# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0356/ # command:# Making conformation for sequence T0356 numbered 1 through 505 Created new target T0356 from T0356.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0356/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0356//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0356/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0356//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0356/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0356/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0356/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1e9rA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1e9rA expands to /projects/compbio/data/pdb/1e9r.pdb.gz 1e9rA:# T0356 read from 1e9rA/merged-good-all-a2m # 1e9rA read from 1e9rA/merged-good-all-a2m # adding 1e9rA to template set # found chain 1e9rA in template set T0356 28 :PVDPHLEITEIADRTLR 1e9rA 133 :GTGKSVLLRELAYTGLL # choosing archetypes in rotamer library T0356 393 :MYTKFVIVCDDD 1e9rA 150 :RGDRMVIVDPNG T0356 417 :ITTRMDPARDTVLVENTP 1e9rA 163 :MLSKFGRDKDIILNPYDQ T0356 435 :IDYLDFASPVSG 1e9rA 185 :WSFFNEIRNDYD T0356 470 :PIKKDPDVVAHID 1e9rA 206 :PRGKTDEAEEWAS Number of specific fragments extracted= 5 number of extra gaps= 0 total=5 Number of alignments=1 # 1e9rA read from 1e9rA/merged-good-all-a2m # found chain 1e9rA in template set T0356 341 :VPILQKQFPE 1e9rA 96 :GGKLKRMTRE T0356 351 :IVDFYLPPEGCSYRLAV 1e9rA 112 :VAGVPMPRDAEPRHLLV T0356 374 :YAGHAKRVMMGVWSFLRQFMYTKFVIVCDDD 1e9rA 131 :ATGTGKSVLLRELAYTGLLRGDRMVIVDPNG T0356 417 :ITTRMDPARDTVLVENTPIDY 1e9rA 163 :MLSKFGRDKDIILNPYDQRTK T0356 438 :LDFASPVSG 1e9rA 185 :WSFFNEIRN T0356 460 :PGETQR 1e9rA 194 :DYDWQR T0356 470 :PIKKDPDVVAHID 1e9rA 206 :PRGKTDEAEEWAS Number of specific fragments extracted= 7 number of extra gaps= 0 total=12 Number of alignments=2 # 1e9rA read from 1e9rA/merged-good-all-a2m # found chain 1e9rA in template set T0356 313 :EDAIYHSTYTGRPPDEP 1e9rA 106 :KAKQVTVAGVPMPRDAE T0356 349 :PEIVDFYLPPEGC 1e9rA 123 :PRHLLVNGATGTG T0356 375 :AGHAKRVMMGVWS 1e9rA 137 :SVLLRELAYTGLL T0356 393 :MYTKFVIVCDDD 1e9rA 150 :RGDRMVIVDPNG T0356 417 :ITTRMDPARDTVLVENTPIDYLDFASPVSG 1e9rA 163 :MLSKFGRDKDIILNPYDQRTKGWSFFNEIR T0356 470 :PIKKDPDVVAHID 1e9rA 206 :PRGKTDEAEEWAS Number of specific fragments extracted= 6 number of extra gaps= 0 total=18 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0356 read from 2fcr/merged-good-all-a2m # 2fcr read from 2fcr/merged-good-all-a2m # found chain 2fcr in training set Warning: unaligning (T0356)E213 because of BadResidue code BAD_PEPTIDE in next template residue (2fcr)D84 Warning: unaligning (T0356)R214 because of BadResidue code BAD_PEPTIDE at template residue (2fcr)D84 T0356 50 :LLFE 2fcr 4 :IFFS T0356 78 :GQEDV 2fcr 8 :TSTGN T0356 85 :LREVGKLLA 2fcr 13 :TTEVADFIG T0356 109 :DKLPQF 2fcr 22 :KTLGAK T0356 119 :NMPTKRLR 2fcr 28 :ADAPIDVD T0356 137 :GDDVDLNRIPI 2fcr 38 :TDPQALKDYDL T0356 160 :TWGLTVTRGPHKERQNL 2fcr 49 :LFLGAPTWNTGADTERS T0356 196 :HRGGALDYQE 2fcr 66 :GTSWDEFLYD T0356 208 :A 2fcr 76 :K T0356 215 :FPVSVALGAD 2fcr 85 :LPVAIFGLGD T0356 234 :PVPDTL 2fcr 97 :GYPDNF T0356 240 :SEYAFAGLLRGTKTEVV 2fcr 105 :AIEEIHDCFAKQGAKPV T0356 275 :GYIEQ 2fcr 122 :GFSNP T0356 284 :PEGPYGDHTGYYNEV 2fcr 127 :DDYDYEESKSVRDGK T0356 315 :AIYHSTYTGRPPDEPA 2fcr 143 :LGLPLDMVNDQIPMEK T0356 336 :LNEVFVPILQKQ 2fcr 159 :RVAGWVEAVVSE Number of specific fragments extracted= 16 number of extra gaps= 1 total=34 Number of alignments=4 # 2fcr read from 2fcr/merged-good-all-a2m # found chain 2fcr in training set T0356 30 :DPHLEITEIADRTLRAGGPALLFENPKGYSM 2fcr 101 :NFCDAIEEIHDCFAKQGAKPVGFSNPDDYDY T0356 62 :VLCNLFGT 2fcr 145 :LPLDMVND T0356 79 :QEDV 2fcr 153 :QIPM T0356 83 :SALREVGK 2fcr 158 :KRVAGWVE T0356 91 :LLAF 2fcr 167 :VVSE Number of specific fragments extracted= 5 number of extra gaps= 0 total=39 Number of alignments=5 # 2fcr read from 2fcr/merged-good-all-a2m # found chain 2fcr in training set T0356 100 :PPKGFRDLFDKLPQFKQVLNMPTKRLRGA 2fcr 9 :STGNTTEVADFIGKTLGAKADAPIDVDDV T0356 137 :GDDVDLNRIP 2fcr 38 :TDPQALKDYD T0356 217 :V 2fcr 48 :L T0356 219 :VALG 2fcr 49 :LFLG T0356 256 :VKCISNDLEVP 2fcr 53 :APTWNTGADTE T0356 321 :YTGR 2fcr 64 :RSGT T0356 339 :VFVPILQKQFPEI 2fcr 68 :SWDEFLYDKLPEV T0356 393 :MYTKFVIVC 2fcr 85 :LPVAIFGLG T0356 402 :DDDVNARDWNDVIWAITTR 2fcr 98 :YPDNFCDAIEEIHDCFAKQ T0356 421 :MDPAR 2fcr 124 :SNPDD T0356 435 :IDYLDFASPVSGLGSKMGLDATNKWPGE 2fcr 129 :YDYEESKSVRDGKFLGLPLDMVNDQIPM T0356 474 :DPDVVAHIDAIWDELA 2fcr 157 :EKRVAGWVEAVVSETG Number of specific fragments extracted= 12 number of extra gaps= 0 total=51 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vheA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vheA expands to /projects/compbio/data/pdb/1vhe.pdb.gz 1vheA:Skipped atom 28, because occupancy 0.4 <= existing 0.600 in 1vheA Skipped atom 30, because occupancy 0.400 <= existing 0.600 in 1vheA Skipped atom 32, because occupancy 0.400 <= existing 0.600 in 1vheA Skipped atom 34, because occupancy 0.400 <= existing 0.600 in 1vheA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 244, because occupancy 0.350 <= existing 0.650 in 1vheA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1294, because occupancy 0.500 <= existing 0.500 in 1vheA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1296, because occupancy 0.500 <= existing 0.500 in 1vheA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2469, because occupancy 0.350 <= existing 0.650 in 1vheA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2471, because occupancy 0.350 <= existing 0.650 in 1vheA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2473, because occupancy 0.350 <= existing 0.650 in 1vheA Skipped atom 2760, because occupancy 0.350 <= existing 0.650 in 1vheA # T0356 read from 1vheA/merged-good-all-a2m # 1vheA read from 1vheA/merged-good-all-a2m # adding 1vheA to template set # found chain 1vheA in template set Warning: unaligning (T0356)P329 because of BadResidue code BAD_PEPTIDE in next template residue (1vheA)N183 Warning: unaligning (T0356)A330 because of BadResidue code BAD_PEPTIDE at template residue (1vheA)N183 T0356 79 :QE 1vheA 4 :LD T0356 83 :SALREVGKLLA 1vheA 6 :ETLTMLKDLTD T0356 97 :EPEPPKGFRDLFDKLPQFKQVLNMPTKRLRGAPC 1vheA 17 :AKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSL T0356 163 :LTVTRGPHKERQ 1vheA 51 :IAKKTGAENGPK T0356 175 :NLGIYRQQLIGKNKLIMRWLSH 1vheA 71 :EVGFMVTQITDKGFIRFQTVGG T0356 208 :AAHPGER 1vheA 96 :QVMLAQR T0356 269 :AEIV 1vheA 103 :VTIV T0356 273 :LEGYI 1vheA 112 :ITGVI T0356 278 :EQGETAPE 1vheA 120 :PPHILSPE T0356 290 :DHTGYYNEVDSFPV 1vheA 164 :HFEFTVMNNEKFLL T0356 320 :T 1vheA 178 :A T0356 326 :PDE 1vheA 179 :KAW T0356 331 :VLGVALNEVFVPILQKQ 1vheA 184 :RIGCAIAIDVLRNLQNT T0356 348 :FP 1vheA 202 :HP T0356 351 :IVDFYLPPEGCSY 1vheA 206 :VYGVGTVQEEVGL T0356 376 :GHAKRVMMGV 1vheA 219 :RGAKTAAHTI T0356 394 :YTKFVIVCD 1vheA 229 :QPDIAFGVD T0356 427 :TVLVENTPIDYLDFASPVSGLGSKMG 1vheA 238 :VGIAGDTPGISEKEAQSKMGKGPQII T0356 471 :IKKDPDVVAHIDAIWDELAIF 1vheA 269 :MVSHKGLRDAVVATAEEAGIP Number of specific fragments extracted= 19 number of extra gaps= 1 total=70 Number of alignments=7 # 1vheA read from 1vheA/merged-good-all-a2m # found chain 1vheA in template set Warning: unaligning (T0356)P329 because of BadResidue code BAD_PEPTIDE in next template residue (1vheA)N183 Warning: unaligning (T0356)A330 because of BadResidue code BAD_PEPTIDE at template residue (1vheA)N183 T0356 80 :E 1vheA 5 :D T0356 83 :SALREVGKLLA 1vheA 6 :ETLTMLKDLTD T0356 97 :EPEPPKGFRDLFDKLPQFKQVLNMPTKRLR 1vheA 17 :AKGIPGNEREVRQVMKSYIEPFADEVTTDR T0356 161 :WGLTVTR 1vheA 47 :LGSLIAK T0356 168 :G 1vheA 55 :T T0356 169 :PHKERQ 1vheA 57 :AENGPK T0356 175 :NLGIYRQQLIGKNKLIMRWLSH 1vheA 71 :EVGFMVTQITDKGFIRFQTVGG T0356 263 :LE 1vheA 93 :WW T0356 267 :ASAEIVLEG 1vheA 99 :LAQRVTIVT T0356 288 :YGDHTGYYN 1vheA 109 :KGEITGVIG T0356 297 :EVDSF 1vheA 120 :PPHIL T0356 302 :PVFTVT 1vheA 138 :MFIDIG T0356 312 :REDAIYHSTYTGRPPDE 1vheA 157 :PGDMIVPHFEFTVMNNE T0356 331 :VLGVALNEVFVPILQKQ 1vheA 184 :RIGCAIAIDVLRNLQNT T0356 348 :FP 1vheA 202 :HP T0356 351 :IVDFYLPPEGCSYR 1vheA 206 :VYGVGTVQEEVGLR T0356 377 :HAKRVMMGV 1vheA 220 :GAKTAAHTI T0356 394 :YTKFVIVCD 1vheA 229 :QPDIAFGVD T0356 427 :TVLVENTPIDYLDFASPVSGLGSKMG 1vheA 238 :VGIAGDTPGISEKEAQSKMGKGPQII T0356 454 :DAT 1vheA 266 :DAS T0356 471 :IKKDPDVVAHIDAIWDELAIF 1vheA 269 :MVSHKGLRDAVVATAEEAGIP Number of specific fragments extracted= 21 number of extra gaps= 1 total=91 Number of alignments=8 # 1vheA read from 1vheA/merged-good-all-a2m # found chain 1vheA in template set Warning: unaligning (T0356)E80 because first residue in template chain is (1vheA)K3 Warning: unaligning (T0356)P329 because of BadResidue code BAD_PEPTIDE in next template residue (1vheA)N183 Warning: unaligning (T0356)A330 because of BadResidue code BAD_PEPTIDE at template residue (1vheA)N183 T0356 81 :DVSALREVGKLLAF 1vheA 4 :LDETLTMLKDLTDA T0356 98 :PEPPKGFRDLFDKLPQFKQVLNMPTKRLRGA 1vheA 18 :KGIPGNEREVRQVMKSYIEPFADEVTTDRLG T0356 161 :WGLTVTRGPHKE 1vheA 49 :SLIAKKTGAENG T0356 173 :RQNLGIYRQQLIGKNKLIMRWLSHRGGA 1vheA 69 :LDEVGFMVTQITDKGFIRFQTVGGWWAQ T0356 247 :LLRGTKTEVV 1vheA 97 :VMLAQRVTIV T0356 273 :LEGYI 1vheA 112 :ITGVI T0356 278 :EQGETAPEGP 1vheA 120 :PPHILSPEAR T0356 288 :YGD 1vheA 164 :HFE T0356 293 :GYYNEVDSFPVF 1vheA 167 :FTVMNNEKFLLA T0356 326 :PDE 1vheA 179 :KAW T0356 331 :VLGVALNEVFVPILQKQFPE 1vheA 184 :RIGCAIAIDVLRNLQNTDHP T0356 351 :IVDFYLPPEGCSY 1vheA 206 :VYGVGTVQEEVGL T0356 376 :GHAKRVMMGV 1vheA 219 :RGAKTAAHTI T0356 394 :YTKFVIVC 1vheA 229 :QPDIAFGV T0356 426 :DTVLVENTPIDYLDFASPVSGLGSKMG 1vheA 237 :DVGIAGDTPGISEKEAQSKMGKGPQII T0356 471 :IKKDPDVVAHIDAIWDELAI 1vheA 269 :MVSHKGLRDAVVATAEEAGI Number of specific fragments extracted= 16 number of extra gaps= 1 total=107 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q7zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0356 read from 1q7zA/merged-good-all-a2m # 1q7zA read from 1q7zA/merged-good-all-a2m # found chain 1q7zA in training set T0356 6 :YNDLRDFLTLLEQQG 1q7zA 125 :YENFRETVEIMVEEG T0356 29 :VDPHLEITEIADRTLRA 1q7zA 148 :FSDILELKAAVLAAREV T0356 46 :GGPALLFENP 1q7zA 167 :DVFLIAHMTF T0356 56 :KG 1q7zA 179 :KG T0356 58 :YSMPVLC 1q7zA 198 :LDIDALG T0356 65 :NLFGTPKRVA 1q7zA 206 :NCSLGPEEIL T0356 83 :SALREVGK 1q7zA 216 :PIFQELSQ T0356 158 :LITWGLTVTRGPHKERQ 1q7zA 224 :YTDKFLVVEPNAGKPIV T0356 185 :GKNKLI 1q7zA 241 :ENGKTV T0356 194 :LSHRGGALDYQEWCAAH 1q7zA 249 :LKPHDFAVHIDSYYELG T0356 217 :VSVALGA 1q7zA 266 :VNIFGGC T0356 224 :DPAT 1q7zA 276 :TPEH T0356 241 :EYAFAGLLRGTKTEVVKCIS 1q7zA 280 :VKLFRKVLGNRKPLQRKKKR T0356 262 :DLEVPAS 1q7zA 300 :IFAVSSP T0356 307 :THITQREDAIYHSTYT 1q7zA 307 :SKLVTFDHFVVIGERI T0356 324 :RPPDEPAVLGVAL 1q7zA 323 :NPAGRKKLWAEMQ T0356 337 :NEVFVPILQKQFP 1q7zA 339 :EEIVIKEAKTQVE T0356 350 :EIVDFYLPPEGCS 1q7zA 355 :EVLDVNFGIESQI T0356 374 :YAGHAKRVMMGVWSFLRQF 1q7zA 368 :DVRYVEKIVQTLPYVSNVP T0356 398 :VIV 1q7zA 387 :LSL T0356 406 :NARDWNDVIWAITTRM 1q7zA 390 :DIQNVDLTERALRAYP T0356 426 :DTVLVENTPID 1q7zA 406 :GRSLFNSAKVD T0356 447 :LGSKMGLDATNK 1q7zA 430 :YGGTLIVLLMGK T0356 469 :RPIKKDP 1q7zA 442 :DVPKSFE T0356 476 :DVVAHIDAIWDELAIFN 1q7zA 452 :EYFEKALKILERHDFSD Number of specific fragments extracted= 25 number of extra gaps= 0 total=132 Number of alignments=10 # 1q7zA read from 1q7zA/merged-good-all-a2m # found chain 1q7zA in training set T0356 9 :LRDFLTLLE 1q7zA 121 :FEEFYENFR T0356 37 :EIADRTLRAGGPALLFENP 1q7zA 130 :ETVEIMVEEGVDGIIFETF T0356 57 :GYSMPVLCNLFG 1q7zA 165 :SRDVFLIAHMTF T0356 69 :TPKRVAMGM 1q7zA 187 :DPANFAITF T0356 85 :LREVGKLLAF 1q7zA 211 :PEEILPIFQE T0356 114 :FKQ 1q7zA 221 :LSQ T0356 158 :LITWGLTVTRGPHKERQ 1q7zA 224 :YTDKFLVVEPNAGKPIV T0356 185 :GKNK 1q7zA 241 :ENGK T0356 194 :LSHRGGALDYQEWCAA 1q7zA 249 :LKPHDFAVHIDSYYEL T0356 212 :G 1q7zA 265 :G T0356 217 :VSVALGA 1q7zA 266 :VNIFGGC T0356 224 :DPATI 1q7zA 276 :TPEHV T0356 242 :YAFAGLLRGTKTEVVKCIS 1q7zA 281 :KLFRKVLGNRKPLQRKKKR T0356 262 :DLEVPAS 1q7zA 300 :IFAVSSP T0356 307 :THITQREDAIYHSTYTG 1q7zA 307 :SKLVTFDHFVVIGERIN T0356 325 :PPDEPAVLGVAL 1q7zA 324 :PAGRKKLWAEMQ T0356 337 :NEVFVPILQKQ 1q7zA 339 :EEIVIKEAKTQ T0356 348 :FPEIVDFYLPPEGCSY 1q7zA 353 :GAEVLDVNFGIESQID T0356 375 :AGHAKRVMMGVWSFLRQF 1q7zA 369 :VRYVEKIVQTLPYVSNVP T0356 399 :IVCD 1q7zA 387 :LSLD T0356 407 :ARDWNDVIWAITTRM 1q7zA 391 :IQNVDLTERALRAYP T0356 426 :DTVLVENTPID 1q7zA 406 :GRSLFNSAKVD T0356 448 :GSKMGLDATN 1q7zA 431 :GGTLIVLLMG T0356 468 :GRPIKKDPDVVA 1q7zA 441 :KDVPKSFEERKE T0356 480 :HIDAIWDELAIFN 1q7zA 456 :KALKILERHDFSD Number of specific fragments extracted= 25 number of extra gaps= 0 total=157 Number of alignments=11 # 1q7zA read from 1q7zA/merged-good-all-a2m # found chain 1q7zA in training set T0356 7 :NDLRDFLTLLEQQG 1q7zA 126 :ENFRETVEIMVEEG T0356 28 :PVDPHLEITEIADRTLR 1q7zA 147 :TFSDILELKAAVLAARE T0356 45 :AGGPALLFENP 1q7zA 166 :RDVFLIAHMTF T0356 56 :KGY 1q7zA 179 :KGR T0356 59 :SMPVL 1q7zA 199 :DIDAL T0356 64 :CNLFGTPKRVA 1q7zA 205 :INCSLGPEEIL T0356 83 :SALREVGK 1q7zA 216 :PIFQELSQ T0356 117 :VLNMPTKRLRGAPCQQK 1q7zA 224 :YTDKFLVVEPNAGKPIV T0356 170 :HKERQNL 1q7zA 241 :ENGKTVY T0356 194 :LSHRGGALDYQEWCAAH 1q7zA 249 :LKPHDFAVHIDSYYELG T0356 217 :VSVALGA 1q7zA 266 :VNIFGGC T0356 237 :DTLSEYAFAGLLRGTKTEVVKCISN 1q7zA 276 :TPEHVKLFRKVLGNRKPLQRKKKRI T0356 263 :LEVPASAEIV 1q7zA 301 :FAVSSPSKLV T0356 276 :YI 1q7zA 311 :TF T0356 313 :EDA 1q7zA 313 :DHF T0356 316 :IYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPE 1q7zA 318 :IGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEK T0356 351 :IVDFYLPPEGCS 1q7zA 356 :VLDVNFGIESQI T0356 374 :YAGHAKRVMMGVWSFLR 1q7zA 368 :DVRYVEKIVQTLPYVSN T0356 395 :TKFVIVC 1q7zA 385 :VPLSLDI T0356 409 :DWNDVIWAITT 1q7zA 393 :NVDLTERALRA T0356 433 :TPIDYLDFASPVSG 1q7zA 404 :YPGRSLFNSAKVDE T0356 447 :LGSKMGLDATNK 1q7zA 430 :YGGTLIVLLMGK T0356 469 :RPIKKDPDVVAHIDAIWDELAIFNNGK 1q7zA 442 :DVPKSFEERKEYFEKALKILERHDFSD Number of specific fragments extracted= 23 number of extra gaps= 0 total=180 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1innA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1innA expands to /projects/compbio/data/pdb/1inn.pdb.gz 1innA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0356 read from 1innA/merged-good-all-a2m # 1innA read from 1innA/merged-good-all-a2m # adding 1innA to template set # found chain 1innA in template set T0356 290 :DHTGYYNEVDSFPVFTVTHITQ 1innA 8 :ESFDLDHTKVKAPYVRLAGVKT T0356 312 :REDAIYHSTYTGRPPDE 1innA 32 :KGDQISKYDLRFLQPNQ T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLPPEGC 1innA 52 :DPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRT T0356 365 :LAVVTIKKQY 1innA 85 :GMYMAVIGEP T0356 375 :AGHAKRVMMGVWSFLRQF 1innA 96 :EQGVMKAFEAALKDTAGH T0356 402 :DDD 1innA 114 :DQP T0356 430 :VENTP 1innA 117 :IPGVS T0356 460 :PGE 1innA 122 :ELE T0356 467 :WGRPIKKD 1innA 125 :CGNYRDHD T0356 475 :PDVVAHIDAIWDE 1innA 134 :AAARQHARDVLDQ Number of specific fragments extracted= 10 number of extra gaps= 0 total=190 Number of alignments=13 # 1innA read from 1innA/merged-good-all-a2m # found chain 1innA in template set Warning: unaligning (T0356)L498 because last residue in template chain is (1innA)L156 T0356 296 :NEVDSFPVFTVTHITQRED 1innA 14 :HTKVKAPYVRLAGVKTTPK T0356 315 :AIYHSTYTGRPPDE 1innA 35 :QISKYDLRFLQPNQ T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLPPEGCSYRLAV 1innA 52 :DPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAV T0356 371 :KKQYAGHAKRVMMGVWSFLRQF 1innA 92 :GEPDEQGVMKAFEAALKDTAGH T0356 402 :DDD 1innA 114 :DQP T0356 430 :VENTP 1innA 117 :IPGVS T0356 460 :PGET 1innA 122 :ELEC T0356 468 :GRPIKKD 1innA 126 :GNYRDHD T0356 475 :PDVVAHIDAIWDE 1innA 134 :AAARQHARDVLDQ T0356 489 :AIFNNGKSA 1innA 147 :GLKVQETIL Number of specific fragments extracted= 10 number of extra gaps= 0 total=200 Number of alignments=14 # 1innA read from 1innA/merged-good-all-a2m # found chain 1innA in template set T0356 290 :DHTGYYNEVDSFPVFTVTHITQRE 1innA 8 :ESFDLDHTKVKAPYVRLAGVKTTP T0356 314 :DAIYHSTYTGRPPDE 1innA 34 :DQISKYDLRFLQPNQ T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLPPEGCSYRLAV 1innA 52 :DPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAV