIHLNRE 1qq7A 10 :YGTLFDVQSV T0379 22 :IRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSEEEFRTEL 1qq7A 20 :ADATERAYPGRGEYITQVWRQKQLEYSWLRALMGRYADFWSV T0379 67 :IGKELTY 1qq7A 76 :EPDESFL T0379 78 :DALLG 1qq7A 83 :ADMAQ T0379 83 :FLEEISAEKFDYIDSLR 1qq7A 90 :NRLTPYPDAAQCLAELA T0379 101 :DYRLFLLSNTNPYVLDLAMS 1qq7A 107 :PLKRAILSNGAPDMLQALVA T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1qq7A 127 :NAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=1137 Number of alignments=117 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aq6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1aq6A expands to /projects/compbio/data/pdb/1aq6.pdb.gz 1aq6A:# T0379 read from 1aq6A/merged-good-all-a2m # 1aq6A read from 1aq6A/merged-good-all-a2m # adding 1aq6A to template set # found chain 1aq6A in template set T0379 1 :MIRNIVFDLGGVLIHLN 1aq6A 1 :MIKAVVFDAYGTLFDVQ T0379 18 :REESIRR 1aq6A 20 :ADATERA T0379 33 :IEEMLDPYLQKGLFLDLESGRKSEEEF 1aq6A 27 :YPGRGEYITQVWRQKQLEYSWLRALMG T0379 60 :RTELSRYIGK 1aq6A 66 :LAYTLGTLGL T0379 70 :EL 1aq6A 79 :ES T0379 76 :VYDALLGFL 1aq6A 81 :FLADMAQAY T0379 85 :EEISAEKFDYIDSLR 1aq6A 92 :LTPYPDAAQCLAELA T0379 101 :DYRLFLLSNTNPYVLDLAMSPRF 1aq6A 107 :PLKRAILSNGAPDMLQALVANAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGENW 1aq6A 130 :LTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQE T0379 199 :AITRLLR 1aq6A 197 :ALARELV Number of specific fragments extracted= 10 number of extra gaps= 0 total=1147 Number of alignments=118 # 1aq6A read from 1aq6A/merged-good-all-a2m # found chain 1aq6A in template set T0379 1 :MIRNIVFDLGGVLIHLN 1aq6A 1 :MIKAVVFDAYGTLFDVQ T0379 18 :REESIRRFKA 1aq6A 35 :TQVWRQKQLE T0379 44 :GLFLDLESGRK 1aq6A 45 :YSWLRALMGRY T0379 55 :SEEEFRTELSRYIGKELTYQQVYDALLGF 1aq6A 61 :VTREALAYTLGTLGLEPDESFLADMAQAY T0379 85 :EEISAEKFDYIDSL 1aq6A 92 :LTPYPDAAQCLAEL T0379 100 :PDYRLFLLSNTNPYVLDLAMSPRF 1aq6A 106 :APLKRAILSNGAPDMLQALVANAG T0379 130 :LDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1aq6A 130 :LTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=1154 Number of alignments=119 # 1aq6A read from 1aq6A/merged-good-all-a2m # found chain 1aq6A in template set T0379 1 :MIRNIVFDLGGVLIHLNRE 1aq6A 1 :MIKAVVFDAYGTLFDVQSV T0379 22 :IRRFKAIGVADIEEMLDPYLQKGLFLDLESGRKSE 1aq6A 20 :ADATERAYPGRGEYITQVWRQKQLEYSWLRALMGR T0379 61 :TELSRY 1aq6A 55 :YADFWG T0379 67 :IGKELTYQQVYD 1aq6A 76 :EPDESFLADMAQ T0379 81 :LGFLEEISAEKFDYIDSLR 1aq6A 88 :AYNRLTPYPDAAQCLAELA T0379 101 :DYRLFLLSNTNPYVLDLAMS 1aq6A 107 :PLKRAILSNGAPDMLQALVA T0379 127 :GRTLDSFFDKVYASCQMGKYKPNEDIFLEMIADSGMKPEETLFIDDGPANVATAERLGFHTYCPDNGEN 1aq6A 127 :NAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=1161 Number of alignments=120 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mh9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1mh9A expands to /projects/compbio/data/pdb/1mh9.pdb.gz 1mh9A:# T0379 read from 1mh9A/merged-good-all-a2m # 1mh9A read from 1mh9A/merged-good-all-a2m # adding 1mh9A to template set # found chain 1mh9A in template set T0379 4 :NIVFDLGGVLIHLNREESIRRFKAIGVADI 1mh9A 37 :RVLVDMDGVLADFEGGFLRKFRARFPDQPF T0379 34 :E 1mh9A 68 :A T0379 37 :LDP 1mh9A 69 :LED T0379 43 :KGLFLDLESGRKSEEEFRTELSRYIGK 1mh9A 72 :RRGFWVSEQYGRLRPGLSEKAISIWES T0379 80 :LLGF 1mh9A 101 :FFFE T0379 85 :EEISAEKFDYIDSLRP 1mh9A 105 :LEPLPGAVEAVKEMAS T0379 101 :DYRLFLLSNTN 1mh9A 123 :NTDVFICTSPI T0379 112 :PYVLDLAMSPRF 1mh9A 140 :PYEKYAWVEKYF T0379 130 :LDSFFDKVYASCQMGKYKPN 1mh9A 152 :GPDFLEQIVLTRDKTVVSAD T0379 168 :LFIDDGP 1mh9A 172 :LLIDDRP T0379 184 :GFHTYCPD 1mh9A 188 :SWEHVLFT T0379 192 :NGENWIP 1mh9A 197 :CHNQHLQ T0379 199 :AITRLLR 1mh9A 217 :DWKAILD Number of specific fragments extracted= 13 number of extra gaps= 0 total=1174 Number of alignments=121 # 1mh9A read from 1mh9A/merged-good-all-a2m # found chain 1mh9A in template set T0379 4 :NIVFDLGGVLIHL 1mh9A 37 :RVLVDMDGVLADF T0379 18 :REESIRRFKAI 1mh9A 50 :EGGFLRKFRAR T0379 29 :GVADIEEMLDPYLQ 1mh9A 63 :DQPFIALEDRRGFW T0379 59 :FRTELSRYIG 1mh9A 77 :VSEQYGRLRP T0379 71 :LTYQQVYDALL 1mh9A 87 :GLSEKAISIWE T0379 85 :EEISAEKFDYIDSLR 1mh9A 105 :LEPLPGAVEAVKEMA T0379 100 :PDYRLFLLSNTN 1mh9A 122 :QNTDVFICTSPI T0379 112 :PYVLDLAMSPRF 1mh9A 140 :PYEKYAWVEKYF T0379 130 :LDSFFDKVYASCQMGKYKPN 1mh9A 152 :GPDFLEQIVLTRDKTVVSAD T0379 168 :LFIDDGPA 1mh9A 172 :LLIDDRPD T0379 185 :FHTYCPDNGENWIPAI 1mh9A 189 :WEHVLFTACHNQHLQL Number of specific fragments extracted= 11 number of extra gaps= 0 total=1185 Number of alignments=122 # 1mh9A read from 1mh9A/merged-good-all-a2m # found chain 1mh9A in template set T0379 4 :NIVFDLGGVLIHLNREESIRRFKAIGVADIEEM 1mh9A 37 :RVLVDMDGVLADFEGGFLRKFRARFPDQPFIAL T0379 37 :LDPYLQKGLFLDLESGRKSEEEFRTEL 1mh9A 74 :GFWVSEQYGRLRPGLSEKAISIWESKN T0379 81 :LGFLEEISAEKFDYIDSLR 1mh9A 101 :FFFELEPLPGAVEAVKEMA T0379 100 :PDYRLFLLSNTN 1mh9A 122 :QNTDVFICTSPI T0379 112 :PYVLDLAMSPR 1mh9A 140 :PYEKYAWVEKY T0379 126 :SGRTLDSF 1mh9A 151 :FGPDFLEQ T0379 137 :VYASCQMGKYKPN 1mh9A 159 :IVLTRDKTVVSAD T0379 168 :LFIDDGP 1mh9A 172 :LLIDDRP T0379 184 :GFHTYCPDN 1mh9A 188 :SWEHVLFTA Number of specific fragments extracted= 9 number of extra gaps= 0 total=1194 Number of alignments=123 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0379//projects/compbio/experiments/protein-predict/casp7/T0379/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0379//projects/compbio/experiments/protein-predict/casp7/T0379/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0379/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0379/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0379)I170.CB, (T0379)Y188.CB) [> 2.7858 = 4.6430 < 6.0358] w=1.0000 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)T187.CB) [> 3.1257 = 5.2095 < 6.7723] w=1.0000 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)D172.CB) [> 3.0276 = 5.0460 < 6.5598] w=1.0000 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)D171.CB) [> 3.6081 = 6.0134 < 7.8174] w=1.0000 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)I170.CB) [> 3.5918 = 5.9864 < 7.7823] w=1.0000 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)D172.CB) [> 2.8637 = 4.7729 < 6.2047] w=1.0000 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)I170.CB) [> 4.2806 = 7.1343 < 9.2746] w=1.0000 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)F169.CB) [> 2.9061 = 4.8435 < 6.2966] w=1.0000 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)L168.CB) [> 4.1807 = 6.9678 < 9.0581] w=1.0000 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)L168.CB) [> 2.8889 = 4.8148 < 6.2592] w=1.0000 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)L168.CB) [> 4.3535 = 7.2558 < 9.4325] w=1.0000 to align # Constraint # added constraint: constraint((T0379)L168.CB, (T0379)Y188.CB) [> 3.7318 = 6.2196 < 8.0855] w=0.9917 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)Y188.CB) [> 4.1911 = 6.9851 < 9.0806] w=0.9917 to align # Constraint # added constraint: constraint((T0379)D171.CB, (T0379)C189.CB) [> 4.0905 = 6.8175 < 8.8627] w=0.9917 to align # Constraint # added constraint: constraint((T0379)D171.CB, (T0379)P190.CB) [> 4.1292 = 6.8819 < 8.9465] w=0.9917 to align # Constraint # added constraint: constraint((T0379)D172.CB, (T0379)P190.CB) [> 2.9999 = 4.9998 < 6.4998] w=0.9917 to align # Constraint # added constraint: constraint((T0379)D172.CB, (T0379)C189.CB) [> 4.2259 = 7.0431 < 9.1560] w=0.9834 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)P190.CB) [> 3.2597 = 5.4328 < 7.0627] w=0.9834 to align # Constraint # added constraint: constraint((T0379)L168.CB, (T0379)H186.CB) [> 2.7320 = 4.5533 < 5.9193] w=0.9754 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)I170.CB) [> 4.0283 = 6.7138 < 8.7279] w=0.9751 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)T167.CB) [> 3.6689 = 6.1149 < 7.9494] w=0.9729 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)T167.CB) [> 2.8397 = 4.7328 < 6.1527] w=0.9729 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)E166.CB) [> 3.8750 = 6.4583 < 8.3958] w=0.9729 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)H186.CB) [> 4.1439 = 6.9066 < 8.9785] w=0.9670 to align # Constraint # added constraint: constraint((T0379)I170.CB, (T0379)P190.CB) [> 3.4774 = 5.7958 < 7.5345] w=0.9668 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)A180.CB) [> 2.5576 = 4.2627 < 5.5415] w=0.9562 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)M156.CB) [> 3.6806 = 6.1343 < 7.9746] w=0.9562 to align # Constraint # added constraint: constraint((T0379)T167.CB, (T0379)H186.CB) [> 4.1446 = 6.9076 < 8.9799] w=0.9479 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)S160.CB) [> 3.3477 = 5.5795 < 7.2534] w=0.9313 to align # Constraint # added constraint: constraint((T0379)I95.CB, (T0379)L104.CB) [> 3.6386 = 6.0643 < 7.8836] w=0.9252 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)K91.CB) [> 3.1867 = 5.3111 < 6.9044] w=0.9252 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)F105.CB) [> 2.8334 = 4.7223 < 6.1390] w=0.9252 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)L104.CB) [> 3.3596 = 5.5993 < 7.2791] w=0.9252 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)R103.CB) [> 2.6439 = 4.4064 < 5.7284] w=0.9252 to align # Constraint # added constraint: constraint((T0379)G10.CA, (T0379)D172.CB) [> 4.3148 = 7.1913 < 9.3487] w=0.9252 to align # Constraint # added constraint: constraint((T0379)F153.CB, (T0379)L183.CB) [> 2.8775 = 4.7959 < 6.2347] w=0.9230 to align # Constraint # added constraint: constraint((T0379)F153.CB, (T0379)T179.CB) [> 3.5369 = 5.8949 < 7.6634] w=0.9230 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)T167.CB) [> 4.3673 = 7.2789 < 9.4625] w=0.9230 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)F105.CB) [> 3.9088 = 6.5147 < 8.4691] w=0.9169 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)F105.CB) [> 4.3659 = 7.2765 < 9.4594] w=0.9169 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)Y102.CB) [> 3.3837 = 5.6394 < 7.3313] w=0.9169 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)Y102.CB) [> 3.8490 = 6.4149 < 8.3394] w=0.9169 to align # Constraint # added constraint: constraint((T0379)D172.CB, (T0379)D191.CB) [> 4.1233 = 6.8722 < 8.9339] w=0.9089 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)L98.CB) [> 3.5201 = 5.8668 < 7.6269] w=0.9005 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)R103.CB) [> 4.4278 = 7.3797 < 9.5936] w=0.9002 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)L107.CB) [> 3.1351 = 5.2252 < 6.7928] w=0.9002 to align # Constraint # added constraint: constraint((T0379)D171.CB, (T0379)T187.CB) [> 4.4039 = 7.3398 < 9.5418] w=0.9002 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)M162.CB) [> 2.9363 = 4.8938 < 6.3619] w=0.8980 to align # Constraint # added constraint: constraint((T0379)G173.CA, (T0379)C189.CB) [> 4.2978 = 7.1630 < 9.3119] w=0.8836 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)L106.CB) [> 4.3123 = 7.1872 < 9.3434] w=0.8836 to align # Constraint # added constraint: constraint((T0379)I14.CB, (T0379)I87.CB) [> 3.7102 = 6.1837 < 8.0388] w=0.8836 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)M156.CB) [> 3.4951 = 5.8251 < 7.5726] w=0.8814 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)I87.CB) [> 3.9098 = 6.5163 < 8.4711] w=0.8753 to align # Constraint # added constraint: constraint((T0379)G10.CA, (T0379)S108.CB) [> 4.0896 = 6.8159 < 8.8607] w=0.8753 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)E166.CB) [> 2.7173 = 4.5288 < 5.8875] w=0.8648 to align # Constraint # added constraint: constraint((T0379)I157.CB, (T0379)T167.CB) [> 3.7752 = 6.2920 < 8.1796] w=0.8648 to align # Constraint # added constraint: constraint((T0379)L106.CB, (T0379)Y138.CB) [> 4.0014 = 6.6690 < 8.6697] w=0.8504 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)Y138.CB) [> 