T0356 370 :IKKQYAGHAKRVMMGVWSFLRQ 1innA 91 :IGEPDEQGVMKAFEAALKDTAG T0356 435 :IDYLDFASPVSGLG 1innA 113 :HDQPIPGVSELECG T0356 460 :PGETQ 1innA 127 :NYRDH T0356 473 :KDPDVVAHIDAIWDE 1innA 132 :DLAAARQHARDVLDQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=207 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ejeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ejeA expands to /projects/compbio/data/pdb/1eje.pdb.gz 1ejeA:# T0356 read from 1ejeA/merged-good-all-a2m # 1ejeA read from 1ejeA/merged-good-all-a2m # adding 1ejeA to template set # found chain 1ejeA in template set Warning: unaligning (T0356)R180 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ejeA)F48 Warning: unaligning (T0356)Q181 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ejeA)F48 T0356 162 :GLTVTRG 1ejeA 30 :VMVTTVD T0356 170 :HKERQNLGIY 1ejeA 37 :EEGNINAAPF T0356 182 :QLI 1ejeA 49 :TMP T0356 185 :GKNKLIMRWLSHRGGALDYQE 1ejeA 55 :DPPVVAFASAPDHHTARNIES T0356 208 :AA 1ejeA 76 :TH T0356 216 :PVSVALGAD 1ejeA 78 :EFVINITPA T0356 225 :PATILGAVTPVPDTLSEYAFA 1ejeA 89 :IERMWVTARDIPAGENELEAA T0356 252 :KTEVVKCISNDLEVPASAEIVLEGYIE 1ejeA 110 :GLAWTSSRRVKPPRIVEAPGHLECELL T0356 294 :YYNEVDSFPV 1ejeA 137 :RMFEVGDHNL T0356 304 :FTVTHITQREDAI 1ejeA 149 :GSVVSASVRSGAV Number of specific fragments extracted= 10 number of extra gaps= 1 total=217 Number of alignments=16 # 1ejeA read from 1ejeA/merged-good-all-a2m # found chain 1ejeA in template set Warning: unaligning (T0356)R180 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ejeA)F48 Warning: unaligning (T0356)Q181 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ejeA)F48 T0356 162 :GLTVTRG 1ejeA 30 :VMVTTVD T0356 170 :HKERQNLGIY 1ejeA 37 :EEGNINAAPF T0356 182 :QLI 1ejeA 49 :TMP T0356 185 :GKNKLIMRWLSHRGGALDYQEW 1ejeA 55 :DPPVVAFASAPDHHTARNIEST T0356 216 :PVSVALGA 1ejeA 78 :EFVINITP T0356 225 :PATILGAVTPVPDTLSEYAFA 1ejeA 89 :IERMWVTARDIPAGENELEAA T0356 252 :KTEVVKCISNDLEVPASAEIVLEGYIE 1ejeA 110 :GLAWTSSRRVKPPRIVEAPGHLECELL T0356 294 :YYNEVDSFPV 1ejeA 137 :RMFEVGDHNL T0356 304 :FTVTHITQREDAI 1ejeA 149 :GSVVSASVRSGAV Number of specific fragments extracted= 9 number of extra gaps= 1 total=226 Number of alignments=17 # 1ejeA read from 1ejeA/merged-good-all-a2m # found chain 1ejeA in template set Warning: unaligning (T0356)R180 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ejeA)F48 T0356 161 :WGLTVTRG 1ejeA 29 :TVMVTTVD T0356 170 :HKERQNLGIY 1ejeA 37 :EEGNINAAPF T0356 181 :QQLIG 1ejeA 49 :TMPVS T0356 186 :KNKLIMRWLSHRGGALDYQEW 1ejeA 56 :PPVVAFASAPDHHTARNIEST T0356 216 :PVSVALGADPAT 1ejeA 78 :EFVINITPADII T0356 228 :ILGAVTPVPDTLSEYAFA 1ejeA 92 :MWVTARDIPAGENELEAA T0356 252 :KTEVVKCISNDLEVPASAEIVLEGYIE 1ejeA 110 :GLAWTSSRRVKPPRIVEAPGHLECELL T0356 294 :YYNEVDSFPVFT 1ejeA 137 :RMFEVGDHNLIT T0356 306 :VTHITQREDAI 1ejeA 151 :VVSASVRSGAV Number of specific fragments extracted= 9 number of extra gaps= 1 total=235 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iyeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1iyeA expands to /projects/compbio/data/pdb/1iye.pdb.gz 1iyeA:# T0356 read from 1iyeA/merged-good-all-a2m # 1iyeA read from 1iyeA/merged-good-all-a2m # adding 1iyeA to template set # found chain 1iyeA in template set T0356 19 :QGELKR 1iyeA 11 :NGEMVR T0356 26 :TLPVDPHLEITE 1iyeA 19 :DAKVHVMSHALH T0356 45 :A 1iyeA 31 :Y T0356 48 :PALLFENP 1iyeA 32 :GTSVFEGI T0356 56 :KGY 1iyeA 46 :KGP T0356 62 :VLCN 1iyeA 49 :VVFR T0356 70 :PKRVA 1iyeA 53 :HREHM T0356 86 :REVGKLLAFLKE 1iyeA 58 :QRLHDSAKIYRF T0356 99 :EPPKGFRDLFDKLPQFKQVLNMPTK 1iyeA 70 :PVSQSIDELMEACRDVIRKNNLTSA T0356 134 :IVS 1iyeA 95 :YIR T0356 162 :GLTVTRGPHK 1iyeA 98 :PLIFVGDVGM T0356 188 :KLIMRWLSHRGGA 1iyeA 118 :DVIIAAFPWGAYL T0356 206 :WCAAH 1iyeA 134 :ALEQG T0356 215 :FPVSVA 1iyeA 139 :IDAMVS T0356 233 :TPVPDTL 1iyeA 148 :RAAPNTI T0356 240 :SEYAFAGLLRGTKTEVVKCI 1iyeA 166 :SSLLVGSEARRHGYQEGIAL T0356 290 :DHTGYYNEVDSFPVFTVT 1iyeA 186 :DVNGYISEGAGENLFEVK T0356 313 :EDAIYH 1iyeA 204 :DGVLFT T0356 325 :PPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPEG 1iyeA 210 :PPFTSSALPGITRDAIIKLAKELGIEVREQVLSRES T0356 362 :SYRLAVV 1iyeA 249 :ADEVFMS T0356 375 :AGHAKRVMMGVWSFL 1iyeA 278 :GPVTKRIQQAFFGLF Number of specific fragments extracted= 21 number of extra gaps= 0 total=256 Number of alignments=19 # 1iyeA read from 1iyeA/merged-good-all-a2m # found chain 1iyeA in template set T0356 19 :QGELKRI 1iyeA 11 :NGEMVRW T0356 26 :TLPVDPHLEITE 1iyeA 19 :DAKVHVMSHALH T0356 47 :GPALLFENPKG 1iyeA 37 :EGIRCYDSHKG T0356 61 :PVLCNL 1iyeA 48 :PVVFRH T0356 71 :K 1iyeA 54 :R T0356 83 :SALREVGKLLAFLK 1iyeA 55 :EHMQRLHDSAKIYR T0356 98 :PEPPKGFRDLFDKLPQFKQVLNMPT 1iyeA 69 :FPVSQSIDELMEACRDVIRKNNLTS T0356 176 :LGIYRQQLIGKN 1iyeA 94 :AYIRPLIFVGDV T0356 188 :KLIMRWLSHRGGA 1iyeA 118 :DVIIAAFPWGAYL T0356 205 :EWCAAH 1iyeA 133 :EALEQG T0356 215 :FPVSVA 1iyeA 139 :IDAMVS T0356 233 :TPVPDTLS 1iyeA 148 :RAAPNTIP T0356 241 :EYAFAGLLRGTKTEVVKCI 1iyeA 167 :SLLVGSEARRHGYQEGIAL T0356 290 :DHTGYYNEVDSFPVFTV 1iyeA 186 :DVNGYISEGAGENLFEV T0356 312 :REDAIYH 1iyeA 203 :KDGVLFT T0356 325 :PPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPEGCSY 1iyeA 210 :PPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLYL T0356 364 :RLA 1iyeA 253 :FMS T0356 367 :VVTIKK 1iyeA 261 :ITPVRS T0356 373 :QYAGHAKRVMMGVWSFLRQ 1iyeA 276 :RCGPVTKRIQQAFFGLFTG Number of specific fragments extracted= 19 number of extra gaps= 0 total=275 Number of alignments=20 # 1iyeA read from 1iyeA/merged-good-all-a2m # found chain 1iyeA in template set T0356 62 :VLC 1iyeA 49 :VVF T0356 81 :DVSALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNMP 1iyeA 52 :RHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVIRKNNLT T0356 156 :APLIT 1iyeA 93 :SAYIR T0356 162 :GLTVTRGPHK 1iyeA 98 :PLIFVGDVGM T0356 188 :KLIMRWLSHRGGA 1iyeA 118 :DVIIAAFPWGAYL T0356 207 :CAAHP 1iyeA 133 :EALEQ T0356 215 :FPVSVA 1iyeA 139 :IDAMVS T0356 233 :TPVPD 1iyeA 148 :RAAPN T0356 239 :LSEYAFAGLLRGTKTEVVKCI 1iyeA 165 :LSSLLVGSEARRHGYQEGIAL T0356 290 :DHTGYYNEVDSFPVFTV 1iyeA 186 :DVNGYISEGAGENLFEV T0356 312 :REDAIYH 1iyeA 203 :KDGVLFT T0356 325 :PPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPE 1iyeA 210 :PPFTSSALPGITRDAIIKLAKELGIEVREQVLSRE T0356 360 :GCSYRLA 1iyeA 249 :ADEVFMS T0356 368 :VTIK 1iyeA 262 :TPVR T0356 372 :KQYAGHAKRVMMGVW 1iyeA 275 :GRCGPVTKRIQQAFF T0356 390 :RQF 1iyeA 290 :GLF Number of specific fragments extracted= 16 number of extra gaps= 0 total=291 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zczA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zczA expands to /projects/compbio/data/pdb/1zcz.pdb.gz 1zczA:Skipped atom 276, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 278, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 400, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 402, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 404, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 1965, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 1967, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2592, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2594, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2596, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2933, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2935, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2937, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2939, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 2941, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 3302, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 3304, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 3306, because occupancy 0.500 <= existing 0.500 in 1zczA Skipped atom 3308, because occupancy 0.500 <= existing 0.500 in 1zczA # T0356 read from 1zczA/merged-good-all-a2m # 1zczA read from 1zczA/merged-good-all-a2m # adding 1zczA to template set # found chain 1zczA in template set Warning: unaligning (T0356)G78 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zczA)I126 Warning: unaligning (T0356)Q79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zczA)I126 Warning: unaligning (T0356)Y363 because of BadResidue code BAD_PEPTIDE in next template residue (1zczA)N356 Warning: unaligning (T0356)R364 because of BadResidue code BAD_PEPTIDE at template residue (1zczA)N356 T0356 35 :ITEIADRTLRA 1zczA 97 :GVALLRAAAKN T0356 46 :GG 1zczA 109 :KK T0356 64 :CNLFGTPKRVAMGM 1zczA 111 :VKPAFDMETLKLAI T0356 80 :EDVSALREVGKLLAF 1zczA 127 :DDEETRKYLAGMTFA T0356 104 :FRDLFDK 1zczA 142 :FTSVYDS T0356 114 :FKQV 1zczA 149 :IRAN T0356 119 :NMPTKRLRG 1zczA 166 :DLQLRYGEN T0356 128 :APCQQKIVSGDDVD 1zczA 184 :KPAFEILHEGKTIS T0356 144 :RIP 1zczA 213 :NLP T0356 160 :TWGLTVTR 1zczA 216 :RMGAVVVK T0356 172 :ERQNL 1zczA 224 :HQSPC T0356 192 :RWLSHRGGALDYQEWCAAHPGE 1zczA 229 :GAAIGEDKVEIVKKAIEADDES T0356 214 :RFPVSVA 1zczA 273 :YLEVIVA T0356 237 :DTLS 1zczA 280 :PSFT T0356 242 :YAFAGLLRGTKTEVVKCISNDLEV 1zczA 284 :QEAIEVLSKKKVRLLKPGDYASWA T0356 293 :GYYNEVD 1zczA 308 :GKMAFGS T0356 304 :F 1zczA 315 :L T0356 308 :HITQREDA 1zczA 316 :VLSERKYP T0356 318 :HSTYTGRPPDEPAVLGVALNEVFVP 1zczA 327 :FELVVGEPLSEKELEDLEFAYRVVE T0356 360 :GCS 1zczA 352 :GAK T0356 365 :LAVVTIKKQ 1zczA 357 :AVLIAKDGV T0356 375 :AGHAKRVMMGVWSFLRQFMYTK 1zczA 373 :QPSRKRAAWIATVMAGEKAKGA T0356 398 :VIVCDDDV 1zczA 395 :VAASDAFF T0356 408 :RDWNDVIWAITTR 1zczA 403 :PFPDSLEILAQAG T0356 449 :SK 1zczA 416 :VK T0356 452 :GLDATNKWPG 1zczA 418 :AVVAPLGSIR T0356 474 :DPDVVAHIDAI 1zczA 428 :DEEVIEKAREL Number of specific fragments extracted= 27 number of extra gaps= 2 total=318 Number of alignments=22 # 1zczA read from 1zczA/merged-good-all-a2m # found chain 1zczA in template set Warning: unaligning (T0356)G78 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zczA)I126 Warning: unaligning (T0356)Q79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zczA)I126 Warning: unaligning (T0356)S362 because of BadResidue code BAD_PEPTIDE in next template residue (1zczA)N356 Warning: unaligning (T0356)Y363 because of BadResidue code BAD_PEPTIDE at template residue (1zczA)N356 T0356 34 :EITEIADRTLRA 1zczA 96 :GGVALLRAAAKN T0356 46 :G 1zczA 110 :K T0356 64 :CNLFGTPKRVAMGM 1zczA 111 :VKPAFDMETLKLAI T0356 80 :EDVSALREVGKLLAF 1zczA 127 :DDEETRKYLAGMTFA T0356 107 :LFDKLPQFKQVL 1zczA 142 :FTSVYDSIRANQ T0356 119 :NMPTKRLRG 1zczA 166 :DLQLRYGEN T0356 128 :APCQQKIVSGDDVD 1zczA 184 :KPAFEILHEGKTIS T0356 144 :RIPI 1zczA 213 :NLPR T0356 161 :WGLTVTR 1zczA 217 :MGAVVVK T0356 172 :ERQNLGI 1zczA 224 :HQSPCGA T0356 194 :LSHRGGALDYQEWCAAHPG 1zczA 231 :AIGEDKVEIVKKAIEADDE T0356 214 :RFPVSVA 1zczA 273 :YLEVIVA T0356 237 :DTLS 1zczA 280 :PSFT T0356 242 :YAFAGLLRGTKTEVVKCISNDLEV 1zczA 284 :QEAIEVLSKKKVRLLKPGDYASWA T0356 278 :EQG 1zczA 311 :AFG T0356 281 :ETAPEGPY 1zczA 320 :RKYPEGNF T0356 319 :STYTGRPPDEPAVLGVALNEVFVPILQ 1zczA 328 :ELVVGEPLSEKELEDLEFAYRVVEGAK T0356 364 :RLAV 1zczA 357 :AVLI T0356 368 :VTIKKQYAG 1zczA 367 :VGIGSGQPS T0356 378 :AKRVMMGVWSFLRQFMYTK 1zczA 376 :RKRAAWIATVMAGEKAKGA T0356 398 :VIVCDDD 1zczA 395 :VAASDAF T0356 407 :ARDWNDVIWAITTRMD 1zczA 402 :FPFPDSLEILAQAGVK T0356 452 :GLDA 1zczA 418 :AVVA T0356 468 :GRPIKKDPDVVAHIDAI 1zczA 422 :PLGSIRDEEVIEKAREL Number of specific fragments extracted= 24 number of extra gaps= 2 total=342 Number of alignments=23 # 1zczA read from 1zczA/merged-good-all-a2m # found chain 1zczA in template set Warning: unaligning (T0356)G78 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zczA)I126 Warning: unaligning (T0356)Q79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zczA)I126 Warning: unaligning (T0356)G360 because of BadResidue code BAD_PEPTIDE in next template residue (1zczA)N356 Warning: unaligning (T0356)C361 because of BadResidue code BAD_PEPTIDE at template residue (1zczA)N356 T0356 35 :ITEIADRTLR 1zczA 97 :GVALLRAAAK T0356 45 :AG 1zczA 108 :WK T0356 64 :CNLFGTPKRVAMGM 1zczA 111 :VKPAFDMETLKLAI T0356 80 :EDVSALREVGKLLAF 1zczA 127 :DDEETRKYLAGMTFA T0356 104 :FRDLFDK 1zczA 142 :FTSVYDS T0356 114 :FKQVL 1zczA 149 :IRANQ T0356 119 :NMPTKRLR 1zczA 166 :DLQLRYGE T0356 127 :GAPCQQKIVSGDDVDL 1zczA 183 :GKPAFEILHEGKTISF T0356 144 :RIPI 1zczA 213 :NLPR T0356 161 :WGLTVTR 1zczA 217 :MGAVVVK T0356 172 :ERQNLGIY 1zczA 224 :HQSPCGAA T0356 195 :SHRGGALDYQEWCAAHPG 1zczA 232 :IGEDKVEIVKKAIEADDE T0356 213 :ERFPVSVA 1zczA 272 :KYLEVIVA T0356 242 :YAFAGLLRGTKTEVVKCIS 1zczA 284 :QEAIEVLSKKKVRLLKPGD T0356 288 :YGDHTGYYNEVD 1zczA 303 :YASWAGKMAFGS T0356 304 :FTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFV 1zczA 315 :LVLSERKYPEGNFELVVGEPLSEKELEDLEFAYRVVEG T0356 359 :E 1zczA 354 :K T0356 362 :SYRLA 1zczA 357 :AVLIA T0356 368 :VTIKKQYAG 1zczA 367 :VGIGSGQPS T0356 378 :AKRVMMGVWSFLRQFMY 1zczA 376 :RKRAAWIATVMAGEKAK T0356 397 :FVIVCDDDVN 1zczA 394 :AVAASDAFFP T0356 409 :DWNDVIWAITTRMD 1zczA 404 :FPDSLEILAQAGVK T0356 452 :GLDATNKWP 1zczA 418 :AVVAPLGSI T0356 473 :KDPDVVAHIDAI 1zczA 427 :RDEEVIEKAREL Number of specific fragments extracted= 24 number of extra gaps= 2 total=366 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5gA expands to /projects/compbio/data/pdb/2f5g.pdb.gz 2f5gA:# T0356 read from 2f5gA/merged-good-all-a2m # 2f5gA read from 2f5gA/merged-good-all-a2m # adding 2f5gA to template set # found chain 2f5gA in template set T0356 303 :VFTVTH 2f5gA 14 :NYHFVW T0356 321 :YTGRPPDE 2f5gA 20 :IPKHRRNT T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLPPE 2f5gA 29 :VNEIAEYTKEVLKSIAEELGCEIIALEVMPD T0356 363 :YRLAVVTIKKQY 2f5gA 60 :HIHLFVNCPPRY T0356 375 :AGHAKRVMMGVWSFLRQF 2f5gA 78 :NYFKGKSARLILKKFPQL T0356 446 :GLG 2f5gA 96 :NKG T0356 457 :NKWPGE 2f5gA 99 :KLWTRS T0356 465 :REWGRPIKKDPDVVAHIDAIWDE 2f5gA 105 :YFVATAGNVSSEVIKKYIEEQWR Number of specific fragments extracted= 8 number of extra gaps= 0 total=374 Number of alignments=25 # 2f5gA read from 2f5gA/merged-good-all-a2m # found chain 2f5gA in template set T0356 305 :TVT 2f5gA 16 :HFV T0356 319 :S 2f5gA 19 :W T0356 321 :YTGRPPDE 2f5gA 20 :IPKHRRNT T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLPP 2f5gA 29 :VNEIAEYTKEVLKSIAEELGCEIIALEVMP T0356 362 :SYRLAVVTIKKQY 2f5gA 59 :DHIHLFVNCPPRY T0356 375 :AGHAKR 2f5gA 73 :PSYLAN T0356 381 :VMMGVWSFLRQF 2f5gA 84 :SARLILKKFPQL T0356 446 :GLG 2f5gA 96 :NKG T0356 457 :NKWPGETQR 2f5gA 99 :KLWTRSYFV T0356 468 :GRPIKKDPDVVAHIDAIWDE 2f5gA 108 :ATAGNVSSEVIKKYIEEQWR Number of specific fragments extracted= 10 number of extra gaps= 0 total=384 Number of alignments=26 # 2f5gA read from 2f5gA/merged-good-all-a2m # found chain 2f5gA in template set T0356 320 :TYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPE 2f5gA 20 :IPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPD T0356 363 :YRLAVVTIKKQY 2f5gA 60 :HIHLFVNCPPRY T0356 375 :AGHAKRVMM 2f5gA 73 :PSYLANYFK T0356 411 :NDVIWAITTRMD 2f5gA 82 :GKSARLILKKFP T0356 424 :A 2f5gA 94 :Q T0356 442 :SPVSG 2f5gA 95 :LNKGK T0356 459 :W 2f5gA 100 :L T0356 461 :GETQREWGRPIKKDPDVVAHI 2f5gA 101 :WTRSYFVATAGNVSSEVIKKY T0356 482 :DAIWDE 2f5gA 123 :EEQWRK Number of specific fragments extracted= 9 number of extra gaps= 0 total=393 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wqaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wqaA expands to /projects/compbio/data/pdb/1wqa.pdb.gz 1wqaA:# T0356 read from 1wqaA/merged-good-all-a2m # 1wqaA read from 1wqaA/merged-good-all-a2m # adding 1wqaA to template set # found chain 1wqaA in template set T0356 8 :DLRDF 1wqaA 56 :MLKEA T0356 13 :LTLLEQQG 1wqaA 62 :ISGLLSVG T0356 21 :ELKRITL 1wqaA 71 :DVIDVGI T0356 33 :LEITEIADRTLRAGGPALLFENPKGYS 1wqaA 78 :APTPAVQWATKHFNADGGAVITASHNP T0356 62 :VLCNLFG 1wqaA 108 :NGIKLLE T0356 75 :MGMGQED 1wqaA 116 :NGMGLKK T0356 83 :SALREVGKLLAF 1wqaA 123 :EREAIVEELFFK T0356 96 :KEPEPPKG 1wqaA 135 :EDFDRAKW T0356 119 :NMPTKR 1wqaA 145 :IGEVRR T0356 197 :RGGALDYQEWCAA 1wqaA 151 :EDIIKPYIEAIKS T0356 214 :RFPVSVALGADPAT 1wqaA 174 :KPFVVVDTSNGAGS T0356 239 :LSEYAFAGLL 1wqaA 188 :LTLPYLLREL T0356 250 :GTKTEVVKCI 1wqaA 198 :GCKVITVNAQ T0356 261 :NDLEVPA 1wqaA 208 :PDGYFPA T0356 291 :HTG 1wqaA 215 :RNP T0356 324 :RPPDEP 1wqaA 218 :EPNEEN T0356 337 :NEVFVPILQKQ 1wqaA 224 :LKEFMEIVKAL T0356 352 :VDFYLPPEGCSYRLAV 1wqaA 238 :FGVAQDGDADRAVFID T0356 371 :KKQYAGHAKRVMMGVWSFLRQFMYTK 1wqaA 255 :NGRFIQGDKTFALVADAVLKEKGGGL T0356 399 :IVCDDDVN 1wqaA 281 :LVTTVATS T0356 410 :WND 1wqaA 291 :LDD T0356 413 :VIWAITT 1wqaA 312 :VARALYE T0356 423 :PARDTVLVENTPIDYLDFASPVSG 1wqaA 319 :NNGTIGGEENGGVIFPEHVLGRDG T0356 458 :KWPGETQREWGRPIKKD 1wqaA 366 :ELPKYYQIKTKRHVEGD T0356 475 :PDVVAHIDAIWDELAI 1wqaA 384 :HAIVNKVAEMARERGY Number of specific fragments extracted= 25 number of extra gaps= 0 total=418 Number of alignments=28 # 1wqaA read from 1wqaA/merged-good-all-a2m # found chain 1wqaA in template set T0356 28 :PVDPHLEIT 1wqaA 17 :KITPEFAMK T0356 37 :EIADRTLRAGG 1wqaA 29 :AFGTLLKREGR T0356 59 :SMPVLCNLFGT 1wqaA 41 :KPLVVVGRDTR T0356 80 :EDVSAL 1wqaA 52 :VSGEML T0356 86 :REVGKLLAFLK 1wqaA 59 :EALISGLLSVG T0356 110 :KLPQFKQVLN 1wqaA 82 :AVQWATKHFN T0356 160 :TWGLTVTRGPHK 1wqaA 92 :ADGGAVITASHN T0356 185 :GKNKLIMRWLSHRGGA 1wqaA 104 :PPEYNGIKLLEPNGMG T0356 201 :LDYQEWCAA 1wqaA 126 :AIVEELFFK T0356 212 :GE 1wqaA 135 :ED T0356 214 :RFPVSVALGAD 1wqaA 174 :KPFVVVDTSNG T0356 241 :EYAFAGLLRGTKTEVVKCIS 1wqaA 189 :TLPYLLRELGCKVITVNAQP T0356 285 :EGP 1wqaA 209 :DGY T0356 321 :YTGRPPDEPA 1wqaA 212 :FPARNPEPNE T0356 336 :LNEVFVPILQKQ 1wqaA 223 :NLKEFMEIVKAL T0356 352 :VDFYLPPEGCSYRLAV 1wqaA 238 :FGVAQDGDADRAVFID T0356 371 :KKQY 1wqaA 255 :NGRF T0356 375 :AGHAKRVMMGVWSFLRQF 1wqaA 262 :DKTFALVADAVLKEKGGG T0356 398 :VIVCDDDVN 1wqaA 280 :LLVTTVATS T0356 412 :D 1wqaA 293 :D T0356 413 :VIWAITT 1wqaA 312 :VARALYE T0356 423 :PARDTVLVENTPIDYLDFASP 1wqaA 319 :NNGTIGGEENGGVIFPEHVLG T0356 458 :KWPGETQREWGRPIKKD 1wqaA 366 :ELPKYYQIKTKRHVEGD T0356 475 :PDVVAHIDAIWDELAI 1wqaA 384 :HAIVNKVAEMARERGY Number of specific fragments extracted= 24 number of extra gaps= 0 total=442 Number of alignments=29 # 1wqaA read from 1wqaA/merged-good-all-a2m # found chain 1wqaA in template set T0356 22 :LKRITLPVDPHLEI 1wqaA 11 :RGIANEKITPEFAM T0356 36 :TEIADRTLRAGGPALLF 1wqaA 28 :MAFGTLLKREGRKKPLV T0356 61 :PVLCNLFGTPKRVA 1wqaA 45 :VVGRDTRVSGEMLK T0356 86 :REVGKLLAFLK 1wqaA 59 :EALISGLLSVG T0356 123 :KRLRGAPCQQK 1wqaA 73 :IDVGIAPTPAV T0356 147 :IMTCWPEDAAPLITWG 1wqaA 86 :ATKHFNADGGAVITAS T0356 169 :P 1wqaA 102 :H T0356 184 :IGKNKLIMRWLSHRGGA 1wqaA 103 :NPPEYNGIKLLEPNGMG T0356 201 :LDYQEWCA 1wqaA 126 :AIVEELFF T0356 214 :RFPVSVALGADPATILG 1wqaA 174 :KPFVVVDTSNGAGSLTL T0356 242 :YAFAGLLR 1wqaA 191 :PYLLRELG T0356 253 :TEVVKCISN 1wqaA 199 :CKVITVNAQ T0356 262 :DLEVPAS 1wqaA 209 :DGYFPAR T0356 299 :D 1wqaA 216 :N T0356 323 :GRPPDEP 1wqaA 217 :PEPNEEN T0356 337 :NEVFVPILQKQ 1wqaA 224 :LKEFMEIVKAL T0356 350 :EIVDFYLPPEGCSYRLAV 1wqaA 235 :GADFGVAQDGDADRAVFI T0356 373 :QY 1wqaA 257 :RF T0356 376 :GHAKRVMMGVWSFLRQ 1wqaA 260 :QGDKTFALVADAVLKE T0356 393 :MYTKFVIVC 1wqaA 276 :KGGGLLVTT T0356 413 :VIWAITT 1wqaA 312 :VARALYE T0356 423 :PARDTVLVEN 1wqaA 319 :NNGTIGGEEN T0356 435 :IDYLDFASPVSG 1wqaA 329 :GGVIFPEHVLGR T0356 462 :ETQREWGRPIKKDPDVVAHIDAIWDELAIFNN 1wqaA 368 :PKYYQIKTKRHVEGDRHAIVNKVAEMARERGY Number of specific fragments extracted= 24 number of extra gaps= 0 total=466 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aisB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1aisB expands to /projects/compbio/data/pdb/1ais.pdb.gz 1aisB:# T0356 read from 1aisB/merged-good-all-a2m # 1aisB read from 1aisB/merged-good-all-a2m # adding 1aisB to template set # found chain 1aisB in template set T0356 7 :NDLRDFLTLLEQQG 1aisB 1131 :EEAARLYREAVRKG T0356 28 :PVDPHLEITEIADRTLR 1aisB 1148 :GRSIESVMAACVYAACR T0356 45 :AG 1aisB 1166 :LK T0356 66 :LFGTPKRVAMGMGQED 1aisB 1168 :VPRTLDEIADIARVDK T0356 83 :SALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNMP 1aisB 1184 :KEIGRSYRFIARNLNLTPKKLFVKPTDYVNKFADELGLS T0356 197 :RGGALDYQEWCAA 1aisB 1223 :EKVRRRAIEILDE T0356 210 :HPGE 1aisB 1238 :KRGL T0356 222 :GADPATILGAV 1aisB 1244 :GKSPAGLVAAA T0356 242 :YAFAGLLRGTKTE 1aisB 1255 :LYIASLLEGEKRT Number of specific fragments extracted= 9 number of extra gaps= 0 total=475 Number of alignments=31 # 1aisB read from 1aisB/merged-good-all-a2m # found chain 1aisB in template set T0356 7 :NDLRDFLTLLEQQG 1aisB 1131 :EEAARLYREAVRKG T0356 28 :PVDPHLEITEIADRTLR 1aisB 1148 :GRSIESVMAACVYAACR T0356 45 :AGG 1aisB 1166 :LKV T0356 67 :FGTPKRVAMGMGQEDVSALREVGKLLAFLK 1aisB 1169 :PRTLDEIADIARVDKKEIGRSYRFIARNLN T0356 98 :PEPPKGFRDLFDKLPQFKQVLNMPTK 1aisB 1199 :LTPKKLFVKPTDYVNKFADELGLSEK T0356 196 :HRGGALDYQEWCAA 1aisB 1226 :RRRAIEILDEAYKR T0356 212 :G 1aisB 1240 :G T0356 222 :GADPATILGAV 1aisB 1244 :GKSPAGLVAAA T0356 242 :YAFAGLLRGTKTE 1aisB 1255 :LYIASLLEGEKRT Number of specific fragments extracted= 9 number of extra gaps= 0 total=484 Number of alignments=32 # 1aisB read from 1aisB/merged-good-all-a2m # found chain 1aisB in template set T0356 8 :DLRDFLTLLEQQG 1aisB 1132 :EAARLYREAVRKG T0356 28 :PVDPHLEITEIADRTLR 1aisB 1148 :GRSIESVMAACVYAACR T0356 46 :GG 1aisB 1167 :KV T0356 67 :FGTPKRVAMGMGQED 1aisB 1169 :PRTLDEIADIARVDK T0356 83 :SALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNMP 1aisB 1184 :KEIGRSYRFIARNLNLTPKKLFVKPTDYVNKFADELGLS T0356 132 :QKIV 1aisB 1223 :EKVR T0356 197 :RGGALDYQ 1aisB 1227 :RRAIEILD T0356 207 :CAAHPGE 1aisB 1235 :EAYKRGL T0356 222 :GADPATILGA 1aisB 1244 :GKSPAGLVAA T0356 241 :EYAFAGLLRGTKTE 1aisB 1254 :ALYIASLLEGEKRT Number of specific fragments extracted= 10 number of extra gaps= 0 total=494 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o2dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0356 read from 1o2dA/merged-good-all-a2m # 1o2dA read from 1o2dA/merged-good-all-a2m # found chain 1o2dA in training set Warning: unaligning (T0356)G323 because of BadResidue code BAD_PEPTIDE in next template residue (1o2dA)G139 Warning: unaligning (T0356)R324 because of BadResidue code BAD_PEPTIDE at template residue (1o2dA)G139 T0356 107 :LFDKLPQFKQVLNMPTKRLRG 1o2dA 45 :SLDDLKKLLDETEISYEIFDE T0356 135 :V 1o2dA 66 :V T0356 195 :SHRGGALDYQEWCAAHPGERFPVSVALGADPATILG 1o2dA 67 :EENPSFDNVMKAVERYRNDSFDFVVGLGGGSPMDFA T0356 242 :YAFAGLLRGTKT 1o2dA 103 :KAVAVLLKEKDL T0356 264 :EV 1o2dA 115 :SV T0356 293 :GYYNEVD 1o2dA 118 :DLYDREK T0356 315 :AIYHSTYT 1o2dA 130 :PVVEIPTT T0356 325 :PPDE 1o2dA 140 :TGSE T0356 329 :PAVL 1o2dA 146 :PYSI T0356 348 :FPE 1o2dA 152 :DPE T0356 351 :IVDFYLPPEGCSYR 1o2dA 165 :PVYAFLDPRYTYSM T0356 374 :YAGHAKRVMMGVWSFL 1o2dA 179 :SDELTLSTGVDALSHA T0356 413 :VIWAITTRM 1o2dA 195 :VEGYLSRKS T0356 474 :DPDVVAHIDAIWDELAIF 1o2dA 204 :TPPSDALAIEAMKIIHRN Number of specific fragments extracted= 14 number of extra gaps= 1 total=508 Number of alignments=34 # 1o2dA read from 1o2dA/merged-good-all-a2m # found chain 1o2dA in training set Warning: unaligning (T0356)G286 because of BadResidue code BAD_PEPTIDE at template residue (1o2dA)G139 T0356 55 :PKGYSMPVLCNLFGT 1o2dA 24 :IDLLGKRALVVTGKS T0356 78 :GQEDVSALREVGKLLAFLK 1o2dA 39 :SSKKNGSLDDLKKLLDETE T0356 120 :MPTKRLRG 1o2dA 58 :ISYEIFDE T0356 130 :CQ 1o2dA 66 :VE T0356 138 :D 1o2dA 68 :E T0356 197 :RGGALDYQEWCAAHPGERFPVSVALGADPATILG 1o2dA 69 :NPSFDNVMKAVERYRNDSFDFVVGLGGGSPMDFA T0356 242 :YAFAGLLRGTKTEV 1o2dA 103 :KAVAVLLKEKDLSV T0356 278 :EQGETAPE 1o2dA 121 :DREKVKHW T0356 287 :PYGDHTGYY 1o2dA 140 :TGSEVTPYS T0356 309 :ITQREDAIYHSTYTGRP 1o2dA 149 :ILTDPEGNKRGCTLMFP T0356 352 :VDFYLPPEGCSYR 1o2dA 166 :VYAFLDPRYTYSM T0356 374 :YAGHAKRVMMGVWSF 1o2dA 179 :SDELTLSTGVDALSH T0356 412 :DVIWAITTRM 1o2dA 194 :AVEGYLSRKS T0356 474 :DPDVVAHIDAIWDEL 1o2dA 204 :TPPSDALAIEAMKII Number of specific fragments extracted= 14 number of extra gaps= 1 total=522 Number of alignments=35 # 1o2dA read from 1o2dA/merged-good-all-a2m # found chain 1o2dA in training set T0356 106 :DLFDKLPQFKQVLNMPTKRLRG 1o2dA 44 :GSLDDLKKLLDETEISYEIFDE T0356 194 :LSHRGGALDYQEWCAAHPGERFPVSVALGADPATILG 1o2dA 66 :VEENPSFDNVMKAVERYRNDSFDFVVGLGGGSPMDFA T0356 242 :YAFAGLLR 1o2dA 103 :KAVAVLLK T0356 260 :SNDLEV 1o2dA 111 :EKDLSV T0356 278 :EQGETAPEGP 1o2dA 121 :DREKVKHWLP T0356 288 :YGDHTGYY 1o2dA 141 :GSEVTPYS T0356 296 :NEVDSF 1o2dA 152 :DPEGNK T0356 351 :IVDFYLPPEGC 1o2dA 165 :PVYAFLDPRYT T0356 375 :AGHAKRVMMGVWSF 1o2dA 180 :DELTLSTGVDALSH T0356 412 :DVIWAITTRM 1o2dA 194 :AVEGYLSRKS T0356 474 :DPDVVAHIDAIWDEL 1o2dA 204 :TPPSDALAIEAMKII Number of specific fragments extracted= 11 number of extra gaps= 0 total=533 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nz9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0356/1nz9A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0356/1nz9A/merged-good-all-a2m.gz for input Trying 1nz9A/merged-good-all-a2m Error: Couldn't open file 1nz9A/merged-good-all-a2m or 1nz9A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sviA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sviA expands to /projects/compbio/data/pdb/1svi.pdb.gz 1sviA:# T0356 read from 1sviA/merged-good-all-a2m # 1sviA read from 1sviA/merged-good-all-a2m # adding 1sviA to template set # found chain 1sviA in template set Warning: unaligning (T0356)T251 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sviA)Q60 Warning: unaligning (T0356)P302 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sviA)Q60 T0356 212 :GERFPVSVALG 1sviA 20 :EGGLPEIALAG T0356 236 :PDTLSEYAFAGLLRG 1sviA 31 :RSNVGKSSFINSLIN T0356 303 :VFTVTHI 1sviA 61 :TLNFYII T0356 313 :EDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYL 1sviA 68 :NDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQ T0356 367 :VVTIKKQYAGHAKRVMMGVWS 1sviA 112 :IVDLRHAPSNDDVQMYEFLKY T0356 392 :FMYTKFVIVCD 1sviA 133 :YGIPVIVIATK T0356 403 :DDVNARDWNDVIWAITT 1sviA 145 :DKIPKGKWDKHAKVVRQ T0356 420 :RMDPARDTVLVEN 1sviA 164 :NIDPEDELILFSS T0356 444 :VSGLG 1sviA 177 :ETKKG T0356 478 :VAHIDAIWDEL 1sviA 182 :KDEAWGAIKKM Number of specific fragments extracted= 10 number of extra gaps= 0 total=543 Number of alignments=37 # 1sviA read from 1sviA/merged-good-all-a2m # found chain 1sviA in template set Warning: unaligning (T0356)T251 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sviA)Q60 Warning: unaligning (T0356)P302 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sviA)Q60 T0356 214 :RFPVSVALG 1sviA 22 :GLPEIALAG T0356 236 :PDTLSEYAFAGLLRG 1sviA 31 :RSNVGKSSFINSLIN T0356 303 :VFTVTHI 1sviA 61 :TLNFYII T0356 313 :EDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYL 1sviA 68 :NDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQ T0356 367 :VVTIKKQYAGHAKRVMMGVWS 1sviA 112 :IVDLRHAPSNDDVQMYEFLKY T0356 392 :FMYTKFVIVCD 1sviA 133 :YGIPVIVIATK T0356 403 :DDVNARDWNDVIWAITT 1sviA 145 :DKIPKGKWDKHAKVVRQ T0356 420 :RMDPARDTVLVEN 1sviA 164 :NIDPEDELILFSS T0356 444 :VSGLG 1sviA 177 :ETKKG T0356 450 :K 1sviA 182 :K T0356 475 :PDVVAHIDAIW 1sviA 183 :DEAWGAIKKMI Number of specific fragments extracted= 11 number of extra gaps= 0 total=554 Number of alignments=38 # 1sviA read from 1sviA/merged-good-all-a2m # found chain 1sviA in template set Warning: unaligning (T0356)T251 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sviA)Q60 Warning: unaligning (T0356)P302 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sviA)Q60 T0356 212 :GERFPVSVALGA 1sviA 20 :EGGLPEIALAGR T0356 237 :DTLSEYAFAGLLRG 1sviA 32 :SNVGKSSFINSLIN T0356 303 :VFTV 1sviA 61 :TLNF T0356 310 :TQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLP 1sviA 65 :YIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQI T0356 368 :VTIKKQYAGHAKRVMMGVWSF 1sviA 113 :VDLRHAPSNDDVQMYEFLKYY T0356 393 :MYTKFVIVCDDD 1sviA 134 :GIPVIVIATKAD T0356 405 :VNARDWNDVIWAI 1sviA 147 :IPKGKWDKHAKVV T0356 418 :TTRMDPARDTVLVEN 1sviA 162 :TLNIDPEDELILFSS T0356 442 :SPV 1sviA 177 :ETK T0356 475 :PDVVAHIDAIW 1sviA 183 :DEAWGAIKKMI Number of specific fragments extracted= 10 number of extra gaps= 0 total=564 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u0vA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0356/1u0vA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0356/1u0vA/merged-good-all-a2m.gz for input Trying 1u0vA/merged-good-all-a2m Error: Couldn't open file 1u0vA/merged-good-all-a2m or 1u0vA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pvvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pvvA expands to /projects/compbio/data/pdb/1pvv.pdb.gz 1pvvA:# T0356 read from 1pvvA/merged-good-all-a2m # 1pvvA read from 1pvvA/merged-good-all-a2m # adding 1pvvA to template set # found chain 1pvvA in template set Warning: unaligning (T0356)T320 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)R107 Warning: unaligning (T0356)Y321 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)R107 Warning: unaligning (T0356)T322 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)V108 Warning: unaligning (T0356)Y394 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)V155 Warning: unaligning (T0356)T395 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)V155 Warning: unaligning (T0356)R469 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)G188 Warning: unaligning (T0356)P470 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)G188 T0356 91 :LL 1pvvA 26 :TA T0356 201 :LDYQEWCAA 1pvvA 28 :KMFKIWQKI T0356 212 :GER 1pvvA 37 :GKP T0356 215 :FPVSVALGA 1pvvA 46 :KTLAMIFQK T0356 236 :PDT 1pvvA 55 :PST T0356 241 :EYAFAGLLRGTKTEVVKCISNDLE 1pvvA 62 :SFEVAMAHLGGHALYLNAQDLQLR T0356 279 :QGET 1pvvA 86 :RGET T0356 312 :REDAIYHS 1pvvA 98 :SRYVDAIM T0356 323 :GR 1pvvA 109 :YD T0356 329 :PAV 1pvvA 111 :HKD T0356 341 :VPILQKQFP 1pvvA 114 :VEDLAKYAT T0356 350 :EIVDFYLPP 1pvvA 124 :PVINGLSDF T0356 373 :QYAGHAKRVMMGVWSFLRQFM 1pvvA 133 :SHPCQALADYMTIWEKKGTIK T0356 396 :K 1pvvA 156 :K T0356 398 :VIVCDDD 1pvvA 157 :VVYVGDG T0356 410 :WNDVIWAITT 1pvvA 167 :AHSLMIAGTK T0356 447 :LGSKMGLDA 1pvvA 177 :LGADVVVAT T0356 468 :G 1pvvA 186 :P T0356 471 :IKKDPDVVAHIDAIWDELAI 1pvvA 189 :YEPDEKVIKWAEQNAAESGG Number of specific fragments extracted= 19 number of extra gaps= 3 total=583 Number of alignments=40 # 1pvvA read from 1pvvA/merged-good-all-a2m # found chain 1pvvA in template set Warning: unaligning (T0356)H318 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)R107 Warning: unaligning (T0356)S319 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)R107 Warning: unaligning (T0356)P325 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)V108 Warning: unaligning (T0356)Y394 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)V155 Warning: unaligning (T0356)T395 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)V155 Warning: unaligning (T0356)R469 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)G188 Warning: unaligning (T0356)P470 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)G188 T0356 200 :ALDYQEWCAA 1pvvA 27 :AKMFKIWQKI T0356 212 :GER 1pvvA 37 :GKP T0356 215 :FPVSVALGA 1pvvA 46 :KTLAMIFQK T0356 238 :TLS 1pvvA 55 :PST T0356 241 :EYAFAGLLRGTKTEVVKCISNDLE 1pvvA 62 :SFEVAMAHLGGHALYLNAQDLQLR T0356 279 :QGET 1pvvA 86 :RGET T0356 312 :RE 1pvvA 98 :SR T0356 314 :DAIY 1pvvA 102 :DAIM T0356 326 :PDEPAV 1pvvA 109 :YDHKDV T0356 342 :PILQKQFP 1pvvA 115 :EDLAKYAT T0356 350 :EIVDFYLPP 1pvvA 124 :PVINGLSDF T0356 373 :QYAGHAKRVMMGVWSFLRQFM 1pvvA 133 :SHPCQALADYMTIWEKKGTIK T0356 396 :KFVIVCDDD 1pvvA 156 :KVVYVGDGN T0356 410 :WNDVIWAITT 1pvvA 167 :AHSLMIAGTK T0356 447 :LGSKMGLDA 1pvvA 177 :LGADVVVAT T0356 468 :G 1pvvA 186 :P T0356 471 :IKKDPDVVAHIDAIWDELAI 1pvvA 189 :YEPDEKVIKWAEQNAAESGG Number of specific fragments extracted= 17 number of extra gaps= 3 total=600 Number of alignments=41 # 1pvvA read from 1pvvA/merged-good-all-a2m # found chain 1pvvA in template set Warning: unaligning (T0356)L239 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)V61 Warning: unaligning (T0356)S240 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)V61 Warning: unaligning (T0356)H318 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)R107 Warning: unaligning (T0356)S319 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)R107 Warning: unaligning (T0356)T320 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)V108 Warning: unaligning (T0356)Y394 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)V155 Warning: unaligning (T0356)T395 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)V155 Warning: unaligning (T0356)R469 because of BadResidue code BAD_PEPTIDE in next template residue (1pvvA)G188 Warning: unaligning (T0356)P470 because of BadResidue code BAD_PEPTIDE at template residue (1pvvA)G188 T0356 87 :EVGKLLAF 1pvvA 22 :TILETAKM T0356 203 :Y 1pvvA 