3.0330 = 5.0550 < 6.5715] w=0.8504 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)S108.CB) [> 2.5339 = 4.2232 < 5.4902] w=0.8503 to align # Constraint # added constraint: constraint((T0379)P164.CB, (T0379)G184.CA) [> 2.9912 = 4.9854 < 6.4810] w=0.8481 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)S88.CB) [> 3.7697 = 6.2829 < 8.1678] w=0.8423 to align # Constraint # added constraint: constraint((T0379)L106.CB, (T0379)V137.CB) [> 2.9247 = 4.8745 < 6.3369] w=0.8421 to align # Constraint # added constraint: constraint((T0379)V177.CB, (T0379)T187.CB) [> 2.9195 = 4.8659 < 6.3257] w=0.8399 to align # Constraint # added constraint: constraint((T0379)K147.CB, (T0379)N176.CB) [> 3.4616 = 5.7693 < 7.5001] w=0.8315 to align # Constraint # added constraint: constraint((T0379)R103.CB, (T0379)S160.CB) [> 3.3674 = 5.6123 < 7.2959] w=0.8315 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)I152.CB) [> 3.5338 = 5.8897 < 7.6566] w=0.8315 to align # Constraint # added constraint: constraint((T0379)L168.CB, (T0379)T187.CB) [> 4.4648 = 7.4413 < 9.6737] w=0.8257 to align # Constraint # added constraint: constraint((T0379)I14.CB, (T0379)E86.CB) [> 4.0132 = 6.6887 < 8.6954] w=0.8254 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)L106.CB) [> 3.5006 = 5.8344 < 7.5847] w=0.8254 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)L104.CB) [> 4.4263 = 7.3771 < 9.5903] w=0.8232 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)F185.CB) [> 2.9736 = 4.9559 < 6.4427] w=0.8174 to align # Constraint # added constraint: constraint((T0379)L168.CB, (T0379)F185.CB) [> 4.0570 = 6.7616 < 8.7901] w=0.8174 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)K136.CB) [> 2.7461 = 4.5769 < 5.9499] w=0.8164 to align # Constraint # added constraint: constraint((T0379)V177.CB, (T0379)C189.CB) [> 3.5066 = 5.8443 < 7.5975] w=0.8149 to align # Constraint # added constraint: constraint((T0379)T167.CB, (T0379)F185.CB) [> 2.8379 = 4.7299 < 6.1488] w=0.8149 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)T167.CB) [> 4.3764 = 7.2940 < 9.4822] w=0.8149 to align # Constraint # added constraint: constraint((T0379)I14.CB, (T0379)A118.CB) [> 3.9082 = 6.5137 < 8.4679] w=0.8088 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)Y138.CB) [> 4.3881 = 7.3135 < 9.5075] w=0.8088 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)V137.CB) [> 4.2785 = 7.1308 < 9.2700] w=0.8088 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)A139.CB) [> 3.4252 = 5.7087 < 7.4213] w=0.8088 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)Y138.CB) [> 3.9874 = 6.6456 < 8.6393] w=0.8005 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)D172.CB) [> 3.7742 = 6.2903 < 8.1774] w=0.8004 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)D171.CB) [> 2.4076 = 4.0126 < 5.2164] w=0.8004 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)I170.CB) [> 3.9653 = 6.6088 < 8.5914] w=0.8004 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)I170.CB) [> 3.1667 = 5.2779 < 6.8613] w=0.8004 to align # Constraint # added constraint: constraint((T0379)D171.CB, (T0379)A180.CB) [> 4.2113 = 7.0189 < 9.1246] w=0.7982 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)R103.CB) [> 4.0043 = 6.6739 < 8.6761] w=0.7899 to align # Constraint # added constraint: constraint((T0379)L106.CB, (T0379)K136.CB) [> 4.2655 = 7.1092 < 9.2419] w=0.7831 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)Y102.CB) [> 3.6819 = 6.1365 < 7.9775] w=0.7816 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)F134.CB) [> 3.6536 = 6.0894 < 7.9162] w=0.7734 to align # Constraint # added constraint: constraint((T0379)P164.CB, (T0379)L183.CB) [> 3.2889 = 5.4815 < 7.1260] w=0.7733 to align # Constraint # added constraint: constraint((T0379)E165.CB, (T0379)G184.CA) [> 3.7596 = 6.2660 < 8.1458] w=0.7733 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)N176.CB) [> 3.5797 = 5.9662 < 7.7560] w=0.7733 to align # Constraint # added constraint: constraint((T0379)H15.CB, (T0379)E86.CB) [> 3.4809 = 5.8015 < 7.5420] w=0.7672 to align # Constraint # added constraint: constraint((T0379)E150.CB, (T0379)L183.CB) [> 3.1325 = 5.2209 < 6.7871] w=0.7650 to align # Constraint # added constraint: constraint((T0379)P148.CB, (T0379)T179.CB) [> 2.7220 = 4.5367 < 5.8977] w=0.7567 to align # Constraint # added constraint: constraint((T0379)K147.CB, (T0379)T179.CB) [> 3.0563 = 5.0938 < 6.6219] w=0.7567 to align # Constraint # added constraint: constraint((T0379)M119.CB, (T0379)L130.CB) [> 3.0472 = 5.0786 < 6.6022] w=0.7491 to align # Constraint # added constraint: constraint((T0379)R103.CB, (T0379)D135.CB) [> 3.0618 = 5.1031 < 6.6340] w=0.7484 to align # Constraint # added constraint: constraint((T0379)I2.CB, (T0379)E166.CB) [> 3.6875 = 6.1458 < 7.9896] w=0.7483 to align # Constraint # added constraint: constraint((T0379)F153.CB, (T0379)F169.CB) [> 4.1953 = 6.9922 < 9.0899] w=0.7483 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)M162.CB) [> 3.2742 = 5.4570 < 7.0941] w=0.7483 to align # Constraint # added constraint: constraint((T0379)N109.CB, (T0379)S140.CB) [> 3.2066 = 5.3443 < 6.9476] w=0.7423 to align # Constraint # added constraint: constraint((T0379)F153.CB, (T0379)A180.CB) [> 3.7481 = 6.2469 < 8.1209] w=0.7401 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)D135.CB) [> 3.6496 = 6.0827 < 7.9075] w=0.7401 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)S140.CB) [> 4.2023 = 7.0038 < 9.1049] w=0.7401 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)L106.CB) [> 4.2293 = 7.0488 < 9.1634] w=0.7340 to align # Constraint # added constraint: constraint((T0379)P148.CB, (T0379)A175.CB) [> 3.2669 = 5.4449 < 7.0783] w=0.7318 to align # Constraint # added constraint: constraint((T0379)L104.CB, (T0379)D135.CB) [> 3.3231 = 5.5384 < 7.2000] w=0.7318 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)F105.CB) [> 4.2785 = 7.1308 < 9.2701] w=0.7256 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)L106.CB) [> 3.2252 = 5.3754 < 6.9880] w=0.7256 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)L107.CB) [> 3.9094 = 6.5156 < 8.4703] w=0.7256 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)S108.CB) [> 3.8082 = 6.3469 < 8.2510] w=0.7256 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)F169.CB) [> 4.6553 = 7.7588 < 10.0864] w=0.7256 to align # Constraint # added constraint: constraint((T0379)P164.CB, (T0379)F185.CB) [> 3.0813 = 5.1356 < 6.6762] w=0.7235 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)S160.CB) [> 3.8218 = 6.3697 < 8.2806] w=0.7234 to align # Constraint # added constraint: constraint((T0379)P148.CB, (T0379)A178.CB) [> 3.1782 = 5.2970 < 6.8861] w=0.7151 to align # Constraint # added constraint: constraint((T0379)L104.CB, (T0379)F134.CB) [> 3.0990 = 5.1649 < 6.7144] w=0.7151 to align # Constraint # added constraint: constraint((T0379)F153.CB, (T0379)F185.CB) [> 3.9628 = 6.6047 < 8.5861] w=0.7068 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)G173.CA) [> 4.4651 = 7.4418 < 9.6743] w=0.7006 to align # Constraint # added constraint: constraint((T0379)R103.CB, (T0379)M162.CB) [> 4.1716 = 6.9526 < 9.0384] w=0.6985 to align # Constraint # added constraint: constraint((T0379)D171.CB, (T0379)Y188.CB) [> 4.6181 = 7.6968 < 10.0058] w=0.6923 to align # Constraint # added constraint: constraint((T0379)I95.CB, (T0379)F133.CB) [> 3.0394 = 5.0656 < 6.5854] w=0.6819 to align # Constraint # added constraint: constraint((T0379)Y138.CB, (T0379)E155.CB) [> 3.5652 = 5.9421 < 7.7247] w=0.6819 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)L104.CB) [> 4.2686 = 7.1144 < 9.2487] w=0.6757 to align # Constraint # added constraint: constraint((T0379)K136.CB, (T0379)D159.CB) [> 3.3297 = 5.5495 < 7.2144] w=0.6736 to align # Constraint # added constraint: constraint((T0379)I170.CB, (T0379)T187.CB) [> 4.5393 = 7.5655 < 9.8351] w=0.6735 to align # Constraint # added constraint: constraint((T0379)I170.CB, (T0379)C189.CB) [> 4.5303 = 7.5505 < 9.8156] w=0.6652 to align # Constraint # added constraint: constraint((T0379)M119.CB, (T0379)D131.CB) [> 3.1956 = 5.3260 < 6.9238] w=0.6577 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)S88.CB) [> 4.2919 = 7.1532 < 9.2992] w=0.6511 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)S88.CB) [> 4.2865 = 7.1442 < 9.2875] w=0.6511 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)L115.CB) [> 3.8797 = 6.4661 < 8.4059] w=0.6508 to align # Constraint # added constraint: constraint((T0379)Y138.CB, (T0379)I152.CB) [> 3.4687 = 5.7811 < 7.5154] w=0.6486 to align # Constraint # added constraint: constraint((T0379)I2.CB, (T0379)L168.CB) [> 3.0533 = 5.0888 < 6.6154] w=0.6486 to align # Constraint # added constraint: constraint((T0379)T110.CB, (T0379)A139.CB) [> 3.3982 = 5.6637 < 7.3628] w=0.6428 to align # Constraint # added constraint: constraint((T0379)M143.CB, (T0379)I152.CB) [> 3.5464 = 5.9107 < 7.6839] w=0.6403 to align # Constraint # added constraint: constraint((T0379)I2.CB, (T0379)H186.CB) [> 4.1365 = 6.8942 < 8.9625] w=0.6403 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)F153.CB) [> 3.8953 = 6.4922 < 8.4399] w=0.6403 to align # Constraint # added constraint: constraint((T0379)P112.CB, (T0379)A139.CB) [> 3.0236 = 5.0393 < 6.5511] w=0.6342 to align # Constraint # added constraint: constraint((T0379)M119.CB, (T0379)V137.CB) [> 3.8329 = 6.3882 < 8.3046] w=0.6259 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)F169.CB) [> 4.4506 = 7.4177 < 9.6431] w=0.6258 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)L107.CB) [> 4.3754 = 7.2924 < 9.4801] w=0.6258 to align # Constraint # added constraint: constraint((T0379)I2.CB, (T0379)Y102.CB) [> 4.0510 = 6.7517 < 8.7772] w=0.6236 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)F185.CB) [> 4.3660 = 7.2767 < 9.4597] w=0.6179 to align # Constraint # added constraint: constraint((T0379)L115.CB, (T0379)V137.CB) [> 3.4841 = 5.8068 < 7.5488] w=0.6175 to align # Constraint # added constraint: constraint((T0379)L115.CB, (T0379)A139.CB) [> 3.3559 = 5.5932 < 7.2712] w=0.6175 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)A118.CB) [> 4.1350 = 6.8917 < 8.9592] w=0.6175 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)P190.CB) [> 4.3951 = 7.3252 < 9.5227] w=0.6175 to align # Constraint # added constraint: constraint((T0379)L104.CB, (T0379)F133.CB) [> 3.7983 = 6.3305 < 8.2297] w=0.6161 to align # Constraint # added constraint: constraint((T0379)S140.CB, (T0379)I152.CB) [> 3.6712 = 6.1186 < 7.9542] w=0.6153 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)T110.CB) [> 3.8347 = 6.3912 < 8.3085] w=0.6070 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)L106.CB) [> 4.4717 = 7.4528 < 9.6886] w=0.6009 to align # Constraint # added constraint: constraint((T0379)N149.CB, (T0379)T179.CB) [> 4.1222 = 6.8704 < 8.9315] w=0.5904 to align # Constraint # added constraint: constraint((T0379)F92.CB, (T0379)L130.CB) [> 4.1248 = 6.8746 < 8.9370] w=0.5821 to align # Constraint # added constraint: constraint((T0379)S120.CB, (T0379)D131.CB) [> 3.1319 = 5.2198 < 6.7857] w=0.5760 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)D171.CB) [> 4.5258 = 7.5429 < 9.8058] w=0.5759 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)L130.CB) [> 4.1632 = 6.9386 < 9.0202] w=0.5738 to align # Constraint # added constraint: constraint((T0379)D96.CB, (T0379)F133.CB) [> 4.0499 = 6.7498 < 8.7748] w=0.5738 to align # Constraint # added constraint: constraint((T0379)P148.CB, (T0379)N176.CB) [> 3.8967 = 6.4944 < 8.4428] w=0.5738 to align # Constraint # added constraint: constraint((T0379)L106.CB, (T0379)M119.CB) [> 4.1664 = 6.9441 < 9.0273] w=0.5676 to align # Constraint # added constraint: constraint((T0379)M156.CB, (T0379)T167.CB) [> 4.3924 = 7.3206 < 9.5168] w=0.5655 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)T179.CB) [> 3.6671 = 6.1118 < 7.9454] w=0.5571 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)V137.CB) [> 4.5125 = 7.5208 < 9.7770] w=0.5510 to align # Constraint # added constraint: constraint((T0379)I87.CB, (T0379)L130.CB) [> 4.0821 = 6.8036 < 8.8446] w=0.5405 to align # Constraint # added constraint: constraint((T0379)N111.CB, (T0379)C141.CB) [> 3.3314 = 5.5524 < 7.2181] w=0.5405 to align # Constraint # added constraint: constraint((T0379)H15.CB, (T0379)I87.CB) [> 4.4766 = 7.4610 < 9.6993] w=0.5344 to align # Constraint # added constraint: constraint((T0379)R103.CB, (T0379)K136.CB) [> 4.5224 = 7.5374 < 9.7986] w=0.5338 to align # Constraint # added constraint: constraint((T0379)M119.CB, (T0379)F134.CB) [> 3.9282 = 6.5471 < 8.5112] w=0.5253 to align # Constraint # added constraint: constraint((T0379)E165.CB, (T0379)F185.CB) [> 4.2938 = 7.1564 < 9.3033] w=0.5239 to align # Constraint # added constraint: constraint((T0379)N111.CB, (T0379)A139.CB) [> 3.4825 = 5.8042 < 7.5454] w=0.5239 to align # Constraint # added constraint: constraint((T0379)D116.CB, (T0379)V137.CB) [> 3.9003 = 6.5006 < 8.4507] w=0.5178 to align # Constraint # added constraint: constraint((T0379)E165.CB, (T0379)H186.CB) [> 4.3741 = 7.2902 < 9.4773] w=0.5073 to align # Constraint # added constraint: constraint((T0379)L106.CB, (T0379)L115.CB) [> 3.7983 = 6.3306 < 8.2297] w=0.5072 to align # Constraint # added constraint: constraint((T0379)R99.CB, (T0379)F133.CB) [> 3.9107 = 6.5178 < 8.4732] w=0.5014 to align # Constraint # added constraint: constraint((T0379)N109.CB, (T0379)A139.CB) [> 4.5022 = 7.5037 < 9.7549] w=0.5011 to align # Constraint # added constraint: constraint((T0379)P148.CB, (T0379)R182.CB) [> 3.9973 = 6.6622 < 8.6609] w=0.4989 to align # Constraint # added constraint: constraint((T0379)I95.CB, (T0379)L130.CB) [> 3.9818 = 6.6363 < 8.6271] w=0.4906 to align # Constraint # added constraint: constraint((T0379)F92.CB, (T0379)F133.CB) [> 4.0207 = 6.7011 < 8.7115] w=0.4823 to align # Constraint # added constraint: constraint((T0379)I157.CB, (T0379)L183.CB) [> 4.3297 = 7.2162 < 9.3811] w=0.4823 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)M156.CB) [> 4.3142 = 7.1904 < 9.3475] w=0.4740 to align # Constraint # added constraint: constraint((T0379)P112.CB, (T0379)C141.CB) [> 3.3455 = 5.5758 < 7.2486] w=0.4740 to align # Constraint # added constraint: constraint((T0379)G10.CA, (T0379)T110.CB) [> 4.2700 = 7.1166 < 9.2516] w=0.4490 to align # Constraint # added constraint: constraint((T0379)T110.CB, (T0379)S140.CB) [> 3.9530 = 6.5883 < 8.5649] w=0.4490 to align # Constraint # added constraint: constraint((T0379)P174.CB, (T0379)C189.CB) [> 3.6168 = 6.0280 < 7.8364] w=0.4429 to align # Constraint # added constraint: constraint((T0379)I87.CB, (T0379)R122.CB) [> 3.4848 = 5.8080 < 7.5504] w=0.4349 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)K91.CB) [> 4.2171 = 7.0284 < 9.1370] w=0.4346 to align # Constraint # added constraint: constraint((T0379)T167.CB, (T0379)L183.CB) [> 3.9340 = 6.5566 < 8.5236] w=0.4323 to align # Constraint # added constraint: constraint((T0379)L104.CB, (T0379)K136.CB) [> 4.5228 = 7.5380 < 9.7994] w=0.4172 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)L183.CB) [> 3.5072 = 5.8454 < 7.5990] w=0.4074 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)L104.CB) [> 4.6481 = 7.7469 < 10.0710] w=0.4016 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)F169.CB) [> 4.5470 = 7.5784 < 9.8519] w=0.4013 to align # Constraint # added constraint: constraint((T0379)D172.CB, (T0379)G193.CA) [> 3.3427 = 5.5712 < 7.2426] w=0.3998 to align # Constraint # added constraint: constraint((T0379)N176.CB, (T0379)T187.CB) [> 4.3375 = 7.2292 < 9.3979] w=0.3908 to align # Constraint # added constraint: constraint((T0379)L81.CB, (T0379)V114.CB) [> 3.8546 = 6.4243 < 8.3516] w=0.3756 to align # Constraint # added constraint: constraint((T0379)T167.CB, (T0379)G184.CA) [> 4.0410 = 6.7350 < 8.7555] w=0.3658 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)I95.CB) [> 4.4383 = 7.3972 < 9.6163] w=0.3597 to align # Constraint # added constraint: constraint((T0379)N176.CB, (T0379)C189.CB) [> 4.4088 = 7.3480 < 9.5524] w=0.3575 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)A180.CB) [> 4.5519 = 7.5865 < 9.8624] w=0.3493 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)P190.CB) [> 4.4687 = 7.4478 < 9.6821] w=0.3265 to align # Constraint # added constraint: constraint((T0379)N111.CB, (T0379)S140.CB) [> 3.5997 = 5.9995 < 7.7993] w=0.3243 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)A139.CB) [> 4.4761 = 7.4602 < 9.6982] w=0.3243 to align # Constraint # added constraint: constraint((T0379)L154.CB, (T0379)P164.CB) [> 3.9811 = 6.6352 < 8.6258] w=0.3242 to align # Constraint # added constraint: constraint((T0379)M1.CB, (T0379)E166.CB) [> 3.8241 = 6.3735 < 8.2856] w=0.3160 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)T179.CB) [> 4.1666 = 6.9444 < 9.0277] w=0.3159 to align # Constraint # added constraint: constraint((T0379)P112.CB, (T0379)V137.CB) [> 3.7258 = 6.2097 < 8.0726] w=0.3077 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)G193.CA) [> 2.9492 = 4.9153 < 6.3899] w=0.2910 to align # Constraint # added constraint: constraint((T0379)F25.CB, (T0379)L37.CB) [> 3.9039 = 6.5066 < 8.4585] w=0.2910 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)I95.CB) [> 4.0845 = 6.8075 < 8.8497] w=0.2849 to align # Constraint # added constraint: constraint((T0379)C189.CB, (T0379)I200.CB) [> 3.7810 = 6.3016 < 8.1921] w=0.2751 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)I152.CB) [> 4.5158 = 7.5263 < 9.7842] w=0.2661 to align # Constraint # added constraint: constraint((T0379)H15.CB, (T0379)G193.CA) [> 4.0119 = 6.6865 < 8.6925] w=0.2661 to align # Constraint # added constraint: constraint((T0379)R18.CB, (T0379)L84.CB) [> 3.9434 = 6.5722 < 8.5439] w=0.2661 to align # Constraint # added constraint: constraint((T0379)L106.CB, (T0379)A139.CB) [> 4.4883 = 7.4805 < 9.7247] w=0.2661 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)L107.CB) [> 4.5303 = 7.5504 < 9.8155] w=0.2661 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)S140.CB) [> 4.4693 = 7.4488 < 9.6835] w=0.2600 to align # Constraint # added constraint: constraint((T0379)V177.CB, (T0379)Y188.CB) [> 4.6002 = 7.6669 < 9.9670] w=0.2578 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)F169.CB) [> 4.5766 = 7.6276 < 9.9159] w=0.2516 to align # Constraint # added constraint: constraint((T0379)I14.CB, (T0379)K91.CB) [> 4.5095 = 7.5158 < 9.7705] w=0.2433 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)N192.CB) [> 3.6701 = 6.1169 < 7.9519] w=0.2428 to align # Constraint # added constraint: constraint((T0379)R99.CB, (T0379)D135.CB) [> 4.4885 = 7.4809 < 9.7251] w=0.2411 to align # Constraint # added constraint: constraint((T0379)L16.CB, (T0379)L84.CB) [> 3.9787 = 6.6312 < 8.6206] w=0.2410 to align # Constraint # added constraint: constraint((T0379)M119.CB, (T0379)F133.CB) [> 4.0701 = 6.7834 < 8.8185] w=0.2351 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)E194.CB) [> 3.9052 = 6.5087 < 8.4613] w=0.2328 to align # Constraint # added constraint: constraint((T0379)K26.CB, (T0379)V76.CB) [> 3.4986 = 5.8310 < 7.5803] w=0.2328 to align # Constraint # added constraint: constraint((T0379)Q142.CB, (T0379)I152.CB) [> 4.2997 = 7.1662 < 9.3160] w=0.2328 to align # Constraint # added constraint: constraint((T0379)I14.CB, (T0379)L84.CB) [> 3.6233 = 6.0388 < 7.8504] w=0.2328 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)D171.CB) [> 4.7048 = 7.8412 < 10.1936] w=0.2267 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)F92.CB) [> 3.9007 = 6.5012 < 8.4515] w=0.2267 to align # Constraint # added constraint: constraint((T0379)Y188.CB, (T0379)L203.CB) [> 3.8815 = 6.4692 < 8.4099] w=0.2252 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)D101.CB) [> 4.2504 = 7.0840 < 9.2092] w=0.2245 to align # Constraint # added constraint: constraint((T0379)I22.CB, (T0379)L80.CB) [> 3.9724 = 6.6206 < 8.6068] w=0.2245 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)I95.CB) [> 4.3171 = 7.1951 < 9.3537] w=0.2245 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)K91.CB) [> 4.2829 = 7.1381 < 9.2795] w=0.2245 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)N176.CB) [> 4.6739 = 7.7899 < 10.1269] w=0.2245 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)F134.CB) [> 4.4659 = 7.4431 < 9.6761] w=0.2162 to align # Constraint # added constraint: constraint((T0379)R24.CB, (T0379)V76.CB) [> 3.7816 = 6.3027 < 8.1935] w=0.2162 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)L168.CB) [> 4.0795 = 6.7991 < 8.8388] w=0.2162 to align # Constraint # added constraint: constraint((T0379)P174.CB, (T0379)W196.CB) [> 3.9160 = 6.5266 < 8.4846] w=0.2162 to align # Constraint # added constraint: constraint((T0379)T110.CB, (T0379)C141.CB) [> 3.5377 = 5.8962 < 7.6650] w=0.2104 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)M119.CB) [> 4.4770 = 7.4617 < 9.7002] w=0.2101 to align # Constraint # added constraint: constraint((T0379)F25.CB, (T0379)E34.CB) [> 4.2008 = 7.0013 < 9.1017] w=0.2079 to align # Constraint # added constraint: constraint((T0379)E20.CB, (T0379)Y77.CB) [> 3.9440 = 6.5733 < 8.5453] w=0.1996 to align # Constraint # added constraint: constraint((T0379)L168.CB, (T0379)A180.CB) [> 4.6527 = 7.7546 < 10.0809] w=0.1996 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)N192.CB) [> 4.0636 = 6.7727 < 8.8045] w=0.1996 to align # Constraint # added constraint: constraint((T0379)V114.CB, (T0379)A139.CB) [> 4.4469 = 7.4115 < 9.6350] w=0.1996 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)A118.CB) [> 3.9928 = 6.6547 < 8.6512] w=0.1996 to align # Constraint # added constraint: constraint((T0379)N109.CB, (T0379)C141.CB) [> 4.2382 = 7.0636 < 9.1827] w=0.1934 to align # Constraint # added constraint: constraint((T0379)N17.CB, (T0379)D172.CB) [> 4.0018 = 6.6696 < 8.6705] w=0.1913 to align # Constraint # added constraint: constraint((T0379)E150.CB, (T0379)E181.CB) [> 3.6063 = 6.0105 < 7.8136] w=0.1912 to align # Constraint # added constraint: constraint((T0379)S21.CB, (T0379)L37.CB) [> 3.3991 = 5.6652 < 7.3647] w=0.1838 to align # Constraint # added constraint: constraint((T0379)S21.CB, (T0379)L41.CB) [> 3.5643 = 5.9406 < 7.7227] w=0.1829 to align # Constraint # added constraint: constraint((T0379)R60.CB, (T0379)Y77.CB) [> 3.6177 = 6.0294 < 7.8382] w=0.1755 to align # Constraint # added constraint: constraint((T0379)F25.CB, (T0379)M36.CB) [> 3.7878 = 6.3129 < 8.2068] w=0.1746 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)K163.CB) [> 4.6396 = 7.7327 < 10.0525] w=0.1746 to align # Constraint # added constraint: constraint((T0379)K91.CB, (T0379)R122.CB) [> 4.2663 = 7.1105 < 9.2436] w=0.1746 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)G193.CA) [> 4.1068 = 6.8447 < 8.8981] w=0.1746 to align # Constraint # added constraint: constraint((T0379)I157.CB, (T0379)E166.CB) [> 4.5650 = 7.6084 < 9.8909] w=0.1746 to align # Constraint # added constraint: constraint((T0379)P174.CB, (T0379)I197.CB) [> 3.7473 = 6.2456 < 8.1192] w=0.1670 to align # Constraint # added constraint: constraint((T0379)L16.CB, (T0379)A118.CB) [> 4.2841 = 7.1402 < 9.2823] w=0.1663 to align # Constraint # added constraint: constraint((T0379)R24.CB, (T0379)L80.CB) [> 4.0175 = 6.6959 < 8.7047] w=0.1663 to align # Constraint # added constraint: constraint((T0379)R60.CB, (T0379)Y73.CB) [> 3.3659 = 5.6099 < 7.2928] w=0.1587 to align # Constraint # added constraint: constraint((T0379)I33.CB, (T0379)F59.CB) [> 3.6374 = 6.0623 < 7.8810] w=0.1587 