30 :F T0356 206 :WCAAHPGER 1pvvA 31 :KIWQKIGKP T0356 215 :FPVSVALGA 1pvvA 46 :KTLAMIFQK T0356 234 :PVPDT 1pvvA 55 :PSTRT T0356 241 :EYAFAGLLRGTKTEVVKCISNDL 1pvvA 62 :SFEVAMAHLGGHALYLNAQDLQL T0356 278 :EQGETAP 1pvvA 85 :RRGETIA T0356 314 :DAIY 1pvvA 102 :DAIM T0356 326 :PDE 1pvvA 109 :YDH T0356 339 :VFVPILQKQFPE 1pvvA 112 :KDVEDLAKYATV T0356 351 :IVDFY 1pvvA 125 :VINGL T0356 357 :P 1pvvA 130 :S T0356 371 :KKQYAGHAKRVMMGVWSFLRQFM 1pvvA 131 :DFSHPCQALADYMTIWEKKGTIK T0356 396 :KFVIVCDDD 1pvvA 156 :KVVYVGDGN T0356 410 :WNDVIWAITT 1pvvA 167 :AHSLMIAGTK T0356 447 :LGSKMGLD 1pvvA 177 :LGADVVVA T0356 467 :WG 1pvvA 185 :TP T0356 471 :IKKDPDVVAHIDAIWDELA 1pvvA 189 :YEPDEKVIKWAEQNAAESG Number of specific fragments extracted= 18 number of extra gaps= 4 total=618 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w1wA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1w1wA expands to /projects/compbio/data/pdb/1w1w.pdb.gz 1w1wA:# T0356 read from 1w1wA/merged-good-all-a2m # 1w1wA read from 1w1wA/merged-good-all-a2m # adding 1w1wA to template set # found chain 1w1wA in template set Warning: unaligning (T0356)Q79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)L62 Warning: unaligning (T0356)P101 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w1wA)L62 Warning: unaligning (T0356)K123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)P89 Warning: unaligning (T0356)R173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w1wA)P89 Warning: unaligning (T0356)F348 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)G1095 Warning: unaligning (T0356)C361 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w1wA)G1095 Warning: unaligning (T0356)A366 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)K1113 Warning: unaligning (T0356)D474 because last residue in template chain is (1w1wA)Y1223 T0356 25 :ITLPV 1w1wA 19 :TKVGF T0356 45 :AGGPALLFENPKGY 1w1wA 24 :GESNFTSIIGPNGS T0356 68 :GTPKRVAMGMG 1w1wA 41 :NMMDAISFVLG T0356 102 :KGF 1w1wA 63 :KDL T0356 120 :MPT 1w1wA 66 :IYR T0356 174 :QNLGIYRQQLIGKN 1w1wA 90 :QSAYVKAFYQKGNK T0356 188 :KLIMRWLSHRG 1w1wA 106 :ELMRIISRNGD T0356 199 :GALDYQEWCAAHP 1w1wA 127 :SYKDYSIFLENEN T0356 212 :GE 1w1wA 152 :GD T0356 333 :GVALNEVFVPILQKQ 1w1wA 1068 :FDYVSDHLDAIYREL T0356 362 :SYRL 1w1wA 1096 :NASL T0356 375 :AGHAKRVMMGVWSFLRQFMYTKFVIV 1w1wA 1131 :GGEKTVAALALLFAINSYQPSPFFVL T0356 401 :CDDDVNARDWNDVIWAITTRMDPARDTVLVEN 1w1wA 1159 :VDAALDITNVQRIAAYIRRHRNPDLQFIVISL T0356 444 :V 1w1wA 1191 :K T0356 447 :LGSKMGLDATNKWPGETQREWGRPIKK 1w1wA 1196 :EKSDALVGVYRQQQENSSKIITLDLSN Number of specific fragments extracted= 15 number of extra gaps= 0 total=633 Number of alignments=43 # 1w1wA read from 1w1wA/merged-good-all-a2m # found chain 1w1wA in template set Warning: unaligning (T0356)Q79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)L62 Warning: unaligning (T0356)P101 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w1wA)L62 Warning: unaligning (T0356)K123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)P89 Warning: unaligning (T0356)Q174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w1wA)P89 Warning: unaligning (T0356)F348 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)G1095 Warning: unaligning (T0356)P357 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w1wA)K1113 Warning: unaligning (T0356)T369 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w1wA)K1113 Warning: unaligning (T0356)D474 because last residue in template chain is (1w1wA)Y1223 T0356 24 :RITLPV 1w1wA 18 :VTKVGF T0356 45 :AGGPALLFENPKGY 1w1wA 24 :GESNFTSIIGPNGS T0356 69 :TPKRVAMGMG 1w1wA 42 :MMDAISFVLG T0356 102 :KGF 1w1wA 63 :KDL T0356 120 :MPT 1w1wA 66 :IYR T0356 175 :NLGIYRQQLIGKN 1w1wA 90 :QSAYVKAFYQKGN T0356 188 :KLIMRWLSHRG 1w1wA 106 :ELMRIISRNGD T0356 200 :ALDYQEWCAAHP 1w1wA 128 :YKDYSIFLENEN T0356 212 :GE 1w1wA 152 :GD T0356 333 :GVALNEVFVPILQKQ 1w1wA 1068 :FDYVSDHLDAIYREL T0356 353 :DFYL 1w1wA 1096 :NASL T0356 370 :IKK 1w1wA 1114 :YHA T0356 373 :QYAGHAKRVMMGVWSFLRQFMYTKFVIVCD 1w1wA 1128 :YLSGGEKTVAALALLFAINSYQPSPFFVLD T0356 403 :DDVNARDWNDVIWAITTRMDPARDTVLV 1w1wA 1161 :AALDITNVQRIAAYIRRHRNPDLQFIVI T0356 447 :LGSKMGLDATNKWPGETQREWGRPIKK 1w1wA 1196 :EKSDALVGVYRQQQENSSKIITLDLSN Number of specific fragments extracted= 15 number of extra gaps= 0 total=648 Number of alignments=44 # 1w1wA read from 1w1wA/merged-good-all-a2m # found chain 1w1wA in template set T0356 375 :AGHAKRVMMGVWSFLRQFMYTKFVIV 1w1wA 1131 :GGEKTVAALALLFAINSYQPSPFFVL T0356 401 :CDDDVNARDWNDVIWAITTRMDPARDTVLVEN 1w1wA 1159 :VDAALDITNVQRIAAYIRRHRNPDLQFIVISL Number of specific fragments extracted= 2 number of extra gaps= 0 total=650 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jwxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0356/1jwxA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0356/1jwxA/merged-good-all-a2m.gz for input Trying 1jwxA/merged-good-all-a2m Error: Couldn't open file 1jwxA/merged-good-all-a2m or 1jwxA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2u1a/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2u1a expands to /projects/compbio/data/pdb/2u1a.pdb.gz 2u1a:Warning: there is no chain 2u1a will retry with 2u1aA # T0356 read from 2u1a/merged-good-all-a2m # 2u1a read from 2u1a/merged-good-all-a2m # adding 2u1a to template set # found chain 2u1a in template set T0356 312 :REDAIYHSTYTGRPPDE 2u1a 8 :SENPPNHILFLTNLPEE T0356 337 :NEVFVPILQK 2u1a 27 :ELMLSMLFNQ T0356 348 :FPEIVDFYLPPEGC 2u1a 37 :FPGFKEVRLVPGRH T0356 364 :RLAVVTIK 2u1a 51 :DIAFVEFD T0356 374 :YAGHAKRVMM 2u1a 59 :NEVQAGAARD Number of specific fragments extracted= 5 number of extra gaps= 0 total=655 Number of alignments=46 # 2u1a read from 2u1a/merged-good-all-a2m # found chain 2u1a in template set T0356 312 :REDAIYHSTYTGRPPDE 2u1a 8 :SENPPNHILFLTNLPEE T0356 337 :NEVFVPIL 2u1a 27 :ELMLSMLF T0356 346 :KQFPEIVDFYLPPEG 2u1a 35 :NQFPGFKEVRLVPGR T0356 363 :YRLAVVTI 2u1a 50 :HDIAFVEF T0356 373 :QYAGHAKRVMMG 2u1a 58 :DNEVQAGAARDA Number of specific fragments extracted= 5 number of extra gaps= 0 total=660 Number of alignments=47 # 2u1a read from 2u1a/merged-good-all-a2m # found chain 2u1a in template set T0356 313 :EDAIYHSTYTGRPPDEP 2u1a 9 :ENPPNHILFLTNLPEET T0356 337 :NEVFVPILQKQFPEIVDFYLPPEGC 2u1a 26 :NELMLSMLFNQFPGFKEVRLVPGRH T0356 364 :RLAVVTIK 2u1a 51 :DIAFVEFD T0356 374 :YAGHAKRVMM 2u1a 59 :NEVQAGAARD Number of specific fragments extracted= 4 number of extra gaps= 0 total=664 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vjeA expands to /projects/compbio/data/pdb/1vje.pdb.gz 1vjeA:# T0356 read from 1vjeA/merged-good-all-a2m # 1vjeA read from 1vjeA/merged-good-all-a2m # adding 1vjeA to template set # found chain 1vjeA in template set Warning: unaligning (T0356)P358 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vjeA)R83 Warning: unaligning (T0356)G360 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vjeA)R83 T0356 291 :HTGYYNEVDSFPVFTVTHITQR 1vjeA 9 :SFDLDHTKVKAPYVRLAGVKTT T0356 313 :EDAIYHSTYTGRPPDE 1vjeA 33 :GDQISKYDLRFLQPNQ T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLP 1vjeA 52 :DPAAIHTLEHLLAGYMRDHLEGVVDVSPM T0356 361 :C 1vjeA 84 :T T0356 365 :LAVVTIKKQY 1vjeA 85 :GMYMAVIGEP T0356 375 :AGHAKRVMMGVWSFLRQF 1vjeA 96 :EQGVMKAFEAALKDTAGH T0356 402 :DD 1vjeA 114 :DQ T0356 430 :VENTP 1vjeA 117 :IPGVS T0356 444 :VSGL 1vjeA 122 :ELEC T0356 468 :GRPIKKD 1vjeA 126 :GNYRDHD T0356 475 :PDVVAHIDAIWDE 1vjeA 134 :AAARQHARDVLDQ Number of specific fragments extracted= 11 number of extra gaps= 0 total=675 Number of alignments=49 # 1vjeA read from 1vjeA/merged-good-all-a2m # found chain 1vjeA in template set Warning: unaligning (T0356)P358 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vjeA)R83 Warning: unaligning (T0356)G360 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vjeA)R83 Warning: unaligning (T0356)L498 because last residue in template chain is (1vjeA)L156 T0356 297 :EVDSFPVFTVTHITQRED 1vjeA 15 :TKVKAPYVRLAGVKTTPK T0356 315 :AIYHSTYTGRPPDE 1vjeA 35 :QISKYDLRFLQPNQ T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLP 1vjeA 52 :DPAAIHTLEHLLAGYMRDHLEGVVDVSPM T0356 361 :CSYRLAV 1vjeA 84 :TGMYMAV T0356 371 :KKQYAGHAKRVMMGVWSFLRQFM 1vjeA 92 :GEPDEQGVMKAFEAALKDTAGHD T0356 403 :DD 1vjeA 115 :QP T0356 430 :VENTP 1vjeA 117 :IPGVS T0356 461 :GETQREWG 1vjeA 122 :ELECGNYR T0356 472 :KKD 1vjeA 130 :DHD T0356 475 :PDVVAHIDAIWDE 1vjeA 134 :AAARQHARDVLDQ T0356 489 :AIFNNGKSA 1vjeA 147 :GLKVQETIL Number of specific fragments extracted= 11 number of extra gaps= 0 total=686 Number of alignments=50 # 1vjeA read from 1vjeA/merged-good-all-a2m # found chain 1vjeA in template set Warning: unaligning (T0356)D290 because first residue in template chain is (1vjeA)E8 Warning: unaligning (T0356)P358 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vjeA)R83 Warning: unaligning (T0356)G360 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vjeA)R83 T0356 291 :HTGYYNEVDSFPVFTVTHITQRE 1vjeA 9 :SFDLDHTKVKAPYVRLAGVKTTP T0356 314 :DAIYHSTYTGRPPDE 1vjeA 34 :DQISKYDLRFLQPNQ T0356 329 :PAVLGVALNEVFVPILQKQFPEIVDFYLP 1vjeA 52 :DPAAIHTLEHLLAGYMRDHLEGVVDVSPM T0356 361 :CSYRLAV 1vjeA 84 :TGMYMAV T0356 370 :IKKQYAGHAKRVMMGVWSFLRQ 1vjeA 91 :IGEPDEQGVMKAFEAALKDTAG T0356 421 :MDP 1vjeA 113 :HDQ T0356 438 :LDFASPVSGLG 1vjeA 116 :PIPGVSELECG T0356 460 :PGETQ 1vjeA 127 :NYRDH T0356 473 :KDPDVVAHIDAIWDE 1vjeA 132 :DLAAARQHARDVLDQ Number of specific fragments extracted= 9 number of extra gaps= 0 total=695 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2dbbA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2dbbA expands to /projects/compbio/data/pdb/2dbb.pdb.gz 2dbbA:# T0356 read from 2dbbA/merged-good-all-a2m # 2dbbA read from 2dbbA/merged-good-all-a2m # adding 2dbbA to template set # found chain 2dbbA in template set T0356 7 :NDLRDFLTLLEQ 2dbbA 9 :RVDMQLVKILSE T0356 19 :QG 2dbbA 22 :SR T0356 68 :GTPKRVAMGMGQED 2dbbA 24 :LTYRELADILNTTR T0356 83 :SALREVGK 2dbbA 38 :QRIARRID T0356 113 :QFKQV 2dbbA 46 :KLKKL T0356 119 :NM 2dbbA 51 :GI T0356 130 :CQQKIVSG 2dbbA 53 :IRKFTIIP T0356 141 :DLNR 2dbbA 61 :DIDK T0356 172 :ER 2dbbA 66 :GY T0356 187 :NKLIMRWLSHR 2dbbA 68 :MYAIVLIKSKV T0356 200 :ALDYQEWCAAHPGE 2dbbA 79 :PSDADKVISEISDI T0356 252 :K 2dbbA 93 :E T0356 302 :PVFTVTHITQREDAIYHSTYTGR 2dbbA 94 :YVKSVEKGVGRYNIIVRLLLPKD T0356 334 :VALNEVFVPILQKQFPEIVDFY 2dbbA 117 :IKDAENLISEFLQRIKNAENVE Number of specific fragments extracted= 14 number of extra gaps= 0 total=709 Number of alignments=52 # 2dbbA read from 2dbbA/merged-good-all-a2m # found chain 2dbbA in template set T0356 7 :NDLRDFLTLLEQQ 2dbbA 9 :RVDMQLVKILSEN T0356 45 :AG 2dbbA 22 :SR T0356 68 :GTPKRVAMGMGQEDVSALREVGKLLAF 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKL T0356 119 :NM 2dbbA 51 :GI T0356 130 :CQQKIVS 2dbbA 53 :IRKFTII T0356 167 :RGPHK 2dbbA 60 :PDIDK T0356 172 :ERQ 2dbbA 66 :GYM T0356 188 :KLIMRWLSH 2dbbA 69 :YAIVLIKSK T0356 199 :GALDYQEWCAAHPGE 2dbbA 78 :VPSDADKVISEISDI T0356 290 :DHTGYYNEVDSFPVFTVTHITQRE 2dbbA 93 :EYVKSVEKGVGRYNIIVRLLLPKD T0356 334 :VALNEVFVPILQKQFPEIVDFY 2dbbA 117 :IKDAENLISEFLQRIKNAENVE Number of specific fragments extracted= 11 number of extra gaps= 0 total=720 Number of alignments=53 # 2dbbA read from 2dbbA/merged-good-all-a2m # found chain 2dbbA in template set T0356 10 :RDFLTLLEQ 2dbbA 12 :MQLVKILSE T0356 20 :G 2dbbA 22 :S T0356 46 :G 2dbbA 23 :R T0356 68 :GTPKRVAMGMGQED 2dbbA 24 :LTYRELADILNTTR T0356 83 :SALREVGKLLAFLK 2dbbA 38 :QRIARRIDKLKKLG T0356 129 :PCQQKIVSGDDVDL 2dbbA 52 :IIRKFTIIPDIDKL T0356 172 :ER 2dbbA 66 :GY T0356 187 :NKLIMRWLSHRGGALDYQ 2dbbA 68 :MYAIVLIKSKVPSDADKV T0356 207 :CAAHPGER 2dbbA 86 :ISEISDIE T0356 291 :H 2dbbA 94 :Y T0356 303 :VFTVTHITQREDAIYHSTYTGR 2dbbA 95 :VKSVEKGVGRYNIIVRLLLPKD T0356 334 :VALNEVFVPILQKQFPEIVDFY 2dbbA 117 :IKDAENLISEFLQRIKNAENVE Number of specific fragments extracted= 12 number of extra gaps= 0 total=732 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1o6jA expands to /projects/compbio/data/pdb/1o6j.pdb.gz 1o6jA:Skipped atom 799, because occupancy 0.500 <= existing 0.500 in 1o6jA Skipped atom 801, because occupancy 0.500 <= existing 0.500 in 1o6jA Skipped atom 803, because occupancy 0.500 <= existing 0.500 in 1o6jA Skipped atom 805, because occupancy 0.500 <= existing 0.500 in 1o6jA Skipped atom 807, because occupancy 0.500 <= existing 0.500 in 1o6jA # T0356 read from 1o6jA/merged-good-all-a2m # 1o6jA read from 1o6jA/merged-good-all-a2m # adding 1o6jA to template set # found chain 1o6jA in template set T0356 358 :PEGCSYRLAVVTIKKQY 1o6jA 40 :PSLAGKTVFFYFSASWC T0356 375 :AGHAKRVMMGVWS 1o6jA 60 :RAFTPQLIDFYKA T0356 389 :LRQFMYTK 1o6jA 73 :HAEKKNFE T0356 398 :VIVCDDD 1o6jA 81 :VMLISWD T0356 408 :RDWNDVIWAIT 1o6jA 88 :ESAEDFKDYYA T0356 432 :NTPIDYLDFAS 1o6jA 99 :KMPWLALPFED Number of specific fragments extracted= 6 number of extra gaps= 0 total=738 Number of alignments=55 # 1o6jA read from 1o6jA/merged-good-all-a2m # found chain 1o6jA in template set T0356 342 :PILQKQFPEIVDFYL 1o6jA 17 :SGLKKFFPYSTNVLK T0356 357 :PPEGCSYRLAVVTIKKQYAG 1o6jA 39 :LPSLAGKTVFFYFSASWCPP T0356 377 :HAKRVMMGVWSF 1o6jA 62 :FTPQLIDFYKAH T0356 390 :RQFMYTKFVIVC 1o6jA 74 :AEKKNFEVMLIS T0356 402 :DD 1o6jA 87 :DE T0356 409 :DWNDVIWAIT 1o6jA 89 :SAEDFKDYYA T0356 432 :NTPIDYLDFAS 1o6jA 99 :KMPWLALPFED T0356 478 :VAHIDAIWDELAIFNNGKSALEH 1o6jA 110 :RKGMEFLTTGFDVKSIPTLVGVE Number of specific fragments extracted= 8 number of extra gaps= 0 total=746 Number of alignments=56 # 1o6jA read from 1o6jA/merged-good-all-a2m # found chain 1o6jA in template set T0356 5 :KYNDLRDFLTLLEQ 1o6jA 55 :WCPPCRAFTPQLID T0356 38 :IADRT 1o6jA 69 :FYKAH T0356 55 :PKGYSMPVLCNLF 1o6jA 74 :AEKKNFEVMLISW T0356 79 :QEDVSALREVGK 1o6jA 87 :DESAEDFKDYYA T0356 94 :FLKEPEPPKGFRDLFDKLPQFKQVLNM 1o6jA 99 :KMPWLALPFEDRKGMEFLTTGFDVKSI T0356 161 :WGLTVTRGPHKERQ 1o6jA 126 :PTLVGVEADSGNII Number of specific fragments extracted= 6 number of extra gaps= 0 total=752 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fbiA expands to /projects/compbio/data/pdb/2fbi.pdb.gz 2fbiA:Skipped atom 2, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 4, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 6, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 12, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 14, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 16, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 18, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 20, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 22, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 250, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 252, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 254, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 256, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 258, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 260, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 262, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 266, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 443, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 445, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 447, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 449, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 451, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 453, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 455, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 457, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 718, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 720, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 722, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 724, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 726, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 728, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 730, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 732, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 734, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 736, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 738, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 829, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 831, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 833, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 835, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 837, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 839, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 891, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 893, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 895, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 897, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 899, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 901, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 903, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 905, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1017, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1019, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1021, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1023, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1025, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1027, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1029, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1031, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1033, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1091, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1093, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1095, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1097, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1099, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1101, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1103, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1105, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1107, because occupancy 0.500 <= existing 0.500 in 2fbiA # T0356 read from 2fbiA/merged-good-all-a2m # 2fbiA read from 2fbiA/merged-good-all-a2m # adding 2fbiA to template set # found chain 2fbiA in template set Warning: unaligning (T0356)K56 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0356)G57 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0356 4 :MKYNDLRDFLTLLEQQGELKRITLP 2fbiA 60 :ILRPSMTGVLARLERDGIVRRWKAP T0356 58 :YS 2fbiA 87 :QR T0356 61 :PVLCNLF 2fbiA 89 :RVYVNLT T0356 71 :KRVAMGM 2fbiA 96 :EKGQQCF T0356 82 :VSALREVGKLLAF 2fbiA 106 :SGDMEKNYQRIQE T0356 100 :PPKGFRDLFDKLPQFKQ 2fbiA 121 :GEEKLAQLLELLNELKK Number of specific fragments extracted= 6 number of extra gaps= 1 total=758 Number of alignments=58 # 2fbiA read from 2fbiA/merged-good-all-a2m # found chain 2fbiA in template set T0356 6 :YNDLRDFLTLLEQQGELKRITLP 2fbiA 62 :RPSMTGVLARLERDGIVRRWKAP T0356 63 :LCNL 2fbiA 91 :YVNL T0356 70 :PKRVAMGM 2fbiA 95 :TEKGQQCF T0356 82 :VSALREV 2fbiA 106 :SGDMEKN T0356 89 :GKLLAFL 2fbiA 114 :QRIQERF T0356 100 :PPKGFRDLFDKLPQFKQ 2fbiA 121 :GEEKLAQLLELLNELKK Number of specific fragments extracted= 6 number of extra gaps= 0 total=764 Number of alignments=59 # 2fbiA read from 2fbiA/merged-good-all-a2m # found chain 2fbiA in template set Warning: unaligning (T0356)K56 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0356)G57 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0356 5 :KYNDLRDFLTLLEQQGELKRITLP 2fbiA 61 :LRPSMTGVLARLERDGIVRRWKAP T0356 58 :YSMPVL 2fbiA 87 :QRRVYV T0356 65 :NL 2fbiA 93 :NL T0356 70 :PKRVAMGM 2fbiA 95 :TEKGQQCF T0356 80 :EDVSALREVGKLLAFLKE 2fbiA 104 :SMSGDMEKNYQRIQERFG T0356 101 :PKGFRDLFDKLPQFKQV 2fbiA 122 :EEKLAQLLELLNELKKI Number of specific fragments extracted= 6 number of extra gaps= 1 total=770 Number of alignments=60 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0356//projects/compbio/experiments/protein-predict/casp7/T0356/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0356//projects/compbio/experiments/protein-predict/casp7/T0356/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0356/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0356/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0356)V341.CB, (T0356)F354.CB) [> 3.4511 = 5.7518 < 7.4773] w=1.0000 to align # Constraint # added constraint: constraint((T0356)N337.CB, (T0356)Y355.CB) [> 4.0167 = 6.6946 < 8.7029] w=0.9382 to align # Constraint # added constraint: constraint((T0356)N337.CB, (T0356)L356.CB) [> 3.0303 = 5.0506 < 6.5657] w=0.9264 to align # Constraint # added constraint: constraint((T0356)V341.CB, (T0356)D353.CB) [> 3.9067 = 6.5112 < 8.4645] w=0.9219 to align # Constraint # added constraint: constraint((T0356)L344.CB, (T0356)V381.CB) [> 3.8768 = 6.4613 < 8.3997] w=0.9103 to align # Constraint # added constraint: constraint((T0356)F340.CB, (T0356)V385.CB) [> 3.9001 = 6.5002 < 8.4502] w=0.8942 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)T253.CB) [> 3.6031 = 6.0051 < 7.8066] w=0.8663 to align # Constraint # added constraint: constraint((T0356)F340.CB, (T0356)F354.CB) [> 3.3025 = 5.5042 < 7.1554] w=0.8505 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)L429.CB) [> 3.6688 = 6.1147 < 7.9492] w=0.8453 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)V428.CB) [> 3.7409 = 6.2348 < 8.1053] w=0.8453 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)V428.CB) [> 3.4472 = 5.7453 < 7.4689] w=0.8453 to align # Constraint # added constraint: constraint((T0356)Q347.CB, (T0356)V381.CB) [> 3.2446 = 5.4076 < 7.0299] w=0.8058 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)Y317.CB) [> 3.6335 = 6.0559 < 7.8726] w=0.8047 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)A366.CB) [> 3.9669 = 6.6115 < 8.5949] w=0.7781 to align # Constraint # added constraint: constraint((T0356)Q345.CB, (T0356)F354.CB) [> 4.2607 = 7.1013 < 9.2316] w=0.7684 to align # Constraint # added constraint: constraint((T0356)L344.CB, (T0356)F354.CB) [> 2.9380 = 4.8967 < 6.3657] w=0.7602 to align # Constraint # added constraint: constraint((T0356)I316.CB, (T0356)V352.CB) [> 4.2904 = 7.1506 < 9.2958] w=0.7570 to align # Constraint # added constraint: constraint((T0356)Q347.CB, (T0356)R380.CB) [> 4.2747 = 7.1245 < 9.2618] w=0.7512 to align # Constraint # added constraint: constraint((T0356)V341.CB, (T0356)I351.CB) [> 3.8461 = 6.4101 < 8.3331] w=0.7382 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)T253.CB) [> 3.6830 = 6.1383 < 7.9798] w=0.7277 to align # Constraint # added constraint: constraint((T0356)F340.CB, (T0356)A366.CB) [> 3.7695 = 6.2826 < 8.1673] w=0.7246 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)V367.CB) [> 3.7754 = 6.2923 < 8.1800] w=0.7229 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)L365.CB) [> 4.1056 = 6.8427 < 8.8955] w=0.7222 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)D426.CB) [> 3.7004 = 6.1672 < 8.0174] w=0.6863 to align # Constraint # added constraint: constraint((T0356)Q347.CB, (T0356)G384.CA) [> 3.7214 = 6.2023 < 8.0630] w=0.6825 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)R364.CB) [> 3.3701 = 5.6168 < 7.3018] w=0.6714 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)A366.CB) [> 3.3438 = 5.5731 < 7.2450] w=0.6714 to align # Constraint # added constraint: constraint((T0356)L344.CB, (T0356)V385.CB) [> 2.8704 = 4.7840 < 6.2192] w=0.6579 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)L429.CB) [> 4.3363 = 7.2271 < 9.3952] w=0.6561 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)V256.CB) [> 3.5346 = 5.8910 < 7.6583] w=0.6546 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)E254.CB) [> 4.2980 = 7.1633 < 9.3123] w=0.6546 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)E254.CB) [> 3.7755 = 6.2925 < 8.1802] w=0.6546 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)T253.CB) [> 4.2052 = 7.0086 < 9.1112] w=0.6546 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)H318.CB) [> 4.4699 = 7.4497 < 9.6847] w=0.6516 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)T320.CB) [> 4.1846 = 6.9743 < 9.0666] w=0.6516 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)S319.CB) [> 3.7156 = 6.1926 < 8.0504] w=0.6516 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)A378.CB) [> 4.0309 = 6.7181 < 8.7336] w=0.6472 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)V385.CB) [> 3.8544 = 6.4241 < 8.3513] w=0.6471 to align # Constraint # added constraint: constraint((T0356)A243.CB, (T0356)T253.CB) [> 3.6094 = 6.0157 < 7.8205] w=0.6469 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)T253.CB) [> 3.3213 = 5.5355 < 7.1962] w=0.6469 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)V352.CB) [> 4.1010 = 6.8349 < 8.8854] w=0.6465 to align # Constraint # added constraint: constraint((T0356)E350.CB, (T0356)I370.CB) [> 2.9136 = 4.8561 < 6.3129] w=0.6337 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)V413.CB) [> 3.8250 = 6.3750 < 8.2874] w=0.6316 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)T427.CB) [> 3.2920 = 5.4867 < 7.1327] w=0.6157 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)R425.CB) [> 3.9322 = 6.5537 < 8.5198] w=0.6157 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)R425.CB) [> 3.6858 = 6.1429 < 7.9858] w=0.6157 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)A366.CB) [> 4.1000 = 6.8334 < 8.8834] w=0.6143 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)F354.CB) [> 3.4053 = 5.6754 < 7.3780] w=0.6141 to align # Constraint # added constraint: constraint((T0356)L336.CB, (T0356)L356.CB) [> 3.9370 = 6.5617 < 8.5302] w=0.6101 to align # Constraint # added constraint: constraint((T0356)G333.CA, (T0356)L356.CB) [> 3.4716 = 5.7861 < 7.5219] w=0.6101 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)V430.CB) [> 3.4808 = 5.8014 < 7.5418] w=0.6084 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)S319.CB) [> 3.6517 = 6.0862 < 7.9121] w=0.6069 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)V256.CB) [> 4.1335 = 6.8892 < 8.9559] w=0.6046 to align # Constraint # added constraint: constraint((T0356)D402.CB, (T0356)E431.CB) [> 3.5711 = 5.9518 < 7.7373] w=0.6031 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)V367.CB) [> 3.9446 = 6.5744 < 8.5467] w=0.6012 to align # Constraint # added constraint: constraint((T0356)I343.CB, (T0356)V385.CB) [> 2.6980 = 4.4966 < 5.8456] w=0.5993 to align # Constraint # added constraint: constraint((T0356)I343.CB, (T0356)G384.CA) [> 4.1080 = 6.8467 < 8.9007] w=0.5993 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)V428.CB) [> 4.0416 = 6.7359 < 8.7567] w=0.5978 to align # Constraint # added constraint: constraint((T0356)F348.CB, (T0356)V381.CB) [> 2.5952 = 4.3253 < 5.6229] w=0.5909 to align # Constraint # added constraint: constraint((T0356)F348.CB, (T0356)A378.CB) [> 4.1769 = 6.9615 < 9.0499] w=0.5909 to align # Constraint # added constraint: constraint((T0356)F348.CB, (T0356)H377.CB) [> 3.6155 = 6.0258 < 7.8335] w=0.5909 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)L365.CB) [> 3.8281 = 6.3802 < 8.2942] w=0.5909 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)A378.CB) [> 3.5936 = 5.9893 < 7.7861] w=0.5909 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)V367.CB) [> 4.2719 = 7.1198 < 9.2557] w=0.5909 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)I351.CB) [> 4.3306 = 7.2176 < 9.3829] w=0.5881 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)V430.CB) [> 3.9697 = 6.6162 < 8.6010] w=0.5851 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)L365.CB) [> 3.3847 = 5.6411 < 7.3334] w=0.5829 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)R364.CB) [> 4.3903 = 7.3171 < 9.5122] w=0.5829 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)L365.CB) [> 4.1734 = 6.9557 < 9.0425] w=0.5829 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)V367.CB) [> 3.4310 = 5.7184 < 7.4339] w=0.5829 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)V413.CB) [> 3.8483 = 6.4139 < 8.3380] w=0.5783 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)C258.CB) [> 3.5391 = 5.8984 < 7.6680] w=0.5780 to align # Constraint # added constraint: constraint((T0356)D404.CB, (T0356)V430.CB) [> 4.1603 = 6.9338 < 9.0140] w=0.5740 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)V381.CB) [> 3.9772 = 6.6286 < 8.6172] w=0.5639 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)A378.CB) [> 3.6519 = 6.0865 < 7.9124] w=0.5639 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)V367.CB) [> 4.3153 = 7.1922 < 9.3499] w=0.5634 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)V367.CB) [> 3.1689 = 5.2815 < 6.8660] w=0.5634 to align # Constraint # added constraint: constraint((T0356)F340.CB, (T0356)L356.CB) [> 3.6342 = 6.0570 < 7.8741] w=0.5633 to align # Constraint # added constraint: constraint((T0356)P349.CB, (T0356)K371.CB) [> 4.3324 = 7.2207 < 9.3869] w=0.5578 to align # Constraint # added constraint: constraint((T0356)W386.CB, (T0356)W485.CB) [> 3.6532 = 6.0887 < 7.9152] w=0.5549 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)F244.CB) [> 3.7272 = 6.2121 < 8.0757] w=0.5539 to align # Constraint # added constraint: constraint((T0356)I309.CB, (T0356)H318.CB) [> 4.0830 = 6.8051 < 8.8466] w=0.5531 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)T320.CB) [> 2.7402 = 4.5670 < 5.9372] w=0.5523 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)S319.CB) [> 4.1601 = 6.9335 < 9.0135] w=0.5523 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)Y321.CB) [> 3.6562 = 6.0937 < 7.9218] w=0.5523 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)T322.CB) [> 3.6527 = 6.0878 < 7.9141] w=0.5523 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)S319.CB) [> 3.7113 = 6.1856 < 8.0412] w=0.5438 to align # Constraint # added constraint: constraint((T0356)D404.CB, (T0356)E431.CB) [> 3.5799 = 5.9665 < 7.7564] w=0.5424 to align # Constraint # added constraint: constraint((T0356)I316.CB, (T0356)I351.CB) [> 2.9664 = 4.9441 < 6.4273] w=0.5350 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)T427.CB) [> 4.1779 = 6.9632 < 9.0522] w=0.5325 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)D426.CB) [> 3.5176 = 5.8627 < 7.6216] w=0.5325 to align # Constraint # added constraint: constraint((T0356)I343.CB, (T0356)F388.CB) [> 2.8224 = 4.7040 < 6.1151] w=0.5295 to align # Constraint # added constraint: constraint((T0356)L336.CB, (T0356)L389.CB) [> 3.7892 = 6.3154 < 8.2100] w=0.5295 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)D426.CB) [> 2.5850 = 4.3083 < 5.6008] w=0.5272 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)R425.CB) [> 3.8530 = 6.4217 < 8.3482] w=0.5272 to align # Constraint # added constraint: constraint((T0356)T395.CB, (T0356)R425.CB) [> 4.2897 = 7.1494 < 9.2943] w=0.5272 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)F244.CB) [> 4.0521 = 6.7535 < 8.7795] w=0.5183 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)A375.CB) [> 3.2497 = 5.4162 < 7.0411] w=0.5161 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)A378.CB) [> 3.7311 = 6.2185 < 8.0840] w=0.5161 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)V256.CB) [> 2.8254 = 4.7090 < 6.1217] w=0.5161 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)T427.CB) [> 3.7707 = 6.2846 < 8.1699] w=0.5150 to align # Constraint # added constraint: constraint((T0356)E350.CB, (T0356)K371.CB) [> 2.5309 = 4.2181 < 5.4836] w=0.5149 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)V368.CB) [> 3.6403 = 6.0672 < 7.8873] w=0.5127 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)T369.CB) [> 2.9388 = 4.8980 < 6.3674] w=0.5127 to align # Constraint # added constraint: constraint((T0356)F348.CB, (T0356)I370.CB) [> 3.8831 = 6.4719 < 8.4135] w=0.5127 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)Y242.CB) [> 4.3713 = 7.2855 < 9.4712] w=0.5099 to align # Constraint # added constraint: constraint((T0356)C207.CB, (T0356)L248.CB) [> 4.3743 = 7.2905 < 9.4776] w=0.5098 to align # Constraint # added constraint: constraint((T0356)Y179.CB, (T0356)M191.CB) [> 3.3810 = 5.6350 < 7.3254] w=0.5021 to align # Constraint # added constraint: constraint((T0356)L344.CB, (T0356)M382.CB) [> 4.3270 = 7.2117 < 9.3752] w=0.5009 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)L429.CB) [> 3.6124 = 6.0208 < 7.8270] w=0.4971 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)I417.CB) [> 3.2027 = 5.3378 < 6.9392] w=0.4953 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)V255.CB) [> 4.4967 = 7.4944 < 9.7427] w=0.4951 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)D353.CB) [> 