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)G184.CA) [> 4.5915 = 7.6525 < 9.9482] w=0.1579 to align # Constraint # added constraint: constraint((T0379)L168.CB, (T0379)G184.CA) [> 4.0128 = 6.6880 < 8.6944] w=0.1579 to align # Constraint # added constraint: constraint((T0379)E166.CB, (T0379)G184.CA) [> 4.2260 = 7.0433 < 9.1563] w=0.1579 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)T179.CB) [> 3.8244 = 6.3739 < 8.2861] w=0.1579 to align # Constraint # added constraint: constraint((T0379)G173.CA, (T0379)P190.CB) [> 4.5668 = 7.6113 < 9.8947] w=0.1497 to align # Constraint # added constraint: constraint((T0379)L45.CB, (T0379)A175.CB) [> 3.6685 = 6.1141 < 7.9484] w=0.1497 to align # Constraint # added constraint: constraint((T0379)Y188.CB, (T0379)I200.CB) [> 3.6851 = 6.1418 < 7.9844] w=0.1497 to align # Constraint # added constraint: constraint((T0379)L45.CB, (T0379)N109.CB) [> 3.9307 = 6.5512 < 8.5166] w=0.1414 to align # Constraint # added constraint: constraint((T0379)S21.CB, (T0379)Y40.CB) [> 3.0525 = 5.0874 < 6.6137] w=0.1414 to align # Constraint # added constraint: constraint((T0379)F25.CB, (T0379)Y40.CB) [> 3.6732 = 6.1220 < 7.9585] w=0.1414 to align # Constraint # added constraint: constraint((T0379)E90.CB, (T0379)E194.CB) [> 4.0101 = 6.6835 < 8.6885] w=0.1414 to align # Constraint # added constraint: constraint((T0379)V30.CB, (T0379)Y66.CB) [> 3.2726 = 5.4544 < 7.0907] w=0.1414 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)T167.CB) [> 4.4650 = 7.4417 < 9.6742] w=0.1413 to align # Constraint # added constraint: constraint((T0379)L115.CB, (T0379)Y138.CB) [> 4.4663 = 7.4439 < 9.6770] w=0.1413 to align # Constraint # added constraint: constraint((T0379)G10.CA, (T0379)L84.CB) [> 4.5000 = 7.5000 < 9.7500] w=0.1330 to align # Constraint # added constraint: constraint((T0379)L49.CB, (T0379)Y146.CB) [> 3.6329 = 6.0549 < 7.8713] w=0.1330 to align # Constraint # added constraint: constraint((T0379)Y94.CB, (T0379)T201.CB) [> 3.7078 = 6.1796 < 8.0335] w=0.1330 to align # Constraint # added constraint: constraint((T0379)P112.CB, (T0379)S140.CB) [> 4.2264 = 7.0439 < 9.1571] w=0.1330 to align # Constraint # added constraint: constraint((T0379)S21.CB, (T0379)L80.CB) [> 3.8628 = 6.4379 < 8.3693] w=0.1255 to align # Constraint # added constraint: constraint((T0379)I33.CB, (T0379)E62.CB) [> 3.5944 = 5.9907 < 7.7879] w=0.1255 to align # Constraint # added constraint: constraint((T0379)L80.CB, (T0379)V114.CB) [> 3.8017 = 6.3362 < 8.2371] w=0.1255 to align # Constraint # added constraint: constraint((T0379)I170.CB, (T0379)I200.CB) [> 4.1274 = 6.8790 < 8.9426] w=0.1254 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)G173.CA) [> 4.3474 = 7.2456 < 9.4193] w=0.1247 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)S160.CB) [> 4.5680 = 7.6134 < 9.8974] w=0.1247 to align # Constraint # added constraint: constraint((T0379)G10.CA, (T0379)A118.CB) [> 4.6537 = 7.7562 < 10.0831] w=0.1247 to align # Constraint # added constraint: constraint((T0379)L16.CB, (T0379)G193.CA) [> 3.5378 = 5.8963 < 7.6652] w=0.1247 to align # Constraint # added constraint: constraint((T0379)G10.CA, (T0379)N109.CB) [> 4.4383 = 7.3972 < 9.6163] w=0.1247 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)G173.CA) [> 4.3612 = 7.2687 < 9.4493] w=0.1247 to align # Constraint # added constraint: constraint((T0379)Y94.CB, (T0379)L204.CB) [> 3.7260 = 6.2101 < 8.0731] w=0.1247 to align # Constraint # added constraint: constraint((T0379)M36.CB, (T0379)F59.CB) [> 3.7787 = 6.2978 < 8.1871] w=0.1247 to align # Constraint # added constraint: constraint((T0379)L49.CB, (T0379)K145.CB) [> 3.4606 = 5.7676 < 7.4979] w=0.1247 to align # Constraint # added constraint: constraint((T0379)I28.CB, (T0379)F59.CB) [> 3.8371 = 6.3952 < 8.3137] w=0.1247 to align # Constraint # added constraint: constraint((T0379)I22.CB, (T0379)I33.CB) [> 3.7847 = 6.3079 < 8.2003] w=0.1171 to align # Constraint # added constraint: constraint((T0379)I170.CB, (T0379)W196.CB) [> 3.8413 = 6.4022 < 8.3228] w=0.1164 to align # Constraint # added constraint: constraint((T0379)G10.CA, (T0379)G193.CA) [> 4.5894 = 7.6491 < 9.9438] w=0.1164 to align # Constraint # added constraint: constraint((T0379)Y102.CB, (T0379)L168.CB) [> 4.5656 = 7.6093 < 9.8921] w=0.1164 to align # Constraint # added constraint: constraint((T0379)F25.CB, (T0379)L41.CB) [> 3.7333 = 6.2221 < 8.0887] w=0.1164 to align # Constraint # added constraint: constraint((T0379)Y77.CB, (T0379)Y113.CB) [> 3.9070 = 6.5116 < 8.4651] w=0.1164 to align # Constraint # added constraint: constraint((T0379)G173.CA, (T0379)D191.CB) [> 3.8562 = 6.4269 < 8.3550] w=0.1081 to align # Constraint # added constraint: constraint((T0379)S140.CB, (T0379)N149.CB) [> 4.5569 = 7.5949 < 9.8733] w=0.1081 to align # Constraint # added constraint: constraint((T0379)Y94.CB, (T0379)I197.CB) [> 3.6563 = 6.0938 < 7.9219] w=0.1081 to align # Constraint # added constraint: constraint((T0379)F25.CB, (T0379)L63.CB) [> 3.7723 = 6.2871 < 8.1733] w=0.1081 to align # Constraint # added constraint: constraint((T0379)L49.CB, (T0379)F59.CB) [> 2.5390 = 4.2317 < 5.5012] w=0.1081 to align # Constraint # added constraint: constraint((T0379)F46.CB, (T0379)F59.CB) [> 4.3821 = 7.3035 < 9.4946] w=0.1081 to align # Constraint # added constraint: constraint((T0379)L45.CB, (T0379)P174.CB) [> 3.8273 = 6.3788 < 8.2924] w=0.1081 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)D171.CB) [> 4.7060 = 7.8433 < 10.1963] w=0.1020 to align # Constraint # added constraint: constraint((T0379)S64.CB, (T0379)Y73.CB) [> 3.4536 = 5.7559 < 7.4827] w=0.1006 to align # Constraint # added constraint: constraint((T0379)L98.CB, (T0379)F133.CB) [> 4.5567 = 7.5945 < 9.8729] w=0.0998 to align # Constraint # added constraint: constraint((T0379)E166.CB, (T0379)F185.CB) [> 4.6756 = 7.7927 < 10.1305] w=0.0998 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)D135.CB) [> 4.6962 = 7.8271 < 10.1752] w=0.0998 to align # Constraint # added constraint: constraint((T0379)P174.CB, (T0379)D191.CB) [> 4.3907 = 7.3179 < 9.5133] w=0.0998 to align # Constraint # added constraint: constraint((T0379)D8.CB, (T0379)N109.CB) [> 4.6401 = 7.7336 < 10.0536] w=0.0998 to align # Constraint # added constraint: constraint((T0379)I28.CB, (T0379)L63.CB) [> 4.1675 = 6.9459 < 9.0296] w=0.0998 to align # Constraint # added constraint: constraint((T0379)D48.CB, (T0379)N109.CB) [> 3.5743 = 5.9572 < 7.7444] w=0.0998 to align # Constraint # added constraint: constraint((T0379)I170.CB, (T0379)A180.CB) [> 4.7283 = 7.8804 < 10.2446] w=0.0998 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)A139.CB) [> 4.3512 = 7.2520 < 9.4276] w=0.0998 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)D191.CB) [> 4.1426 = 6.9043 < 8.9756] w=0.0998 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)D191.CB) [> 4.1711 = 6.9519 < 9.0374] w=0.0998 to align # Constraint # added constraint: constraint((T0379)Y188.CB, (T0379)A199.CB) [> 3.4659 = 5.7765 < 7.5094] w=0.0998 to align # Constraint # added constraint: constraint((T0379)L98.CB, (T0379)L204.CB) [> 4.2057 = 7.0095 < 9.1124] w=0.0923 to align # Constraint # added constraint: constraint((T0379)H15.CB, (T0379)N192.CB) [> 4.0297 = 6.7162 < 8.7310] w=0.0915 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)E165.CB) [> 3.9527 = 6.5878 < 8.5642] w=0.0915 to align # Constraint # added constraint: constraint((T0379)P190.CB, (T0379)L203.CB) [> 3.6542 = 6.0903 < 7.9174] w=0.0915 to align # Constraint # added constraint: constraint((T0379)L49.CB, (T0379)G144.CA) [> 3.2120 = 5.3533 < 6.9593] w=0.0915 to align # Constraint # added constraint: constraint((T0379)C189.CB, (T0379)T201.CB) [> 3.6194 = 6.0323 < 7.8420] w=0.0915 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)F134.CB) [> 2.8196 = 4.6993 < 6.1091] w=0.0915 to align # Constraint # added constraint: constraint((T0379)D172.CB, (T0379)I197.CB) [> 4.1788 = 6.9646 < 9.0540] w=0.0914 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)L204.CB) [> 4.1026 = 6.8377 < 8.8890] w=0.0839 to align # Constraint # added constraint: constraint((T0379)P121.CB, (T0379)S132.CB) [> 4.2286 = 7.0477 < 9.1621] w=0.0832 to align # Constraint # added constraint: constraint((T0379)R24.CB, (T0379)L49.CB) [> 4.1105 = 6.8508 < 8.9060] w=0.0832 to align # Constraint # added constraint: constraint((T0379)E56.CB, (T0379)Y66.CB) [> 3.8221 = 6.3702 < 8.2813] w=0.0832 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)E194.CB) [> 4.5041 = 7.5068 < 9.7589] w=0.0832 to align # Constraint # added constraint: constraint((T0379)E166.CB, (T0379)H186.CB) [> 4.3016 = 7.1694 < 9.3202] w=0.0832 to align # Constraint # added constraint: constraint((T0379)I28.CB, (T0379)I67.CB) [> 3.8474 = 6.4124 < 8.3361] w=0.0832 to align # Constraint # added constraint: constraint((T0379)R18.CB, (T0379)T110.CB) [> 2.8171 = 4.6952 < 6.1038] w=0.0832 to align # Constraint # added constraint: constraint((T0379)I5.CB, (T0379)I200.CB) [> 4.3236 = 7.2059 < 9.3677] w=0.0831 to align # Constraint # added constraint: constraint((T0379)F46.CB, (T0379)P174.CB) [> 3.8768 = 6.4613 < 8.3997] w=0.0756 to align # Constraint # added constraint: constraint((T0379)M1.CB, (T0379)E165.CB) [> 4.1228 = 6.8714 < 8.9328] w=0.0748 to align # Constraint # added constraint: constraint((T0379)I28.CB, (T0379)V76.CB) [> 4.2192 = 7.0320 < 9.1416] w=0.0748 to align # Constraint # added constraint: constraint((T0379)L9.CB, (T0379)N109.CB) [> 4.7310 = 7.8849 < 10.2504] w=0.0748 to align # Constraint # added constraint: constraint((T0379)E50.CB, (T0379)S140.CB) [> 3.0974 = 5.1624 < 6.7111] w=0.0748 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)K136.CB) [> 4.4697 = 7.4495 < 9.6843] w=0.0748 to align # Constraint # added constraint: constraint((T0379)H186.CB, (T0379)L203.CB) [> 4.0048 = 6.6747 < 8.6771] w=0.0748 to align # Constraint # added constraint: constraint((T0379)L115.CB, (T0379)S140.CB) [> 4.0575 = 6.7625 < 8.7912] w=0.0748 to align # Constraint # added constraint: constraint((T0379)N109.CB, (T0379)M143.CB) [> 3.9970 = 6.6617 < 8.6602] w=0.0687 to align # Constraint # added constraint: constraint((T0379)G173.CA, (T0379)N192.CB) [> 3.6286 = 6.0477 < 7.8621] w=0.0682 to align # Constraint # added constraint: constraint((T0379)E50.CB, (T0379)N109.CB) [> 2.8773 = 4.7955 < 6.2341] w=0.0665 to align # Constraint # added constraint: constraint((T0379)F46.CB, (T0379)K147.CB) [> 3.9526 = 6.5877 < 8.5641] w=0.0665 to align # Constraint # added constraint: constraint((T0379)N109.CB, (T0379)K145.CB) [> 4.2095 = 7.0159 < 9.1207] w=0.0665 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)L98.CB) [> 4.5776 = 7.6293 < 9.9181] w=0.0665 to align # Constraint # added constraint: constraint((T0379)L107.CB, (T0379)M143.CB) [> 3.6119 = 6.0198 < 7.8257] w=0.0604 to align # Constraint # added constraint: constraint((T0379)F83.CB, (T0379)L117.CB) [> 2.7604 = 4.6007 < 5.9809] w=0.0589 to align # Constraint # added constraint: constraint((T0379)F46.CB, (T0379)N109.CB) [> 3.8222 = 6.3704 < 8.2815] w=0.0582 to align # Constraint # added constraint: constraint((T0379)P190.CB, (T0379)I200.CB) [> 3.7811 = 6.3019 < 8.1924] w=0.0582 to align # Constraint # added constraint: constraint((T0379)P190.CB, (T0379)L204.CB) [> 4.0204 = 6.7007 < 8.7109] w=0.0582 to align # Constraint # added constraint: constraint((T0379)C189.CB, (T0379)L204.CB) [> 2.9829 = 4.9715 < 6.4629] w=0.0582 to align # Constraint # added constraint: constraint((T0379)L106.CB, (T0379)D135.CB) [> 4.1598 = 6.9331 < 9.0130] w=0.0582 to align # Constraint # added constraint: constraint((T0379)D151.CB, (T0379)R182.CB) [> 4.6034 = 7.6723 < 9.9740] w=0.0582 to align # Constraint # added constraint: constraint((T0379)F83.CB, (T0379)P121.CB) [> 4.1216 = 6.8694 < 8.9302] w=0.0507 to align # Constraint # added constraint: constraint((T0379)I2.CB, (T0379)E165.CB) [> 4.7035 = 7.8392 < 10.1910] w=0.0499 to align # Constraint # added constraint: constraint((T0379)M156.CB, (T0379)F169.CB) [> 4.6859 = 7.8099 < 10.1529] w=0.0499 to align # Constraint # added constraint: constraint((T0379)L41.CB, (T0379)Y146.CB) [> 3.9032 = 6.5053 < 8.4569] w=0.0499 to align # Constraint # added constraint: constraint((T0379)A118.CB, (T0379)T129.CB) [> 3.6479 = 6.0798 < 7.9037] w=0.0499 to align # Constraint # added constraint: constraint((T0379)V30.CB, (T0379)A79.CB) [> 3.5306 = 5.8843 < 7.6496] w=0.0499 to align # Constraint # added constraint: constraint((T0379)L80.CB, (T0379)L117.CB) [> 3.9107 = 6.5178 < 8.4732] w=0.0499 to align # Constraint # added constraint: constraint((T0379)L104.CB, (T0379)F123.CB) [> 4.0241 = 6.7068 < 8.7188] w=0.0499 to align # Constraint # added constraint: constraint((T0379)D171.CB, (T0379)N192.CB) [> 4.4990 = 7.4983 < 9.7477] w=0.0499 to align # Constraint # added constraint: constraint((T0379)Y188.CB, (T0379)L204.CB) [> 4.0350 = 6.7249 < 8.7424] w=0.0499 to align # Constraint # added constraint: constraint((T0379)Y40.CB, (T0379)I67.CB) [> 4.0595 = 6.7658 < 8.7956] w=0.0416 to align # Constraint # added constraint: constraint((T0379)S64.CB, (T0379)V76.CB) [> 3.7684 = 6.2807 < 8.1649] w=0.0416 to align # Constraint # added constraint: constraint((T0379)D191.CB, (T0379)T201.CB) [> 3.3922 = 5.6536 < 7.3497] w=0.0416 to align # Constraint # added constraint: constraint((T0379)G11.CA, (T0379)I22.CB) [> 4.1803 = 6.9671 < 9.0572] w=0.0416 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)M143.CB) [> 4.0091 = 6.6818 < 8.6863] w=0.0416 to align # Constraint # added constraint: constraint((T0379)C189.CB, (T0379)R205.CB) [> 3.0763 = 5.1272 < 6.6654] w=0.0416 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)Y94.CB) [> 4.4783 = 7.4638 < 9.7030] w=0.0416 to align # Constraint # added constraint: constraint((T0379)N111.CB, (T0379)Y138.CB) [> 2.9655 = 4.9426 < 6.4253] w=0.0416 to align # Constraint # added constraint: constraint((T0379)Y113.CB, (T0379)Y138.CB) [> 3.3349 = 5.5581 < 7.2256] w=0.0416 to align # Constraint # added constraint: constraint((T0379)N109.CB, (T0379)Q142.CB) [> 3.0809 = 5.1349 < 6.6754] w=0.0357 to align # Constraint # added constraint: constraint((T0379)L115.CB, (T0379)C141.CB) [> 4.1321 = 6.8868 < 8.9529] w=0.0333 to align # Constraint # added constraint: constraint((T0379)D32.CB, (T0379)F46.CB) [> 3.6842 = 6.1403 < 7.9823] w=0.0333 to align # Constraint # added constraint: constraint((T0379)F46.CB, (T0379)N111.CB) [> 3.8420 = 6.4033 < 8.3243] w=0.0333 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)Y94.CB) [> 4.6842 = 7.8070 < 10.1491] w=0.0333 to align # Constraint # added constraint: constraint((T0379)Y188.CB, (T0379)I197.CB) [> 3.6975 = 6.1625 < 8.0113] w=0.0333 to align # Constraint # added constraint: constraint((T0379)F7.CB, (T0379)I33.CB) [> 4.4313 = 7.3855 < 9.6012] w=0.0333 to align # Constraint # added constraint: constraint((T0379)N4.CB, (T0379)D32.CB) [> 4.1373 = 6.8955 < 8.9641] w=0.0333 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)V30.CB) [> 3.8767 = 6.4611 < 8.3994] w=0.0333 to align # Constraint # added constraint: constraint((T0379)L104.CB, (T0379)R122.CB) [> 4.4418 = 7.4030 < 9.6239] w=0.0333 to align # Constraint # added constraint: constraint((T0379)T187.CB, (T0379)L203.CB) [> 3.5798 = 5.9663 < 7.7562] w=0.0333 to align # Constraint # added constraint: constraint((T0379)L47.CB, (T0379)V177.CB) [> 4.4041 = 7.3402 < 9.5423] w=0.0333 to align # Constraint # added constraint: constraint((T0379)G193.CA, (T0379)R205.CB) [> 3.4893 = 5.8155 < 7.5602] w=0.0333 to align # Constraint # added constraint: constraint((T0379)L104.CB, (T0379)S132.CB) [> 4.6348 = 7.7247 < 10.0421] w=0.0333 to align # Constraint # added constraint: constraint((T0379)Y188.CB, (T0379)R202.CB) [> 3.6818 = 6.1364 < 7.9773] w=0.0332 to align # Constraint # added constraint: constraint((T0379)R3.CB, (T0379)I33.CB) [> 3.8798 = 6.4663 < 8.4061] w=0.0332 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)M143.CB) [> 4.1299 = 6.8832 < 8.9481] w=0.0271 to align # Constraint # added constraint: constraint((T0379)M143.CB, (T0379)F169.CB) [> 3.7602 = 6.2670 < 8.1470] w=0.0271 to align # Constraint # added constraint: constraint((T0379)N192.CB, (T0379)T201.CB) [> 3.4548 = 5.7581 < 7.4855] w=0.0249 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)S108.CB) [> 4.7819 = 7.9698 < 10.3608] w=0.0249 to align # Constraint # added constraint: constraint((T0379)V114.CB, (T0379)C141.CB) [> 4.7489 = 7.9149 < 10.2893] w=0.0249 to align # Constraint # added constraint: constraint((T0379)A178.CB, (T0379)T187.CB) [> 4.7521 = 7.9202 < 10.2963] w=0.0249 to align # Constraint # added constraint: constraint((T0379)L16.CB, (T0379)L37.CB) [> 4.6197 = 7.6995 < 10.0094] w=0.0249 to align # Constraint # added constraint: constraint((T0379)V177.CB, (T0379)G193.CA) [> 3.5982 = 5.9970 < 7.7961] w=0.0249 to align # Constraint # added constraint: constraint((T0379)V177.CB, (T0379)D191.CB) [> 3.8763 = 6.4606 < 8.3988] w=0.0249 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)L124.CB) [> 4.1905 = 6.9842 < 9.0795] w=0.0249 to align # Constraint # added constraint: constraint((T0379)I14.CB, (T0379)L124.CB) [> 3.6084 = 6.0140 < 7.8182] w=0.0249 to align # Constraint # added constraint: constraint((T0379)V6.CB, (T0379)D32.CB) [> 4.3386 = 7.2309 < 9.4002] w=0.0249 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)L63.CB) [> 4.6370 = 7.7284 < 10.0469] w=0.0249 to align # Constraint # added constraint: constraint((T0379)I67.CB, (T0379)V76.CB) [> 4.0719 = 6.7866 < 8.8225] w=0.0249 to align # Constraint # added constraint: constraint((T0379)N109.CB, (T0379)N149.CB) [> 3.9365 = 6.5608 < 8.5290] w=0.0249 to align # Constraint # added constraint: constraint((T0379)A180.CB, (T0379)C189.CB) [> 4.4141 = 7.3568 < 9.5639] w=0.0249 to align # Constraint # added constraint: constraint((T0379)T187.CB, (T0379)I200.CB) [> 3.1518 = 5.2529 < 6.8288] w=0.0249 to align # Constraint # added constraint: constraint((T0379)S97.CB, (T0379)C141.CB) [> 4.7684 = 7.9473 < 10.3315] w=0.0166 to align # Constraint # added constraint: constraint((T0379)T110.CB, (T0379)F134.CB) [> 4.7822 = 7.9704 < 10.3615] w=0.0166 to align # Constraint # added constraint: constraint((T0379)Y73.CB, (T0379)M143.CB) [> 2.8314 = 4.7189 < 6.1346] w=0.0166 to align # Constraint # added constraint: constraint((T0379)M1.CB, (T0379)L204.CB) [> 4.1567 = 6.9278 < 9.0061] w=0.0166 to align # Constraint # added constraint: constraint((T0379)L47.CB, (T0379)C141.CB) [> 4.3283 = 7.2139 < 9.3780] w=0.0166 to align # Constraint # added constraint: constraint((T0379)M1.CB, (T0379)Y102.CB) [> 4.5336 = 7.5560 < 9.8228] w=0.0166 to align # Constraint # added constraint: constraint((T0379)I14.CB, (T0379)L117.CB) [> 3.9825 = 6.6374 < 8.6286] w=0.0166 to align # Constraint # added constraint: constraint((T0379)S64.CB, (T0379)T110.CB) [> 3.0007 = 5.0012 < 6.5015] w=0.0166 to align # Constraint # added constraint: constraint((T0379)L47.CB, (T0379)Q75.CB) [> 3.7372 = 6.2287 < 8.0973] w=0.0166 to align # Constraint # added constraint: constraint((T0379)V76.CB, (T0379)S108.CB) [> 4.3465 = 7.2442 < 9.4175] w=0.0166 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)C141.CB) [> 4.3420 = 7.2367 < 9.4077] w=0.0166 to align # Constraint # added constraint: constraint((T0379)L63.CB, (T0379)Q75.CB) [> 4.4041 = 7.3401 < 9.5421] w=0.0090 to align # Constraint # added constraint: constraint((T0379)N17.CB, (T0379)A79.CB) [> 3.7266 = 6.2109 < 8.0742] w=0.0083 to align # Constraint # added constraint: constraint((T0379)F46.CB, (T0379)F83.CB) [> 3.3039 = 5.5065 < 7.1584] w=0.0083 to align # Constraint # added constraint: constraint((T0379)Y146.CB, (T0379)V177.CB) [> 4.5560 = 7.5933 < 9.8713] w=0.0083 to align # Constraint # added constraint: constraint((T0379)F105.CB, (T0379)C141.CB) [> 4.6162 = 7.6937 < 10.0018] w=0.0083 to align # Constraint # added constraint: constraint((T0379)L98.CB, (T0379)G144.CA) [> 4.7521 = 7.9202 < 10.2962] w=0.0083 to align # Constraint # added constraint: constraint((T0379)H15.CB, (T0379)F83.CB) [> 3.5533 = 5.9222 < 7.6988] w=0.0083 to align # Constraint # added constraint: constraint((T0379)V12.CB, (T0379)T201.CB) [> 4.7421 = 7.9035 < 10.2746] w=0.0083 to align # Constraint # added constraint: constraint((T0379)I2.CB, (T0379)T187.CB) [> 4.5741 = 7.6234 < 9.9105] w=0.0083 to align # Constraint # added constraint: constraint((T0379)M1.CB, (T0379)H186.CB) [> 4.7609 = 7.9348 < 10.3152] w=0.0083 to align # Constraint # added constraint: constraint((T0379)F169.CB, (T0379)C189.CB) [> 4.1435 = 6.9059 < 8.9776] w=0.0083 to align # Constraint # added constraint: constraint((T0379)S108.CB, (T0379)L124.CB) [> 4.7275 = 7.8792 < 10.2430] w=0.0083 to align # Constraint # added constraint: constraint((T0379)L63.CB, (T0379)L106.CB) [> 4.2594 = 7.0990 < 9.2288] w=0.0083 to align # Constraint # added constraint: constraint((T0379)L13.CB, (T0379)I67.CB) [> 4.3510 = 7.2516 < 9.4271] w=0.0083 to align # Constraint # added constraint: constraint((T0379)G173.CA, (T0379)Y188.CB) [> 4.7601 = 7.9335 < 10.3135] w=0.0083 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0379/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0379/decoys/ # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 166 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 137 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 111 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 113 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 166 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 134 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 111 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 165 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 88 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 85 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 18 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 194 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # Found a chain break before 190 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CPHmodels_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation CPHmodels_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # Found a chain break before 186 # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # Found a chain break before 126 # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 123 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 198 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # Found a chain break before 190 # copying to AlignedFragments data structure # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 194 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 114 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 113 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 173 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 194 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 Skipped atom 11, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL2.pdb.gz Skipped atom 304, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL2.pdb.gz # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 Skipped atom 806, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL3.pdb.gz Skipped atom 808, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL3.pdb.gz Skipped atom 810, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL3.pdb.gz Skipped atom 812, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL3.pdb.gz # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 Skipped atom 34, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 36, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 98, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 100, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 102, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 104, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 190, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 192, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 194, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 196, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 246, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 248, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 250, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 252, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 486, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 488, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 490, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 492, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 Skipped atom 11, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 304, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 Skipped atom 34, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 36, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 98, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 100, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 102, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 104, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 190, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 192, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 194, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 196, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 246, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 248, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 250, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 252, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 486, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 488, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 490, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz Skipped atom 492, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL3.pdb.gz # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 170 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 166 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 194 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # Found a chain break before 164 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # Found a chain break before 49 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # Found a chain break before 145 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/Frankenstein_TS1.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS1 # ReadConformPDB reading from PDB file servers/Frankenstein_TS2.pdb.gz looking for model 1 # Found a chain break before 174 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS2 # ReadConformPDB reading from PDB file servers/Frankenstein_TS3.pdb.gz looking for model 1 # Found a chain break before 100 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS3 # ReadConformPDB reading from PDB file servers/Frankenstein_TS4.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS4 # ReadConformPDB reading from PDB file servers/Frankenstein_TS5.pdb.gz looking for model 1 # Found a chain break before 115 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS5 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # Found a chain break before 82 # copying to AlignedFragments data structure # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 49 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # Found a chain break before 84 # copying to AlignedFragments data structure # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/MIG_FROST_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation MIG_FROST_AL1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS1.pdb.gz looking for model 1 # Found a chain break before 198 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS2.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS3.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS4.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS5.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 131 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 137 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 190 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 190 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 198 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 207 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # Found a chain break before 119 # copying to AlignedFragments data structure # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # Found a chain break before 135 # copying to AlignedFragments data structure # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # Found a chain break before 133 # copying to AlignedFragments data structure # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # Found a chain break before 120 # copying to AlignedFragments data structure # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # Found a chain break before 133 # copying to AlignedFragments data structure # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # Found a chain break before 135 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # Found a chain break before 198 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # Found a chain break before 189 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # Found a chain break before 133 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # Found a chain break before 192 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # Found a chain break before 195 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # Found a chain break before 207 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 175 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 189 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 2 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 166 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 130 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 164 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 114 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 # Found a chain break before 132 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 # Found a chain break before 184 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 # Found a chain break before 40 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 # Found a chain break before 192 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 # Found a chain break before 40 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 Skipped atom 310, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 312, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 314, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 316, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 362, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 364, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 366, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 368, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 382, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 384, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 386, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 388, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 390, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 392, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 394, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 396, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 666, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 668, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 670, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 672, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM-T99_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL2 # ReadConformPDB reading from PDB file servers/SAM-T99_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL3 # ReadConformPDB reading from PDB file servers/SAM-T99_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL4 # ReadConformPDB reading from PDB file servers/SAM-T99_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL5 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 206 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 72 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 203 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 85 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 184 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 42 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 85 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 184 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 54 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 31 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 58 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 123 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 125 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 125 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 Skipped atom 766, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz Skipped atom 768, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz Skipped atom 770, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz Skipped atom 772, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz Skipped atom 774, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz Skipped atom 776, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz Skipped atom 778, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz Skipped atom 780, because occupancy 1.000 <= existing 1.000 in servers/forecast-s_AL2.pdb.gz # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 164 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 194 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 206 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0379)E57.O and (T0379)E58.N only 0.000 apart, marking (T0379)E58.N as missing WARNING: atoms too close: (T0379)M119.O and (T0379)S120.N only 0.000 apart, marking (T0379)S120.N as missing # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0379)E86.O and (T0379)I87.N only 0.000 apart, marking (T0379)I87.N as missing # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0379)E86.O and (T0379)I87.N only 0.000 apart, marking (T0379)I87.N as missing # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0379)N149.O and (T0379)E150.N only 0.000 apart, marking (T0379)E150.N as missing # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # Found a chain break before 120 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/panther2_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0379)E86.N and (T0379)N111.N only 0.000 apart, marking (T0379)N111.N as missing WARNING: atoms too close: (T0379)E86.CA and (T0379)N111.CA only 0.000 apart, marking (T0379)N111.CA as missing WARNING: atoms too close: (T0379)E86.CB and (T0379)N111.CB only 0.000 apart, marking (T0379)N111.CB as missing WARNING: atoms too close: (T0379)E86.CG and (T0379)N111.CG only 0.000 apart, marking (T0379)N111.CG as missing WARNING: atoms too close: (T0379)E86.O and (T0379)N111.O only 0.000 apart, marking (T0379)N111.O as missing WARNING: atoms too close: (T0379)E86.C and (T0379)N111.C only 0.000 apart, marking (T0379)N111.C as missing WARNING: atoms too close: (T0379)N111.N and (T0379)P112.N only 0.000 apart, marking (T0379)N111.N as missing WARNING: atoms too close: (T0379)E86.N and (T0379)P112.N only 0.000 apart, marking (T0379)P112.N as missing WARNING: atoms too close: (T0379)N111.CA and (T0379)P112.CA only 0.000 apart, marking (T0379)P112.CA as missing WARNING: atoms too close: (T0379)E86.CA and (T0379)P112.CA only 0.000 apart, marking (T0379)P112.CA as missing WARNING: atoms too close: (T0379)N111.CB and (T0379)P112.CB only 0.000 apart, marking (T0379)P112.CB as missing WARNING: atoms too close: (T0379)E86.CB and (T0379)P112.CB only 0.000 apart, marking (T0379)P112.CB as missing WARNING: atoms too close: (T0379)N111.O and (T0379)P112.O only 0.000 apart, marking (T0379)P112.O as missing WARNING: atoms too close: (T0379)E86.O and (T0379)P112.O only 0.000 apart, marking (T0379)P112.O as missing WARNING: atoms too close: (T0379)N111.C and (T0379)P112.C only 0.000 apart, marking (T0379)P112.C as missing WARNING: atoms too close: (T0379)E86.C and (T0379)P112.C only 0.000 apart, marking (T0379)P112.C as missing # WARNING: incomplete conformation T0379 can't currently be optimized by undertaker # naming current conformation panther2_TS1 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score -0.2069 model score -0.0401 model score -0.0407 model score -0.1814 model score -0.1045 model score -0.2912 model score -0.2840 model score -0.2133 model score -0.2633 model score -0.2015 model score -0.0434 model score -0.2513 model score -0.2715 model score -0.2343 model score -0.2409 model score -0.2973 model score -0.2967 model score -0.2672 model score -0.2838 model score -0.2732 model score 1.4599 model score 1.6462 model score 1.8785 model score 1.5746 model score 1.6407 model score -0.5151 model score -0.3170 model score -0.1071 model score -0.4228 model score -0.4329 model score -0.4225 model score -0.4094 model score -0.3838 model score -0.3776 model score -0.3035 model score -0.3011 model score 0.3482 model score -0.3627 model score -0.4132 model score 0.0057 model score -0.3067 model score -0.4866 model score 1.2764 model score 1.2779 model score 1.2764 model score 1.2769 model score 1.2774 model score -0.2987 model score -0.2869 model score -0.3014 model score -0.0948 model score -0.2408 model score -0.3144 model score -0.3035 model score -0.3011 model score -0.4094 model score -0.3776 model score -0.2842 model score -0.2859 model score -0.2546 model score -0.2331 model score -0.2278 model score 1.2763 model score 1.2765 model score 1.2765 model score 1.2754 model score 1.2753 model score 1.2765 model score 1.2763 model score 1.2753 model score 1.2754 model score 1.2711 model score 2.0852 model score 2.5850 model score 2.4604 model score 2.0833 model score 2.3324 model score -0.3234 model score -0.2373 model score -0.4860 model score -0.4494 model score -0.1219 model score 1.2751 model score 1.2783 model score 1.2763 model score 1.2711 model score 1.2775 model score -0.2343 model score -0.0326 model score -0.2178 model score -0.0205 model score -0.2286 model score 0.5426 model score 2.2862 model score 2.4288 model score 0.9229 model score 0.8157 model score -0.3063 model score -0.3055 model score -0.3564 model score -0.3680 model score -0.3451 model score -0.5603 model score -0.5106 model score -0.1300 model score -0.0294 model score -0.3751 model score -0.3165 model score -0.3513 model score -0.2360 model score -0.0668 model score -0.3421 model score -0.3901 model score -0.3861 model score 1.2771 model score -0.3498 model score -0.3659 model score -0.2417 model score -0.3626 model score -0.4640 model score -0.3311 model score -0.2417 model score -0.4785 model score -0.4135 model score -0.4297 model score -0.5534 model score -0.5441 model score -0.5435 model score -0.5282 model score -0.4535 model score -0.2360 model score -0.3429 model score -0.3489 model score -0.3591 model score -0.3469 model score -0.3017 model score -0.3442 model score -0.4823 model score -0.4732 model score -0.3017 model score -0.3195 model score -0.3464 model score -0.3825 model score -0.0952 model score -0.5096 model score 0.2870 model score -0.3070 model score -0.3943 model score -0.4999 model score -0.4679 model score -0.4476 model score -0.3361 model score -0.3743 model score -0.3524 model score -0.3694 model score -0.3578 model score -0.4632 model score -0.3188 model score -0.3129 model score -0.3711 model score -0.3629 model score -0.2623 model score -0.4257 model score -0.2260 model score -0.4568 model score -0.4380 model score -0.3092 model score -0.4951 model score -0.2802 model score -0.5370 model score -0.5259 model score -0.3753 model score -0.3725 model score -0.2952 model score -0.3738 model score -0.3743 model score -0.3524 model score -0.3115 model score -0.4603 model score -0.4759 model score -0.2974 model score -0.4789 model score 1.2751 model score 1.2759 model score 1.2768 model score 1.2718 model score 1.2753 model score 1.2759 model score 1.2762 model score 1.2751 model score 1.2765 model score 1.2765 model score -0.3461 model score -0.3043 model score -0.1188 model score -0.3693 model score -0.5549 model score -0.3198 model score -0.4008 model score -0.5205 model score -0.5102 model score -0.0613 model score -0.3041 model score -0.3943 model score -0.5197 model score -0.5102 model score -0.1490 model score -0.3302 model score -0.3821 model score -0.3728 model score -0.3307 model score -0.5190 model score 1.2751 model score 1.2765 model score 1.2780 model score 1.2765 model score 1.2789 model score -0.3700 model score 1.2751 model score 1.2765 model score 1.2779 model score 1.2765 model score 1.2778 model score -0.3301 model score -0.2974 model score -0.3197 model score -0.3089 model score -0.3643 model score -0.4914 model score -0.3406 model score 1.2763 model score 1.2765 model score 1.2776 model score 1.2755 model score 1.2720 model score -0.4969 model score -0.4225 model score -0.5116 model score -0.2831 model score -0.5067 model score 2.0229 model score 1.5028 model score 2.2503 model score 1.9532 model score 1.9616 model score -0.4157 model score -0.4995 model score -0.5018 model score -0.3568 model score -0.4426 model score -0.3368 model score -0.4357 model score -0.0729 model score -0.4168 model score -0.3573 model score -0.3510 model score -0.2972 model score -0.1820 model score -0.2093 model score -0.1558 model score -0.3222 model score -0.4682 USE_META, weight: 0.8989 cost: -0.2069 min: -0.5603 max: 2.5850 USE_META, weight: 0.8511 cost: -0.0401 min: -0.5603 max: 2.5850 USE_META, weight: 0.8513 cost: -0.0407 min: -0.5603 max: 2.5850 USE_META, weight: 0.8916 cost: -0.1814 min: -0.5603 max: 2.5850 USE_META, weight: 0.8696 cost: -0.1045 min: -0.5603 max: 2.5850 USE_META, weight: 0.9230 cost: -0.2912 min: -0.5603 max: 2.5850 USE_META, weight: 0.9209 cost: -0.2840 min: -0.5603 max: 2.5850 USE_META, weight: 0.9007 cost: -0.2133 min: -0.5603 max: 2.5850 USE_META, weight: 0.9150 cost: -0.2633 min: -0.5603 max: 2.5850 USE_META, weight: 0.8973 cost: -0.2015 min: -0.5603 max: 2.5850 USE_META, weight: 0.8521 cost: -0.0434 min: -0.5603 max: 2.5850 USE_META, weight: 0.9116 cost: -0.2513 min: -0.5603 max: 2.5850 USE_META, weight: 0.9173 cost: -0.2715 min: -0.5603 max: 2.5850 USE_META, weight: 0.9067 cost: -0.2343 min: -0.5603 max: 2.5850 USE_META, weight: 0.9086 cost: -0.2409 min: -0.5603 max: 2.5850 USE_META, weight: 0.9247 cost: -0.2973 min: -0.5603 max: 2.5850 USE_META, weight: 0.9246 cost: -0.2967 min: -0.5603 max: 2.5850 USE_META, weight: 0.9161 cost: -0.2672 min: -0.5603 max: 2.5850 USE_META, weight: 0.9209 cost: -0.2838 min: -0.5603 max: 2.5850 USE_META, weight: 0.9178 cost: -0.2732 min: -0.5603 max: 2.5850 USE_META, weight: 0.4219 cost: 1.4599 min: -0.5603 max: 2.5850 USE_META, weight: 0.3686 cost: 1.6462 min: -0.5603 max: 2.5850 USE_META, weight: 0.3021 cost: 1.8785 min: -0.5603 max: 2.5850 USE_META, weight: 0.3891 cost: 1.5746 min: -0.5603 max: 2.5850 USE_META, weight: 0.3702 cost: 1.6407 min: -0.5603 max: 2.5850 USE_META, weight: 0.9870 cost: -0.5151 min: -0.5603 max: 2.5850 USE_META, weight: 0.9304 cost: -0.3170 min: -0.5603 max: 2.5850 USE_META, weight: 0.8703 cost: -0.1071 min: -0.5603 max: 2.5850 USE_META, weight: 0.9607 cost: -0.4228 min: -0.5603 max: 2.5850 USE_META, weight: 0.9635 cost: -0.4329 min: -0.5603 max: 2.5850 USE_META, weight: 0.9605 cost: -0.4225 min: -0.5603 max: 2.5850 USE_META, weight: 0.9568 cost: -0.4094 min: -0.5603 max: 2.5850 USE_META, weight: 0.9495 cost: -0.3838 min: -0.5603 max: 2.5850 USE_META, weight: 0.9477 cost: -0.3776 min: -0.5603 max: 2.5850 USE_META, weight: 0.9265 cost: -0.3035 min: -0.5603 max: 2.5850 USE_META, weight: 0.9258 cost: -0.3011 min: -0.5603 max: 2.5850 USE_META, weight: 0.7400 cost: 0.3482 min: -0.5603 max: 2.5850 USE_META, weight: 0.9434 cost: -0.3627 min: -0.5603 max: 2.5850 USE_META, weight: 0.9579 cost: -0.4132 min: -0.5603 max: 2.5850 USE_META, weight: 0.8380 cost: 0.0057 min: -0.5603 max: 2.5850 USE_META, weight: 0.9274 cost: -0.3067 min: -0.5603 max: 2.5850 USE_META, weight: 0.9789 cost: -0.4866 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2764 min: -0.5603 max: 2.5850 USE_META, weight: 0.4740 cost: 1.2779 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2764 min: -0.5603 max: 2.5850 USE_META, weight: 0.4743 cost: 1.2769 min: -0.5603 max: 2.5850 USE_META, weight: 0.4742 cost: 1.2774 min: -0.5603 max: 2.5850 USE_META, weight: 0.9251 cost: -0.2987 min: -0.5603 max: 2.5850 USE_META, weight: 0.9217 cost: -0.2869 min: -0.5603 max: 2.5850 USE_META, weight: 0.9259 cost: -0.3014 min: -0.5603 max: 2.5850 USE_META, weight: 0.8668 cost: -0.0948 min: -0.5603 max: 2.5850 USE_META, weight: 0.9086 cost: -0.2408 min: -0.5603 max: 2.5850 USE_META, weight: 0.9296 cost: -0.3144 min: -0.5603 max: 2.5850 USE_META, weight: 0.9265 cost: -0.3035 min: -0.5603 max: 2.5850 USE_META, weight: 0.9258 cost: -0.3011 min: -0.5603 max: 2.5850 USE_META, weight: 0.9568 cost: -0.4094 min: -0.5603 max: 2.5850 USE_META, weight: 0.9477 cost: -0.3776 min: -0.5603 max: 2.5850 USE_META, weight: 0.9210 cost: -0.2842 min: -0.5603 max: 2.5850 USE_META, weight: 0.9215 cost: -0.2859 min: -0.5603 max: 2.5850 USE_META, weight: 0.9125 cost: -0.2546 min: -0.5603 max: 2.5850 USE_META, weight: 0.9064 cost: -0.2331 min: -0.5603 max: 2.5850 USE_META, weight: 0.9048 cost: -0.2278 min: -0.5603 max: 2.5850 USE_META, weight: 0.4745 cost: 1.2763 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4747 cost: 1.2754 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2753 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4745 cost: 1.2763 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2753 min: -0.5603 max: 2.5850 USE_META, weight: 0.4747 cost: 1.2754 min: -0.5603 max: 2.5850 USE_META, weight: 0.4760 cost: 1.2711 min: -0.5603 max: 2.5850 USE_META, weight: 0.2430 cost: 2.0852 min: -0.5603 max: 2.5850 USE_META, weight: 0.1000 cost: 2.5850 min: -0.5603 max: 2.5850 USE_META, weight: 0.1357 cost: 2.4604 min: -0.5603 max: 2.5850 USE_META, weight: 0.2435 cost: 2.0833 min: -0.5603 max: 2.5850 USE_META, weight: 0.1723 cost: 2.3324 min: -0.5603 max: 2.5850 USE_META, weight: 0.9322 cost: -0.3234 min: -0.5603 max: 2.5850 USE_META, weight: 0.9076 cost: -0.2373 min: -0.5603 max: 2.5850 USE_META, weight: 0.9787 cost: -0.4860 min: -0.5603 max: 2.5850 USE_META, weight: 0.9683 cost: -0.4494 min: -0.5603 max: 2.5850 USE_META, weight: 0.8745 cost: -0.1219 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2751 min: -0.5603 max: 2.5850 USE_META, weight: 0.4739 cost: 1.2783 min: -0.5603 max: 2.5850 USE_META, weight: 0.4745 cost: 1.2763 min: -0.5603 max: 2.5850 USE_META, weight: 0.4760 cost: 1.2711 min: -0.5603 max: 2.5850 USE_META, weight: 0.4741 cost: 1.2775 min: -0.5603 max: 2.5850 USE_META, weight: 0.9067 cost: -0.2343 min: -0.5603 max: 2.5850 USE_META, weight: 0.8490 cost: -0.0326 min: -0.5603 max: 2.5850 USE_META, weight: 0.9020 cost: -0.2178 min: -0.5603 max: 2.5850 USE_META, weight: 0.8455 