4.1687 = 6.9478 < 9.0321] w=0.4926 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)H318.CB) [> 2.5085 = 4.1809 < 5.4352] w=0.4892 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)T320.CB) [> 3.0078 = 5.0129 < 6.5168] w=0.4892 to align # Constraint # added constraint: constraint((T0356)H308.CB, (T0356)Y317.CB) [> 4.0929 = 6.8215 < 8.8679] w=0.4892 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)F340.CB) [> 4.4818 = 7.4696 < 9.7105] w=0.4860 to align # Constraint # added constraint: constraint((T0356)G230.CA, (T0356)A245.CB) [> 3.2961 = 5.4936 < 7.1416] w=0.4851 to align # Constraint # added constraint: constraint((T0356)G230.CA, (T0356)F244.CB) [> 3.3338 = 5.5564 < 7.2233] w=0.4851 to align # Constraint # added constraint: constraint((T0356)W193.CB, (T0356)Y203.CB) [> 4.4907 = 7.4845 < 9.7299] w=0.4811 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)V255.CB) [> 3.5509 = 5.9181 < 7.6936] w=0.4750 to align # Constraint # added constraint: constraint((T0356)G230.CA, (T0356)A243.CB) [> 3.4914 = 5.8190 < 7.5646] w=0.4744 to align # Constraint # added constraint: constraint((T0356)G230.CA, (T0356)Y242.CB) [> 2.8865 = 4.8109 < 6.2541] w=0.4744 to align # Constraint # added constraint: constraint((T0356)L229.CB, (T0356)Y242.CB) [> 4.1388 = 6.8980 < 8.9674] w=0.4744 to align # Constraint # added constraint: constraint((T0356)P325.CB, (T0356)L356.CB) [> 3.5157 = 5.8595 < 7.6174] w=0.4711 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)I370.CB) [> 3.5707 = 5.9512 < 7.7365] w=0.4698 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)I370.CB) [> 3.7966 = 6.3277 < 8.2260] w=0.4698 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)Y317.CB) [> 4.4336 = 7.3893 < 9.6061] w=0.4627 to align # Constraint # added constraint: constraint((T0356)D402.CB, (T0356)V413.CB) [> 3.4445 = 5.7409 < 7.4631] w=0.4606 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)L356.CB) [> 3.9555 = 6.5926 < 8.5703] w=0.4546 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)L356.CB) [> 3.5721 = 5.9535 < 7.7396] w=0.4546 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)Y355.CB) [> 3.0738 = 5.1231 < 6.6600] w=0.4546 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)F354.CB) [> 4.3748 = 7.2914 < 9.4788] w=0.4546 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)Y355.CB) [> 4.0215 = 6.7025 < 8.7132] w=0.4546 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)F354.CB) [> 4.1241 = 6.8735 < 8.9356] w=0.4546 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)D353.CB) [> 3.2637 = 5.4394 < 7.0713] w=0.4546 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)L247.CB) [> 3.5904 = 5.9840 < 7.7791] w=0.4536 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)V385.CB) [> 3.6751 = 6.1252 < 7.9628] w=0.4483 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)V352.CB) [> 3.2331 = 5.3885 < 7.0051] w=0.4470 to align # Constraint # added constraint: constraint((T0356)V339.CB, (T0356)F388.CB) [> 4.2579 = 7.0965 < 9.2254] w=0.4463 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)K257.CB) [> 3.7348 = 6.2246 < 8.0920] w=0.4451 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)C258.CB) [> 4.3398 = 7.2330 < 9.4028] w=0.4451 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)T427.CB) [> 4.5360 = 7.5600 < 9.8280] w=0.4440 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)T427.CB) [> 3.4183 = 5.6972 < 7.4063] w=0.4387 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)I417.CB) [> 3.3535 = 5.5891 < 7.2658] w=0.4385 to align # Constraint # added constraint: constraint((T0356)L344.CB, (T0356)V368.CB) [> 3.5430 = 5.9051 < 7.6766] w=0.4367 to align # Constraint # added constraint: constraint((T0356)N432.CB, (T0356)V444.CB) [> 3.2215 = 5.3692 < 6.9799] w=0.4354 to align # Constraint # added constraint: constraint((T0356)D403.CB, (T0356)E431.CB) [> 3.7637 = 6.2728 < 8.1546] w=0.4312 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)L344.CB) [> 4.4010 = 7.3349 < 9.5354] w=0.4297 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)D353.CB) [> 3.5289 = 5.8816 < 7.6460] w=0.4287 to align # Constraint # added constraint: constraint((T0356)L389.CB, (T0356)I481.CB) [> 2.4444 = 4.0739 < 5.2961] w=0.4270 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)C361.CB) [> 3.5477 = 5.9129 < 7.6867] w=0.4270 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)V430.CB) [> 3.8527 = 6.4212 < 8.3476] w=0.4261 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)C258.CB) [> 3.7952 = 6.3253 < 8.2229] w=0.4249 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)C258.CB) [> 3.3956 = 5.6593 < 7.3570] w=0.4249 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)K257.CB) [> 3.5349 = 5.8915 < 7.6590] w=0.4249 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)Y242.CB) [> 3.5083 = 5.8471 < 7.6013] w=0.4249 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)V398.CB) [> 4.3463 = 7.2438 < 9.4170] w=0.4228 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)T395.CB) [> 4.0665 = 6.7775 < 8.8107] w=0.4228 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)G323.CA) [> 3.5108 = 5.8513 < 7.6067] w=0.4193 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)L365.CB) [> 4.2392 = 7.0653 < 9.1849] w=0.4190 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)A366.CB) [> 2.9757 = 4.9595 < 6.4474] w=0.4190 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)Y363.CB) [> 3.4159 = 5.6932 < 7.4012] w=0.4190 to align # Constraint # added constraint: constraint((T0356)Y179.CB, (T0356)R192.CB) [> 3.6194 = 6.0324 < 7.8421] w=0.4189 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)T320.CB) [> 4.3582 = 7.2637 < 9.4428] w=0.4174 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)Y374.CB) [> 4.1411 = 6.9019 < 8.9724] w=0.4157 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)R364.CB) [> 4.4258 = 7.3763 < 9.5892] w=0.4152 to align # Constraint # added constraint: constraint((T0356)T427.CB, (T0356)Y437.CB) [> 4.0613 = 6.7689 < 8.7995] w=0.4127 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)Y317.CB) [> 3.1801 = 5.3001 < 6.8901] w=0.4126 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)I316.CB) [> 4.0967 = 6.8279 < 8.8763] w=0.4126 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)A315.CB) [> 4.3232 = 7.2052 < 9.3668] w=0.4126 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)I351.CB) [> 3.2547 = 5.4245 < 7.0519] w=0.4113 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)I316.CB) [> 3.5965 = 5.9942 < 7.7924] w=0.4095 to align # Constraint # added constraint: constraint((T0356)V413.CB, (T0356)V430.CB) [> 3.9281 = 6.5468 < 8.5109] w=0.4066 to align # Constraint # added constraint: constraint((T0356)A416.CB, (T0356)V428.CB) [> 4.5348 = 7.5581 < 9.8255] w=0.4066 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)V428.CB) [> 3.0714 = 5.1189 < 6.6546] w=0.4066 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)V367.CB) [> 3.6742 = 6.1238 < 7.9609] w=0.4059 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)A366.CB) [> 4.4193 = 7.3655 < 9.5751] w=0.4059 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)Y363.CB) [> 2.9512 = 4.9187 < 6.3942] w=0.4059 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)R364.CB) [> 4.1173 = 6.8622 < 8.9208] w=0.4023 to align # Constraint # added constraint: constraint((T0356)A231.CB, (T0356)F244.CB) [> 4.1308 = 6.8846 < 8.9500] w=0.3989 to align # Constraint # added constraint: constraint((T0356)A231.CB, (T0356)Y242.CB) [> 4.1925 = 6.9875 < 9.0837] w=0.3989 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)A416.CB) [> 3.0736 = 5.1226 < 6.6594] w=0.3977 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)D412.CB) [> 3.1209 = 5.2016 < 6.7620] w=0.3977 to align # Constraint # added constraint: constraint((T0356)D404.CB, (T0356)T433.CB) [> 4.3208 = 7.2014 < 9.3618] w=0.3970 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)V219.CB) [> 3.1230 = 5.2050 < 6.7665] w=0.3960 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)V219.CB) [> 4.6529 = 7.7549 < 10.0814] w=0.3960 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)Y321.CB) [> 4.0025 = 6.6708 < 8.6720] w=0.3917 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)L365.CB) [> 4.0585 = 6.7642 < 8.7935] w=0.3899 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)T322.CB) [> 4.6698 = 7.7829 < 10.1178] w=0.3866 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)V256.CB) [> 4.3885 = 7.3141 < 9.5083] w=0.3865 to align # Constraint # added constraint: constraint((T0356)F215.CB, (T0356)K252.CB) [> 4.3748 = 7.2914 < 9.4788] w=0.3865 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)L229.CB) [> 4.0127 = 6.6877 < 8.6941] w=0.3859 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)I351.CB) [> 4.4018 = 7.3362 < 9.5371] w=0.3834 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)V255.CB) [> 3.2463 = 5.4106 < 7.0337] w=0.3818 to align # Constraint # added constraint: constraint((T0356)P349.CB, (T0356)H377.CB) [> 3.7482 = 6.2470 < 8.1212] w=0.3808 to align # Constraint # added constraint: constraint((T0356)R180.CB, (T0356)I190.CB) [> 4.0920 = 6.8200 < 8.8660] w=0.3805 to align # Constraint # added constraint: constraint((T0356)R180.CB, (T0356)L189.CB) [> 3.4523 = 5.7538 < 7.4799] w=0.3805 to align # Constraint # added constraint: constraint((T0356)G177.CA, (T0356)W193.CB) [> 3.8702 = 6.4503 < 8.3854] w=0.3805 to align # Constraint # added constraint: constraint((T0356)L176.CB, (T0356)W193.CB) [> 3.9589 = 6.5981 < 8.5776] w=0.3805 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)S449.CB) [> 3.1655 = 5.2758 < 6.8586] w=0.3800 to align # Constraint # added constraint: constraint((T0356)Y363.CB, (T0356)H377.CB) [> 4.2730 = 7.1217 < 9.2582] w=0.3731 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)L248.CB) [> 3.6155 = 6.0259 < 7.8336] w=0.3714 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)G448.CA) [> 4.2512 = 7.0853 < 9.2108] w=0.3711 to align # Constraint # added constraint: constraint((T0356)K379.CB, (T0356)A416.CB) [> 4.3752 = 7.2921 < 9.4797] w=0.3711 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)A416.CB) [> 3.1759 = 5.2932 < 6.8811] w=0.3711 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)W415.CB) [> 4.1210 = 6.8683 < 8.9288] w=0.3711 to align # Constraint # added constraint: constraint((T0356)A375.CB, (T0356)D412.CB) [> 3.7297 = 6.2162 < 8.0811] w=0.3711 to align # Constraint # added constraint: constraint((T0356)L33.CB, (T0356)E87.CB) [> 4.3516 = 7.2527 < 9.4285] w=0.3711 to align # Constraint # added constraint: constraint((T0356)A74.CB, (T0356)L85.CB) [> 3.4523 = 5.7539 < 7.4801] w=0.3699 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)L85.CB) [> 3.5243 = 5.8738 < 7.6359] w=0.3699 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)A245.CB) [> 3.9214 = 6.5357 < 8.4965] w=0.3688 to align # Constraint # added constraint: constraint((T0356)L176.CB, (T0356)L194.CB) [> 3.8832 = 6.4719 < 8.4135] w=0.3678 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)V352.CB) [> 4.1846 = 6.9743 < 9.0666] w=0.3661 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)D353.CB) [> 4.3708 = 7.2846 < 9.4700] w=0.3661 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)Y355.CB) [> 4.5615 = 7.6025 < 9.8832] w=0.3661 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)P325.CB) [> 4.4556 = 7.4260 < 9.6538] w=0.3661 to align # Constraint # added constraint: constraint((T0356)Q181.CB, (T0356)I190.CB) [> 3.5320 = 5.8866 < 7.6526] w=0.3655 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)L248.CB) [> 3.8674 = 6.4457 < 8.3794] w=0.3647 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)G323.CA) [> 4.7095 = 7.8492 < 10.2040] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)K379.CB) [> 2.5515 = 4.2526 < 5.5283] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)M382.CB) [> 3.5252 = 5.8753 < 7.6379] w=0.3631 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)T322.CB) [> 4.3145 = 7.1908 < 9.3481] w=0.3631 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)T320.CB) [> 4.6930 = 7.8217 < 10.1682] w=0.3631 to align # Constraint # added constraint: constraint((T0356)H308.CB, (T0356)H318.CB) [> 2.4462 = 4.0770 < 5.3001] w=0.3631 to align # Constraint # added constraint: constraint((T0356)A315.CB, (T0356)K371.CB) [> 4.0574 = 6.7623 < 8.7910] w=0.3631 to align # Constraint # added constraint: constraint((T0356)A315.CB, (T0356)K372.CB) [> 3.3277 = 5.5462 < 7.2100] w=0.3631 to align # Constraint # added constraint: constraint((T0356)A315.CB, (T0356)Q373.CB) [> 3.8827 = 6.4712 < 8.4126] w=0.3631 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)K372.CB) [> 4.0041 = 6.6735 < 8.6756] w=0.3631 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)Y374.CB) [> 3.9904 = 6.6508 < 8.6460] w=0.3631 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)V367.CB) [> 4.4264 = 7.3774 < 9.5906] w=0.3631 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)M382.CB) [> 3.4452 = 5.7420 < 7.4646] w=0.3631 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)C361.CB) [> 3.7020 = 6.1700 < 8.0210] w=0.3631 to align # Constraint # added constraint: constraint((T0356)E297.CB, (T0356)P326.CB) [> 4.3005 = 7.1675 < 9.3177] w=0.3631 to align # Constraint # added constraint: constraint((T0356)D299.CB, (T0356)T322.CB) [> 4.1525 = 6.9208 < 8.9971] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F301.CB, (T0356)T322.CB) [> 3.1583 = 5.2638 < 6.8430] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F301.CB, (T0356)G323.CA) [> 3.3039 = 5.5066 < 7.1585] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F301.CB, (T0356)R324.CB) [> 3.3505 = 5.5841 < 7.2593] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F301.CB, (T0356)P325.CB) [> 2.4156 = 4.0260 < 5.2338] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F301.CB, (T0356)P326.CB) [> 4.2442 = 7.0736 < 9.1957] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F301.CB, (T0356)C361.CB) [> 4.3812 = 7.3021 < 9.4927] w=0.3631 to align # Constraint # added constraint: constraint((T0356)F301.CB, (T0356)E487.CB) [> 4.6762 = 7.7936 < 10.1317] w=0.3631 to align # Constraint # added constraint: constraint((T0356)P302.CB, (T0356)T322.CB) [> 3.7207 = 6.2011 < 8.0614] w=0.3631 to align # Constraint # added constraint: constraint((T0356)P302.CB, (T0356)G323.CA) [> 2.6126 = 4.3543 < 5.6606] w=0.3631 to align # Constraint # added constraint: constraint((T0356)P302.CB, (T0356)R324.CB) [> 4.5111 = 7.5185 < 9.7741] w=0.3631 to align # Constraint # added constraint: constraint((T0356)P302.CB, (T0356)I484.CB) [> 2.4810 = 4.1351 < 5.3756] w=0.3631 to align # Constraint # added constraint: constraint((T0356)V339.CB, (T0356)V477.CB) [> 3.7721 = 6.2868 < 8.1729] w=0.3631 to align # Constraint # added constraint: constraint((T0356)Q347.CB, (T0356)F388.CB) [> 4.7403 = 7.9005 < 10.2707] w=0.3631 to align # Constraint # added constraint: constraint((T0356)M383.CB, (T0356)W485.CB) [> 4.2329 = 7.0547 < 9.1712] w=0.3631 to align # Constraint # added constraint: constraint((T0356)W386.CB, (T0356)I481.CB) [> 2.6910 = 4.4850 < 5.8305] w=0.3631 to align # Constraint # added constraint: constraint((T0356)W386.CB, (T0356)I484.CB) [> 3.5029 = 5.8382 < 7.5897] w=0.3631 to align # Constraint # added constraint: constraint((T0356)L389.CB, (T0356)V478.CB) [> 3.8228 = 6.3713 < 8.2827] w=0.3631 to align # Constraint # added constraint: constraint((T0356)Q391.CB, (T0356)V478.CB) [> 4.6591 = 7.7651 < 10.0946] w=0.3631 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)H480.CB) [> 4.2819 = 7.1365 < 9.2775] w=0.3631 to align # Constraint # added constraint: constraint((T0356)R324.CB, (T0356)C361.CB) [> 2.5041 = 4.1734 < 5.4254] w=0.3631 to align # Constraint # added constraint: constraint((T0356)V331.CB, (T0356)K473.CB) [> 3.0744 = 5.1239 < 6.6611] w=0.3631 to align # Constraint # added constraint: constraint((T0356)L332.CB, (T0356)V477.CB) [> 3.0111 = 5.0184 < 6.5240] w=0.3631 to align # Constraint # added constraint: constraint((T0356)L332.CB, (T0356)H480.CB) [> 3.7317 = 6.2195 < 8.0854] w=0.3631 to align # Constraint # added constraint: constraint((T0356)L336.CB, (T0356)I481.CB) [> 4.5149 = 7.5248 < 9.7823] w=0.3631 to align # Constraint # added constraint: constraint((T0356)L336.CB, (T0356)H480.CB) [> 3.9417 = 6.5695 < 8.5403] w=0.3631 to align # Constraint # added constraint: constraint((T0356)A335.CB, (T0356)V477.CB) [> 2.3770 = 3.9617 < 5.1502] w=0.3631 to align # Constraint # added constraint: constraint((T0356)A335.CB, (T0356)D474.CB) [> 3.2955 = 5.4925 < 7.1402] w=0.3631 to align # Constraint # added constraint: constraint((T0356)A335.CB, (T0356)K473.CB) [> 3.1784 = 5.2974 < 6.8866] w=0.3631 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)E254.CB) [> 3.0324 = 5.0540 < 6.5702] w=0.3630 to align # Constraint # added constraint: constraint((T0356)F215.CB, (T0356)T251.CB) [> 2.9214 = 4.8690 < 6.3297] w=0.3630 to align # Constraint # added constraint: constraint((T0356)Y294.CB, (T0356)T320.CB) [> 4.5325 = 7.5542 < 9.8205] w=0.3604 to align # Constraint # added constraint: constraint((T0356)T233.CB, (T0356)F244.CB) [> 4.2680 = 7.1133 < 9.2473] w=0.3578 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)S319.CB) [> 4.1751 = 6.9584 < 9.0460] w=0.3563 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)H318.CB) [> 3.7610 = 6.2684 < 8.1489] w=0.3563 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)V428.CB) [> 3.8455 = 6.4092 < 8.3320] w=0.3555 to align # Constraint # added constraint: constraint((T0356)A74.CB, (T0356)A84.CB) [> 3.9801 = 6.6334 < 8.6234] w=0.3549 to align # Constraint # added constraint: constraint((T0356)V265.CB, (T0356)T310.CB) [> 3.6731 = 6.1218 < 7.9583] w=0.3547 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)T395.CB) [> 3.3986 = 5.6643 < 7.3636] w=0.3539 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)Y394.CB) [> 2.9228 = 4.8714 < 6.3328] w=0.3522 to align # Constraint # added constraint: constraint((T0356)W415.CB, (T0356)I481.CB) [> 3.3505 = 5.5843 < 7.2595] w=0.3513 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)Y363.CB) [> 4.7464 = 7.9107 < 10.2839] w=0.3513 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)C64.CB) [> 3.4995 = 5.8325 < 7.5822] w=0.3512 to align # Constraint # added constraint: constraint((T0356)I228.CB, (T0356)A243.CB) [> 4.3330 = 7.2217 < 9.3882] w=0.3509 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)L85.CB) [> 3.9728 = 6.6213 < 8.6077] w=0.3506 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)I417.CB) [> 3.2227 = 5.3712 < 6.9825] w=0.3500 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)T369.CB) [> 3.7555 = 6.2591 < 8.1368] w=0.3488 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)V368.CB) [> 3.6804 = 6.1340 < 7.9742] w=0.3488 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)T369.CB) [> 3.3895 = 5.6491 < 7.3438] w=0.3488 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)I370.CB) [> 4.3476 = 7.2460 < 9.4198] w=0.3488 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)V367.CB) [> 4.4558 = 7.4263 < 9.6542] w=0.3488 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)A366.CB) [> 3.7148 = 6.1913 < 8.0487] w=0.3488 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)V367.CB) [> 3.2044 = 5.3407 < 6.9429] w=0.3488 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)V368.CB) [> 4.0309 = 6.7182 < 8.7336] w=0.3488 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)L365.CB) [> 3.3343 = 5.5572 < 7.2244] w=0.3488 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)L365.CB) [> 2.6984 = 4.4973 < 5.8465] w=0.3488 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)V368.CB) [> 3.7772 = 6.2953 < 8.1839] w=0.3488 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)T369.CB) [> 2.1353 = 3.5589 < 4.6266] w=0.3488 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)V368.CB) [> 4.6245 = 7.7074 < 10.0196] w=0.3488 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)A366.CB) [> 3.1418 = 5.2362 < 6.8071] w=0.3488 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)F354.CB) [> 4.0860 = 6.8100 < 8.8530] w=0.3487 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)R425.CB) [> 3.9325 = 6.5542 < 8.5205] w=0.3487 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)E431.CB) [> 3.8665 = 6.4441 < 8.3773] w=0.3482 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)V352.CB) [> 4.4355 = 7.3924 < 9.6102] w=0.3473 to align # Constraint # added constraint: constraint((T0356)R167.CB, (T0356)D202.CB) [> 4.0010 = 6.6683 < 8.6688] w=0.3459 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)A220.CB) [> 3.7564 = 6.2606 < 8.1388] w=0.3459 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)V217.CB) [> 3.7126 = 6.1876 < 8.0439] w=0.3459 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)A220.CB) [> 4.2444 = 7.0740 < 9.1962] w=0.3459 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)S218.CB) [> 3.9543 = 6.5904 < 8.5675] w=0.3459 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)V217.CB) [> 3.5557 = 5.9262 < 7.7041] w=0.3459 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)V381.CB) [> 4.0781 = 6.7968 < 8.8358] w=0.3451 to align # Constraint # added constraint: constraint((T0356)P70.CB, (T0356)L85.CB) [> 3.9148 = 6.5247 < 8.4821] w=0.3432 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)V352.CB) [> 3.3794 = 5.6323 < 7.3220] w=0.3384 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)K257.CB) [> 3.3021 = 5.5034 < 7.1545] w=0.3365 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)V255.CB) [> 4.1200 = 6.8666 < 8.9266] w=0.3365 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)E254.CB) [> 4.1044 = 6.8407 < 8.8929] w=0.3365 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)K252.CB) [> 4.3480 = 7.2466 < 9.4206] w=0.3365 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)K252.CB) [> 2.6460 = 4.4100 < 5.7330] w=0.3365 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)A378.CB) [> 3.1714 = 5.2857 < 6.8714] w=0.3353 to align # Constraint # added constraint: constraint((T0356)L9.CB, (T0356)I38.CB) [> 2.5835 = 4.3059 < 5.5976] w=0.3352 to align # Constraint # added constraint: constraint((T0356)L9.CB, (T0356)R41.CB) [> 3.7396 = 6.2327 < 8.1025] w=0.3352 to align # Constraint # added constraint: constraint((T0356)L9.CB, (T0356)T42.CB) [> 3.1069 = 5.1782 < 6.7316] w=0.3352 to align # Constraint # added constraint: constraint((T0356)D454.CB, (T0356)G468.CA) [> 3.9578 = 6.5964 < 8.5753] w=0.3347 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)V428.CB) [> 3.9155 = 6.5259 < 8.4837] w=0.3307 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)D426.CB) [> 4.1356 = 6.8927 < 8.9605] w=0.3307 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)R420.CB) [> 4.1371 = 6.8951 < 8.9636] w=0.3303 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)E241.CB) [> 3.9229 = 6.5382 < 8.4997] w=0.3303 to align # Constraint # added constraint: constraint((T0356)T369.CB, (T0356)A378.CB) [> 4.2302 = 7.0503 < 9.1654] w=0.3298 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)I399.CB) [> 3.9329 = 6.5548 < 8.5213] w=0.3297 to align # Constraint # added constraint: constraint((T0356)N175.CB, (T0356)S195.CB) [> 3.9156 = 6.5260 < 8.4838] w=0.3294 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)P357.CB) [> 4.2372 = 7.0619 < 9.1805] w=0.3285 to align # Constraint # added constraint: constraint((T0356)T418.CB, (T0356)G448.CA) [> 3.7668 = 6.2780 < 8.1614] w=0.3259 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)L429.CB) [> 4.5754 = 7.6256 < 9.9133] w=0.3254 to align # Constraint # added constraint: constraint((T0356)F340.CB, (T0356)Y363.CB) [> 3.6792 = 6.1319 < 7.9715] w=0.3252 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)F354.CB) [> 3.7022 = 6.1703 < 8.0214] w=0.3233 to align # Constraint # added constraint: constraint((T0356)A315.CB, (T0356)V352.CB) [> 3.6433 = 6.0721 < 7.8938] w=0.3233 to align # Constraint # added constraint: constraint((T0356)L16.CB, (T0356)I38.CB) [> 4.0332 = 6.7219 < 8.7385] w=0.3233 to align # Constraint # added constraint: constraint((T0356)M451.CB, (T0356)W485.CB) [> 4.5162 = 7.5269 < 9.7850] w=0.3225 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)H377.CB) [> 3.2491 = 5.4152 < 7.0397] w=0.3217 to align # Constraint # added constraint: constraint((T0356)M120.CB, (T0356)S195.CB) [> 4.0401 = 6.7334 < 8.7535] w=0.3194 to align # Constraint # added constraint: constraint((T0356)M120.CB, (T0356)W193.CB) [> 3.6084 = 6.0139 < 7.8181] w=0.3194 to align # Constraint # added constraint: constraint((T0356)A245.CB, (T0356)V255.CB) [> 3.5512 = 5.9186 < 7.6942] w=0.3182 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)V256.CB) [> 4.2508 = 7.0846 < 9.2100] w=0.3182 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)V255.CB) [> 3.4635 = 5.7725 < 7.5042] w=0.3182 to align # Constraint # added constraint: constraint((T0356)F392.CB, (T0356)D426.CB) [> 2.9646 = 4.9411 < 6.4234] w=0.3181 to align # Constraint # added constraint: constraint((T0356)A455.CB, (T0356)I471.CB) [> 3.4437 = 5.7396 < 7.4614] w=0.3180 to align # Constraint # added constraint: constraint((T0356)P325.CB, (T0356)R364.CB) [> 3.4785 = 5.7975 < 7.5367] w=0.3163 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)L365.CB) [> 3.8857 = 6.4762 < 8.4190] w=0.3157 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)V413.CB) [> 3.7392 = 6.2319 < 8.1015] w=0.3154 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)I399.CB) [> 3.9974 = 6.6623 < 8.6610] w=0.3153 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)V398.CB) [> 3.8387 = 6.3978 < 8.3172] w=0.3153 to align # Constraint # added constraint: constraint((T0356)Y294.CB, (T0356)V303.CB) [> 3.8015 = 6.3359 < 8.2367] w=0.3135 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)F397.CB) [> 3.7863 = 6.3105 < 8.2036] w=0.3091 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)K371.CB) [> 3.8650 = 6.4417 < 8.3742] w=0.3079 to align # Constraint # added constraint: constraint((T0356)L429.CB, (T0356)S449.CB) [> 4.3358 = 7.2263 < 9.3942] w=0.3075 to align # Constraint # added constraint: constraint((T0356)K371.CB, (T0356)D402.CB) [> 3.3119 = 5.5199 < 7.1759] w=0.3064 to align # Constraint # added constraint: constraint((T0356)I370.CB, (T0356)C401.CB) [> 3.9767 = 6.6279 < 8.6163] w=0.3064 to align # Constraint # added constraint: constraint((T0356)T369.CB, (T0356)C401.CB) [> 3.5346 = 5.8909 < 7.6582] w=0.3064 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)V400.CB) [> 3.2424 = 5.4041 < 7.0253] w=0.3064 to align # Constraint # added constraint: constraint((T0356)I38.CB, (T0356)L92.CB) [> 4.1990 = 6.9984 < 9.0979] w=0.3064 to align # Constraint # added constraint: constraint((T0356)E34.CB, (T0356)V88.CB) [> 2.7788 = 4.6313 < 6.0207] w=0.3064 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)S319.CB) [> 3.0859 = 5.1431 < 6.6861] w=0.3063 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)H318.CB) [> 4.6668 = 7.7781 < 10.1115] w=0.3063 to align # Constraint # added constraint: constraint((T0356)D403.CB, (T0356)V430.CB) [> 4.4025 = 7.3375 < 9.5387] w=0.3051 to align # Constraint # added constraint: constraint((T0356)V428.CB, (T0356)K450.CB) [> 3.4912 = 5.8187 < 7.5643] w=0.3042 to align # Constraint # added constraint: constraint((T0356)L344.CB, (T0356)L365.CB) [> 3.8705 = 6.4509 < 8.3862] w=0.3007 to align # Constraint # added constraint: constraint((T0356)T418.CB, (T0356)L447.CB) [> 3.9530 = 6.5883 < 8.5649] w=0.3006 to align # Constraint # added constraint: constraint((T0356)A200.CB, (T0356)A243.CB) [> 3.2892 = 5.4820 < 7.1266] w=0.3001 to align # Constraint # added constraint: constraint((T0356)N54.CB, (T0356)N65.CB) [> 3.7919 = 6.3199 < 8.2158] w=0.3001 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)N65.CB) [> 2.9734 = 4.9556 < 6.4423] w=0.3001 to align # Constraint # added constraint: constraint((T0356)L43.CB, (T0356)M60.CB) [> 4.1161 = 6.8603 < 8.9183] w=0.3001 to align # Constraint # added constraint: constraint((T0356)A39.CB, (T0356)M60.CB) [> 3.7168 = 6.1946 < 8.0530] w=0.3001 to align # Constraint # added constraint: constraint((T0356)N296.CB, (T0356)D327.CB) [> 4.1049 = 6.8415 < 8.8939] w=0.2973 to align # Constraint # added constraint: constraint((T0356)N296.CB, (T0356)P326.CB) [> 2.2700 = 3.7834 < 4.9184] w=0.2973 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)W193.CB) [> 3.9059 = 6.5098 < 8.4627] w=0.2973 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)R192.CB) [> 3.6942 = 6.1570 < 8.0042] w=0.2973 to align # Constraint # added constraint: constraint((T0356)L176.CB, (T0356)S195.CB) [> 2.7568 = 4.5946 < 5.9730] w=0.2973 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)R364.CB) [> 4.0110 = 6.6849 < 8.6904] w=0.2967 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)R364.CB) [> 3.9689 = 6.6149 < 8.5994] w=0.2967 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)S362.CB) [> 3.3011 = 5.5019 < 7.1525] w=0.2967 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)S362.CB) [> 2.4678 = 4.1130 < 5.3469] w=0.2967 to align # Constraint # added constraint: constraint((T0356)F215.CB, (T0356)A315.CB) [> 4.1439 = 6.9065 < 8.9784] w=0.2955 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)M382.CB) [> 4.2219 = 7.0364 < 9.1474] w=0.2949 to align # Constraint # added constraint: constraint((T0356)L344.CB, (T0356)F388.CB) [> 4.2823 = 7.1372 < 9.2783] w=0.2949 to align # Constraint # added constraint: constraint((T0356)L16.CB, (T0356)V73.CB) [> 4.5866 = 7.6444 < 9.9377] w=0.2943 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)T433.CB) [> 3.3859 = 5.6432 < 7.3361] w=0.2943 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)N432.CB) [> 4.4067 = 7.3445 < 9.5478] w=0.2943 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)A366.CB) [> 3.9160 = 6.5266 < 8.4846] w=0.2936 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)C258.CB) [> 3.5759 = 5.9599 < 7.7478] w=0.2933 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)S268.CB) [> 4.6624 = 7.7706 < 10.1018] w=0.2933 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)A267.CB) [> 3.7643 = 6.2738 < 8.1560] w=0.2933 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)G323.CA) [> 4.0608 = 6.7680 < 8.7984] w=0.2932 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)A378.CB) [> 4.2541 = 7.0902 < 9.2173] w=0.2931 to align # Constraint # added constraint: constraint((T0356)F215.CB, (T0356)E254.CB) [> 3.2257 = 5.3762 < 6.9891] w=0.2916 to align # Constraint # added constraint: constraint((T0356)F108.CB, (T0356)R124.CB) [> 4.5022 = 7.5036 < 9.7547] w=0.2909 to align # Constraint # added constraint: constraint((T0356)N432.CB, (T0356)S445.CB) [> 4.0257 = 6.7096 < 8.7224] w=0.2892 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)D353.CB) [> 4.0859 = 6.8098 < 8.8528] w=0.2876 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)V368.CB) [> 3.4039 = 5.6731 < 7.3751] w=0.2849 to align # Constraint # added constraint: constraint((T0356)P349.CB, (T0356)I370.CB) [> 3.4815 = 5.8025 < 7.5433] w=0.2849 to align # Constraint # added constraint: constraint((T0356)Q181.CB, (T0356)M191.CB) [> 3.4064 = 5.6773 < 7.3804] w=0.2823 to align # Constraint # added constraint: constraint((T0356)Q181.CB, (T0356)R192.CB) [> 3.6388 = 6.0647 < 7.8841] w=0.2823 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)L176.CB) [> 4.5564 = 7.5940 < 9.8722] w=0.2814 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)N175.CB) [> 3.0567 = 5.0944 < 6.6228] w=0.2814 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)L176.CB) [> 3.1809 = 5.3015 < 6.8919] w=0.2814 to align # Constraint # added constraint: constraint((T0356)A74.CB, (T0356)R86.CB) [> 3.5396 = 5.8994 < 7.6692] w=0.2806 to align # Constraint # added constraint: constraint((T0356)L229.CB, (T0356)F244.CB) [> 3.6432 = 6.0720 < 7.8936] w=0.2803 to align # Constraint # added constraint: constraint((T0356)L229.CB, (T0356)A243.CB) [> 3.5844 = 5.9739 < 7.7661] w=0.2803 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)G230.CA) [> 4.4402 = 7.4003 < 9.6204] w=0.2803 to align # Constraint # added constraint: constraint((T0356)C207.CB, (T0356)F244.CB) [> 3.6064 = 6.0107 < 7.8139] w=0.2803 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)V352.CB) [> 3.1554 = 5.2590 < 6.8367] w=0.2777 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)I351.CB) [> 3.1525 = 5.2542 < 6.8305] w=0.2777 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)I351.CB) [> 3.9160 = 6.5266 < 8.4846] w=0.2777 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)Y355.CB) [> 3.9916 = 6.6526 < 8.6484] w=0.2777 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)R324.CB) [> 3.6242 = 6.0403 < 7.8525] w=0.2777 to align # Constraint # added constraint: constraint((T0356)W410.CB, (T0356)L429.CB) [> 3.7440 = 6.2400 < 8.1120] w=0.2777 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)Y317.CB) [> 3.9867 = 6.6444 < 8.6377] w=0.2765 to align # Constraint # added constraint: constraint((T0356)N261.CB, (T0356)Y276.CB) [> 3.8106 = 6.3509 < 8.2562] w=0.2753 to align # Constraint # added constraint: constraint((T0356)I228.CB, (T0356)A245.CB) [> 4.0585 = 6.7642 < 8.7934] w=0.2753 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)T419.CB) [> 3.0909 = 5.1515 < 6.6970] w=0.2747 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)K371.CB) [> 4.6777 = 7.7962 < 10.1350] w=0.2729 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)V398.CB) [> 3.6790 = 6.1316 < 7.9711] w=0.2708 to align # Constraint # added constraint: constraint((T0356)A231.CB, (T0356)E241.CB) [> 2.7418 = 4.5697 < 5.9406] w=0.2695 to align # Constraint # added constraint: constraint((T0356)G230.CA, (T0356)E241.CB) [> 4.0258 = 6.7096 < 8.7225] w=0.2695 to align # Constraint # added constraint: constraint((T0356)G448.CA, (T0356)I490.CB) [> 3.6350 = 6.0583 < 7.8757] w=0.2694 to align # Constraint # added constraint: constraint((T0356)F392.CB, (T0356)L447.CB) [> 3.1062 = 5.1770 < 6.7301] w=0.2687 to align # Constraint # added constraint: constraint((T0356)K71.CB, (T0356)F104.CB) [> 4.1586 = 6.9311 < 9.0104] w=0.2684 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)K257.CB) [> 3.2793 = 5.4655 < 7.1052] w=0.2681 to align # Constraint # added constraint: constraint((T0356)V428.CB, (T0356)G448.CA) [> 3.9911 = 6.6518 < 8.6474] w=0.2672 to align # Constraint # added constraint: constraint((T0356)A200.CB, (T0356)L247.CB) [> 2.8169 = 4.6948 < 6.1032] w=0.2660 to align # Constraint # added constraint: constraint((T0356)T456.CB, (T0356)I471.CB) [> 3.4822 = 5.8037 < 7.5448] w=0.2660 to align # Constraint # added constraint: constraint((T0356)D224.CB, (T0356)G360.CA) [> 3.1941 = 5.3234 < 6.9205] w=0.2655 to align # Constraint # added constraint: constraint((T0356)D224.CB, (T0356)E359.CB) [> 3.4193 = 5.6989 < 7.4086] w=0.2655 to align # Constraint # added constraint: constraint((T0356)D224.CB, (T0356)P358.CB) [> 3.0945 = 5.1575 < 6.7047] w=0.2655 to align # Constraint # added constraint: constraint((T0356)D224.CB, (T0356)P357.CB) [> 3.8126 = 6.3544 < 8.2607] w=0.2655 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)I259.CB) [> 3.7319 = 6.2199 < 8.0858] w=0.2655 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)Y242.CB) [> 3.8433 = 6.4056 < 8.3272] w=0.2655 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)L356.CB) [> 3.7265 = 6.2108 < 8.0741] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)L356.CB) [> 4.4824 = 7.4707 < 9.7119] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)F354.CB) [> 3.9466 = 6.5777 < 8.5510] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)D353.CB) [> 3.9950 = 6.6583 < 8.6558] w=0.2655 to align # Constraint # added constraint: constraint((T0356)F215.CB, (T0356)V352.CB) [> 3.9207 = 6.5346 < 8.4950] w=0.2655 to align # Constraint # added constraint: constraint((T0356)D40.CB, (T0356)W206.CB) [> 3.4614 = 5.7691 < 7.4998] w=0.2655 to align # Constraint # added constraint: constraint((T0356)E37.CB, (T0356)Y203.CB) [> 2.8643 = 4.7738 < 6.2059] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V428.CB, (T0356)L438.CB) [> 3.6146 = 6.0244 < 7.8317] w=0.2655 to align # Constraint # added constraint: constraint((T0356)T427.CB, (T0356)L438.CB) [> 4.5473 = 7.5788 < 9.8524] w=0.2655 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)L438.CB) [> 3.3575 = 5.5958 < 7.2746] w=0.2655 to align # Constraint # added constraint: constraint((T0356)A416.CB, (T0356)R425.CB) [> 3.9454 = 6.5757 < 8.5484] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V413.CB, (T0356)D436.CB) [> 4.1467 = 6.9112 < 8.9846] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V413.CB, (T0356)L429.CB) [> 4.1650 = 6.9416 < 9.0241] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)T427.CB) [> 2.8749 = 4.7914 < 6.2288] w=0.2655 to align # Constraint # added constraint: constraint((T0356)V381.CB, (T0356)I435.CB) [> 2.8906 = 4.8177 < 6.2630] w=0.2655 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)V430.CB) [> 4.6323 = 7.7205 < 10.0366] w=0.2655 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)L429.CB) [> 3.7661 = 6.2769 < 8.1599] w=0.2655 to align # Constraint # added constraint: constraint((T0356)E87.CB, (T0356)A335.CB) [> 3.9445 = 6.5742 < 8.5465] w=0.2651 to align # Constraint # added constraint: constraint((T0356)L176.CB, (T0356)H196.CB) [> 3.9646 = 6.6076 < 8.5899] w=0.2642 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)Q174.CB) [> 3.5411 = 5.9018 < 7.6723] w=0.2634 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)M421.CB) [> 4.3403 = 7.2338 < 9.4040] w=0.2628 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)L63.CB) [> 4.3223 = 7.2038 < 9.3649] w=0.2627 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)L63.CB) [> 3.0452 = 5.0753 < 6.5979] w=0.2627 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)L63.CB) [> 4.4224 = 7.3706 < 9.5818] w=0.2627 to align # Constraint # added constraint: constraint((T0356)S362.CB, (T0356)H377.CB) [> 3.6311 = 6.0518 < 7.8674] w=0.2627 to align # Constraint # added constraint: constraint((T0356)S362.CB, (T0356)A378.CB) [> 3.6469 = 6.0782 < 7.9017] w=0.2627 to align # Constraint # added constraint: constraint((T0356)I228.CB, (T0356)Y242.CB) [> 3.5106 = 5.8509 < 7.6062] w=0.2624 to align # Constraint # added constraint: constraint((T0356)T122.CB, (T0356)V219.CB) [> 4.7111 = 7.8518 < 10.2074] w=0.2624 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)R364.CB) [> 4.0636 = 6.7727 < 8.8046] w=0.2623 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)F244.CB) [> 4.7413 = 7.9021 < 10.2728] w=0.2617 to align # Constraint # added constraint: constraint((T0356)E328.CB, (T0356)L356.CB) [> 3.5231 = 5.8718 < 7.6334] w=0.2602 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)K372.CB) [> 4.6518 = 7.7530 < 10.0789] w=0.2602 to align # Constraint # added constraint: constraint((T0356)D402.CB, (T0356)V430.CB) [> 3.3073 = 5.5122 < 7.1659] w=0.2602 to align # Constraint # added constraint: constraint((T0356)D402.CB, (T0356)N432.CB) [> 4.7832 = 7.9720 < 10.3636] w=0.2597 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)F397.CB) [> 4.1507 = 6.9178 < 8.9931] w=0.2597 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)F397.CB) [> 3.7862 = 6.3103 < 8.2034] w=0.2597 to align # Constraint # added constraint: constraint((T0356)N187.CB, (T0356)V306.CB) [> 2.6593 = 4.4321 < 5.7618] w=0.2591 to align # Constraint # added constraint: constraint((T0356)L189.CB, (T0356)L273.CB) [> 3.6867 = 6.1444 < 7.9877] w=0.2591 to align # Constraint # added constraint: constraint((T0356)L189.CB, (T0356)V306.CB) [> 3.5818 = 5.9696 < 7.7605] w=0.2591 to align # Constraint # added constraint: constraint((T0356)I190.CB, (T0356)V303.CB) [> 3.8756 = 6.4594 < 8.3972] w=0.2591 to align # Constraint # added constraint: constraint((T0356)I190.CB, (T0356)F304.CB) [> 4.5225 = 7.5376 < 9.7989] w=0.2591 to align # Constraint # added constraint: constraint((T0356)L273.CB, (T0356)V306.CB) [> 3.3493 = 5.5822 < 7.2568] w=0.2591 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)P326.CB) [> 4.1666 = 6.9443 < 9.0276] w=0.2579 to align # Constraint # added constraint: constraint((T0356)M421.CB, (T0356)D474.CB) [> 3.6246 = 6.0410 < 7.8533] w=0.2576 to align # Constraint # added constraint: constraint((T0356)W206.CB, (T0356)F244.CB) [> 3.4084 = 5.6807 < 7.3849] w=0.2565 to align # Constraint # added constraint: constraint((T0356)Y179.CB, (T0356)W193.CB) [> 3.9651 = 6.6085 < 8.5910] w=0.2558 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)V219.CB) [> 3.6896 = 6.1493 < 7.9941] w=0.2548 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)A220.CB) [> 3.6357 = 6.0595 < 7.8773] w=0.2548 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)A220.CB) [> 2.6570 = 4.4284 < 5.7569] w=0.2548 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)G222.CA) [> 4.0704 = 6.7840 < 8.8192] w=0.2548 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)L176.CB) [> 4.0882 = 6.8137 < 8.8578] w=0.2548 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)G199.CA) [> 4.1446 = 6.9078 < 8.9801] w=0.2548 to align # Constraint # added constraint: constraint((T0356)N175.CB, (T0356)S240.CB) [> 3.8655 = 6.4424 < 8.3752] w=0.2548 to align # Constraint # added constraint: constraint((T0356)L176.CB, (T0356)S240.CB) [> 3.8438 = 6.4064 < 8.3283] w=0.2548 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)G275.CA) [> 3.6704 = 6.1173 < 7.9524] w=0.2548 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)G275.CA) [> 4.5246 = 7.5410 < 9.8033] w=0.2548 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)F304.CB) [> 4.1625 = 6.9375 < 9.0187] w=0.2545 to align # Constraint # added constraint: constraint((T0356)L194.CB, (T0356)P302.CB) [> 4.1444 = 6.9073 < 8.9795] w=0.2545 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)Y321.CB) [> 2.9991 = 4.9984 < 6.4980] w=0.2531 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)I316.CB) [> 3.9024 = 6.5040 < 8.4552] w=0.2524 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)H318.CB) [> 3.5491 = 5.9152 < 7.6897] w=0.2524 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)Y317.CB) [> 3.0039 = 5.0065 < 6.5084] w=0.2524 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)I316.CB) [> 4.4130 = 7.3550 < 9.5615] w=0.2524 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)H318.CB) [> 2.9654 = 4.9424 < 6.4251] w=0.2524 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)H318.CB) [> 4.1857 = 6.9762 < 9.0690] w=0.2524 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)V398.CB) [> 4.3825 = 7.3042 < 9.4954] w=0.2522 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)A378.CB) [> 4.6014 = 7.6690 < 9.9697] w=0.2509 to align # Constraint # added constraint: constraint((T0356)H291.CB, (T0356)T307.CB) [> 4.4459 = 7.4098 < 9.6327] w=0.2509 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)L429.CB) [> 4.1525 = 6.9208 < 8.9970] w=0.2496 to align # Constraint # added constraint: constraint((T0356)R380.CB, (T0356)D409.CB) [> 3.9100 = 6.5166 < 8.4715] w=0.2496 to align # Constraint # added constraint: constraint((T0356)R380.CB, (T0356)V405.CB) [> 4.3495 = 7.2491 < 9.4239] w=0.2496 to align # Constraint # added constraint: constraint((T0356)K379.CB, (T0356)D404.CB) [> 3.3757 = 5.6261 < 7.3139] w=0.2496 to align # Constraint # added constraint: constraint((T0356)E328.CB, (T0356)P357.CB) [> 3.1461 = 5.2435 < 6.8165] w=0.2494 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)F354.CB) [> 4.0624 = 6.7706 < 8.8018] w=0.2480 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)I259.CB) [> 3.7778 = 6.2964 < 8.1853] w=0.2480 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)G246.CA) [> 3.9418 = 6.5696 < 8.5405] w=0.2480 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)I399.CB) [> 3.7116 = 6.1860 < 8.0419] w=0.2478 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)C401.CB) [> 4.1368 = 6.8946 < 8.9630] w=0.2478 to align # Constraint # added constraint: constraint((T0356)I370.CB, (T0356)D402.CB) [> 3.6429 = 6.0715 < 7.8929] w=0.2478 to align # Constraint # added constraint: constraint((T0356)A39.CB, (T0356)L50.CB) [> 3.7837 = 6.3062 < 8.1980] w=0.2475 to align # Constraint # added constraint: constraint((T0356)M451.CB, (T0356)I490.CB) [> 4.2511 = 7.0852 < 9.2107] w=0.2474 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)W410.CB) [> 3.1565 = 5.2608 < 6.8390] w=0.2449 to align # Constraint # added constraint: constraint((T0356)Y363.CB, (T0356)A378.CB) [> 3.2796 = 5.4659 < 7.1057] w=0.2425 to align # Constraint # added constraint: constraint((T0356)F215.CB, (T0356)Y317.CB) [> 3.6212 = 6.0353 < 7.8459] w=0.2423 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)I316.CB) [> 2.8255 = 4.7091 < 6.1218] w=0.2423 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)Y317.CB) [> 4.5622 = 7.6036 < 9.8847] w=0.2423 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)H318.CB) [> 4.5358 = 7.5597 < 9.8276] w=0.2423 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)S319.CB) [> 3.2080 = 5.3466 < 6.9506] w=0.2423 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)H318.CB) [> 3.3310 = 5.5517 < 7.2172] w=0.2423 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)S319.CB) [> 4.2294 = 7.0490 < 9.1637] w=0.2423 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)I417.CB) [> 3.8590 = 6.4316 < 8.3611] w=0.2423 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)V62.CB) [> 4.1396 = 6.8993 < 8.9691] w=0.2422 to align # Constraint # added constraint: constraint((T0356)L332.CB, (T0356)D474.CB) [> 2.7336 = 4.5560 < 5.9228] w=0.2421 to align # Constraint # added constraint: constraint((T0356)V331.CB, (T0356)D474.CB) [> 2.3997 = 3.9996 < 5.1995] w=0.2421 to align # Constraint # added constraint: constraint((T0356)V331.CB, (T0356)K472.CB) [> 2.8984 = 4.8307 < 6.2799] w=0.2421 to align # Constraint # added constraint: constraint((T0356)P329.CB, (T0356)D474.CB) [> 3.8122 = 6.3536 < 8.2597] w=0.2421 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)S362.CB) [> 3.5815 = 5.9693 < 7.7600] w=0.2421 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)A366.CB) [> 4.5862 = 7.6437 < 9.9368] w=0.2421 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)L365.CB) [> 2.8544 = 4.7574 < 6.1846] w=0.2421 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)A366.CB) [> 3.1422 = 5.2370 < 6.8081] w=0.2421 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)L365.CB) [> 4.4246 = 7.3743 < 9.5866] w=0.2421 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)R364.CB) [> 3.8927 = 6.4879 < 8.4342] w=0.2421 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)V367.CB) [> 2.9587 = 4.9312 < 6.4106] w=0.2421 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)A366.CB) [> 4.3330 = 7.2217 < 9.3882] w=0.2421 to align # Constraint # added constraint: constraint((T0356)I316.CB, (T0356)V367.CB) [> 4.3119 = 7.1865 < 9.3425] w=0.2421 to align # Constraint # added constraint: constraint((T0356)F392.CB, (T0356)V430.CB) [> 4.7113 = 7.8522 < 10.2079] w=0.2421 to align # Constraint # added constraint: constraint((T0356)F392.CB, (T0356)D403.CB) [> 3.3920 = 5.6534 < 7.3494] w=0.2421 to align # Constraint # added constraint: constraint((T0356)E338.CB, (T0356)T433.CB) [> 4.1437 = 6.9061 < 8.9780] w=0.2421 to align # Constraint # added constraint: constraint((T0356)V334.CB, (T0356)D474.CB) [> 4.7221 = 7.8702 < 10.2313] w=0.2421 to align # Constraint # added constraint: constraint((T0356)G333.CA, (T0356)D474.CB) [> 4.7224 = 7.8706 < 10.2318] w=0.2421 to align # Constraint # added constraint: constraint((T0356)E34.CB, (T0356)E87.CB) [> 2.5979 = 4.3298 < 5.6288] w=0.2417 to align # Constraint # added constraint: constraint((T0356)E34.CB, (T0356)L91.CB) [> 4.1623 = 6.9372 < 9.0184] w=0.2417 to align # Constraint # added constraint: constraint((T0356)G293.CA, (T0356)P358.CB) [> 3.3960 = 5.6599 < 7.3579] w=0.2415 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)I259.CB) [> 3.9589 = 6.5982 < 8.5777] w=0.2415 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)K257.CB) [> 4.2218 = 7.0363 < 9.1472] w=0.2415 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)K115.CB) [> 3.7864 = 6.3106 < 8.2038] w=0.2415 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)L111.CB) [> 3.9820 = 6.6366 < 8.6276] w=0.2415 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)L92.CB) [> 3.9105 = 6.5174 < 8.4727] w=0.2409 to align # Constraint # added constraint: constraint((T0356)G68.CA, (T0356)E80.CB) [> 4.4412 = 7.4020 < 9.6226] w=0.2409 to align # Constraint # added constraint: constraint((T0356)K379.CB, (T0356)W415.CB) [> 3.7612 = 6.2686 < 8.1492] w=0.2382 