cost: -0.0205 min: -0.5603 max: 2.5850 USE_META, weight: 0.9051 cost: -0.2286 min: -0.5603 max: 2.5850 USE_META, weight: 0.6844 cost: 0.5426 min: -0.5603 max: 2.5850 USE_META, weight: 0.1855 cost: 2.2862 min: -0.5603 max: 2.5850 USE_META, weight: 0.1447 cost: 2.4288 min: -0.5603 max: 2.5850 USE_META, weight: 0.5756 cost: 0.9229 min: -0.5603 max: 2.5850 USE_META, weight: 0.6063 cost: 0.8157 min: -0.5603 max: 2.5850 USE_META, weight: 0.9273 cost: -0.3063 min: -0.5603 max: 2.5850 USE_META, weight: 0.9271 cost: -0.3055 min: -0.5603 max: 2.5850 USE_META, weight: 0.9416 cost: -0.3564 min: -0.5603 max: 2.5850 USE_META, weight: 0.9450 cost: -0.3680 min: -0.5603 max: 2.5850 USE_META, weight: 0.9384 cost: -0.3451 min: -0.5603 max: 2.5850 USE_META, weight: 1.0000 cost: -0.5603 min: -0.5603 max: 2.5850 USE_META, weight: 0.9858 cost: -0.5106 min: -0.5603 max: 2.5850 USE_META, weight: 0.8769 cost: -0.1300 min: -0.5603 max: 2.5850 USE_META, weight: 0.8481 cost: -0.0294 min: -0.5603 max: 2.5850 USE_META, weight: 0.9470 cost: -0.3751 min: -0.5603 max: 2.5850 USE_META, weight: 0.9302 cost: -0.3165 min: -0.5603 max: 2.5850 USE_META, weight: 0.9402 cost: -0.3513 min: -0.5603 max: 2.5850 USE_META, weight: 0.9072 cost: -0.2360 min: -0.5603 max: 2.5850 USE_META, weight: 0.8588 cost: -0.0668 min: -0.5603 max: 2.5850 USE_META, weight: 0.9376 cost: -0.3421 min: -0.5603 max: 2.5850 USE_META, weight: 0.9513 cost: -0.3901 min: -0.5603 max: 2.5850 USE_META, weight: 0.9501 cost: -0.3861 min: -0.5603 max: 2.5850 USE_META, weight: 0.4742 cost: 1.2771 min: -0.5603 max: 2.5850 USE_META, weight: 0.9397 cost: -0.3498 min: -0.5603 max: 2.5850 USE_META, weight: 0.9444 cost: -0.3659 min: -0.5603 max: 2.5850 USE_META, weight: 0.9088 cost: -0.2417 min: -0.5603 max: 2.5850 USE_META, weight: 0.9434 cost: -0.3626 min: -0.5603 max: 2.5850 USE_META, weight: 0.9724 cost: -0.4640 min: -0.5603 max: 2.5850 USE_META, weight: 0.9344 cost: -0.3311 min: -0.5603 max: 2.5850 USE_META, weight: 0.9088 cost: -0.2417 min: -0.5603 max: 2.5850 USE_META, weight: 0.9766 cost: -0.4785 min: -0.5603 max: 2.5850 USE_META, weight: 0.9580 cost: -0.4135 min: -0.5603 max: 2.5850 USE_META, weight: 0.9626 cost: -0.4297 min: -0.5603 max: 2.5850 USE_META, weight: 0.9980 cost: -0.5534 min: -0.5603 max: 2.5850 USE_META, weight: 0.9954 cost: -0.5441 min: -0.5603 max: 2.5850 USE_META, weight: 0.9952 cost: -0.5435 min: -0.5603 max: 2.5850 USE_META, weight: 0.9908 cost: -0.5282 min: -0.5603 max: 2.5850 USE_META, weight: 0.9694 cost: -0.4535 min: -0.5603 max: 2.5850 USE_META, weight: 0.9072 cost: -0.2360 min: -0.5603 max: 2.5850 USE_META, weight: 0.9378 cost: -0.3429 min: -0.5603 max: 2.5850 USE_META, weight: 0.9395 cost: -0.3489 min: -0.5603 max: 2.5850 USE_META, weight: 0.9424 cost: -0.3591 min: -0.5603 max: 2.5850 USE_META, weight: 0.9389 cost: -0.3469 min: -0.5603 max: 2.5850 USE_META, weight: 0.9260 cost: -0.3017 min: -0.5603 max: 2.5850 USE_META, weight: 0.9382 cost: -0.3442 min: -0.5603 max: 2.5850 USE_META, weight: 0.9777 cost: -0.4823 min: -0.5603 max: 2.5850 USE_META, weight: 0.9751 cost: -0.4732 min: -0.5603 max: 2.5850 USE_META, weight: 0.9260 cost: -0.3017 min: -0.5603 max: 2.5850 USE_META, weight: 0.9311 cost: -0.3195 min: -0.5603 max: 2.5850 USE_META, weight: 0.9388 cost: -0.3464 min: -0.5603 max: 2.5850 USE_META, weight: 0.9491 cost: -0.3825 min: -0.5603 max: 2.5850 USE_META, weight: 0.8669 cost: -0.0952 min: -0.5603 max: 2.5850 USE_META, weight: 0.9855 cost: -0.5096 min: -0.5603 max: 2.5850 USE_META, weight: 0.7575 cost: 0.2870 min: -0.5603 max: 2.5850 USE_META, weight: 0.9275 cost: -0.3070 min: -0.5603 max: 2.5850 USE_META, weight: 0.9525 cost: -0.3943 min: -0.5603 max: 2.5850 USE_META, weight: 0.9827 cost: -0.4999 min: -0.5603 max: 2.5850 USE_META, weight: 0.9735 cost: -0.4679 min: -0.5603 max: 2.5850 USE_META, weight: 0.9677 cost: -0.4476 min: -0.5603 max: 2.5850 USE_META, weight: 0.9358 cost: -0.3361 min: -0.5603 max: 2.5850 USE_META, weight: 0.9468 cost: -0.3743 min: -0.5603 max: 2.5850 USE_META, weight: 0.9405 cost: -0.3524 min: -0.5603 max: 2.5850 USE_META, weight: 0.9454 cost: -0.3694 min: -0.5603 max: 2.5850 USE_META, weight: 0.9420 cost: -0.3578 min: -0.5603 max: 2.5850 USE_META, weight: 0.9722 cost: -0.4632 min: -0.5603 max: 2.5850 USE_META, weight: 0.9309 cost: -0.3188 min: -0.5603 max: 2.5850 USE_META, weight: 0.9292 cost: -0.3129 min: -0.5603 max: 2.5850 USE_META, weight: 0.9459 cost: -0.3711 min: -0.5603 max: 2.5850 USE_META, weight: 0.9435 cost: -0.3629 min: -0.5603 max: 2.5850 USE_META, weight: 0.9147 cost: -0.2623 min: -0.5603 max: 2.5850 USE_META, weight: 0.9615 cost: -0.4257 min: -0.5603 max: 2.5850 USE_META, weight: 0.9043 cost: -0.2260 min: -0.5603 max: 2.5850 USE_META, weight: 0.9704 cost: -0.4568 min: -0.5603 max: 2.5850 USE_META, weight: 0.9650 cost: -0.4380 min: -0.5603 max: 2.5850 USE_META, weight: 0.9281 cost: -0.3092 min: -0.5603 max: 2.5850 USE_META, weight: 0.9813 cost: -0.4951 min: -0.5603 max: 2.5850 USE_META, weight: 0.9198 cost: -0.2802 min: -0.5603 max: 2.5850 USE_META, weight: 0.9933 cost: -0.5370 min: -0.5603 max: 2.5850 USE_META, weight: 0.9901 cost: -0.5259 min: -0.5603 max: 2.5850 USE_META, weight: 0.9471 cost: -0.3753 min: -0.5603 max: 2.5850 USE_META, weight: 0.9462 cost: -0.3725 min: -0.5603 max: 2.5850 USE_META, weight: 0.9241 cost: -0.2952 min: -0.5603 max: 2.5850 USE_META, weight: 0.9466 cost: -0.3738 min: -0.5603 max: 2.5850 USE_META, weight: 0.9468 cost: -0.3743 min: -0.5603 max: 2.5850 USE_META, weight: 0.9405 cost: -0.3524 min: -0.5603 max: 2.5850 USE_META, weight: 0.9288 cost: -0.3115 min: -0.5603 max: 2.5850 USE_META, weight: 0.9714 cost: -0.4603 min: -0.5603 max: 2.5850 USE_META, weight: 0.9758 cost: -0.4759 min: -0.5603 max: 2.5850 USE_META, weight: 0.9247 cost: -0.2974 min: -0.5603 max: 2.5850 USE_META, weight: 0.9767 cost: -0.4789 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2751 min: -0.5603 max: 2.5850 USE_META, weight: 0.4746 cost: 1.2759 min: -0.5603 max: 2.5850 USE_META, weight: 0.4743 cost: 1.2768 min: -0.5603 max: 2.5850 USE_META, weight: 0.4758 cost: 1.2718 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2753 min: -0.5603 max: 2.5850 USE_META, weight: 0.4746 cost: 1.2759 min: -0.5603 max: 2.5850 USE_META, weight: 0.4745 cost: 1.2762 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2751 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.9387 cost: -0.3461 min: -0.5603 max: 2.5850 USE_META, weight: 0.9267 cost: -0.3043 min: -0.5603 max: 2.5850 USE_META, weight: 0.8737 cost: -0.1188 min: -0.5603 max: 2.5850 USE_META, weight: 0.9453 cost: -0.3693 min: -0.5603 max: 2.5850 USE_META, weight: 0.9985 cost: -0.5549 min: -0.5603 max: 2.5850 USE_META, weight: 0.9312 cost: -0.3198 min: -0.5603 max: 2.5850 USE_META, weight: 0.9543 cost: -0.4008 min: -0.5603 max: 2.5850 USE_META, weight: 0.9886 cost: -0.5205 min: -0.5603 max: 2.5850 USE_META, weight: 0.9856 cost: -0.5102 min: -0.5603 max: 2.5850 USE_META, weight: 0.8572 cost: -0.0613 min: -0.5603 max: 2.5850 USE_META, weight: 0.9267 cost: -0.3041 min: -0.5603 max: 2.5850 USE_META, weight: 0.9525 cost: -0.3943 min: -0.5603 max: 2.5850 USE_META, weight: 0.9884 cost: -0.5197 min: -0.5603 max: 2.5850 USE_META, weight: 0.9856 cost: -0.5102 min: -0.5603 max: 2.5850 USE_META, weight: 0.8823 cost: -0.1490 min: -0.5603 max: 2.5850 USE_META, weight: 0.9341 cost: -0.3302 min: -0.5603 max: 2.5850 USE_META, weight: 0.9490 cost: -0.3821 min: -0.5603 max: 2.5850 USE_META, weight: 0.9463 cost: -0.3728 min: -0.5603 max: 2.5850 USE_META, weight: 0.9343 cost: -0.3307 min: -0.5603 max: 2.5850 USE_META, weight: 0.9882 cost: -0.5190 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2751 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4740 cost: 1.2780 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4737 cost: 1.2789 min: -0.5603 max: 2.5850 USE_META, weight: 0.9455 cost: -0.3700 min: -0.5603 max: 2.5850 USE_META, weight: 0.4748 cost: 1.2751 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4740 cost: 1.2779 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4740 cost: 1.2778 min: -0.5603 max: 2.5850 USE_META, weight: 0.9341 cost: -0.3301 min: -0.5603 max: 2.5850 USE_META, weight: 0.9248 cost: -0.2974 min: -0.5603 max: 2.5850 USE_META, weight: 0.9311 cost: -0.3197 min: -0.5603 max: 2.5850 USE_META, weight: 0.9280 cost: -0.3089 min: -0.5603 max: 2.5850 USE_META, weight: 0.9439 cost: -0.3643 min: -0.5603 max: 2.5850 USE_META, weight: 0.9803 cost: -0.4914 min: -0.5603 max: 2.5850 USE_META, weight: 0.9371 cost: -0.3406 min: -0.5603 max: 2.5850 USE_META, weight: 0.4745 cost: 1.2763 min: -0.5603 max: 2.5850 USE_META, weight: 0.4744 cost: 1.2765 min: -0.5603 max: 2.5850 USE_META, weight: 0.4741 cost: 1.2776 min: -0.5603 max: 2.5850 USE_META, weight: 0.4747 cost: 1.2755 min: -0.5603 max: 2.5850 USE_META, weight: 0.4757 cost: 1.2720 min: -0.5603 max: 2.5850 USE_META, weight: 0.9818 cost: -0.4969 min: -0.5603 max: 2.5850 USE_META, weight: 0.9606 cost: -0.4225 min: -0.5603 max: 2.5850 USE_META, weight: 0.9861 cost: -0.5116 min: -0.5603 max: 2.5850 USE_META, weight: 0.9207 cost: -0.2831 min: -0.5603 max: 2.5850 USE_META, weight: 0.9847 cost: -0.5067 min: -0.5603 max: 2.5850 USE_META, weight: 0.2608 cost: 2.0229 min: -0.5603 max: 2.5850 USE_META, weight: 0.4097 cost: 1.5028 min: -0.5603 max: 2.5850 USE_META, weight: 0.1958 cost: 2.2503 min: -0.5603 max: 2.5850 USE_META, weight: 0.2808 cost: 1.9532 min: -0.5603 max: 2.5850 USE_META, weight: 0.2784 cost: 1.9616 min: -0.5603 max: 2.5850 USE_META, weight: 0.9586 cost: -0.4157 min: -0.5603 max: 2.5850 USE_META, weight: 0.9826 cost: -0.4995 min: -0.5603 max: 2.5850 USE_META, weight: 0.9832 cost: -0.5018 min: -0.5603 max: 2.5850 USE_META, weight: 0.9418 cost: -0.3568 min: -0.5603 max: 2.5850 USE_META, weight: 0.9663 cost: -0.4426 min: -0.5603 max: 2.5850 USE_META, weight: 0.9360 cost: -0.3368 min: -0.5603 max: 2.5850 USE_META, weight: 0.9643 cost: -0.4357 min: -0.5603 max: 2.5850 USE_META, weight: 0.8605 cost: -0.0729 min: -0.5603 max: 2.5850 USE_META, weight: 0.9589 cost: -0.4168 min: -0.5603 max: 2.5850 USE_META, weight: 0.9419 cost: -0.3573 min: -0.5603 max: 2.5850 USE_META, weight: 0.9401 cost: -0.3510 min: -0.5603 max: 2.5850 USE_META, weight: 0.9247 cost: -0.2972 min: -0.5603 max: 2.5850 USE_META, weight: 0.8918 cost: -0.1820 min: -0.5603 max: 2.5850 USE_META, weight: 0.8995 cost: -0.2093 min: -0.5603 max: 2.5850 USE_META, weight: 0.8843 cost: -0.1558 min: -0.5603 max: 2.5850 USE_META, weight: 0.9319 cost: -0.3222 min: -0.5603 max: 2.5850 USE_META, weight: 0.9736 cost: -0.4682 min: -0.5603 max: 2.5850 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9977 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9977 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9977 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9877 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9877 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.9877 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.1004 eval: 0.0002 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.1004 eval: 0.0002 min: 0.0000 max: 0.0002 USE_EVALUE, weight: 0.1004 eval: 0.0002 min: 0.0000 max: 0.0002 Number of contacts in models: 262 Number of contacts in alignments: 123 NUMB_ALIGNS: 123 Adding 7480 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -346.5890, CN propb: -346.5890 weights: 0.3725 constraints: 503 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 503 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 503 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 6977 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 6977 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 7480 # command: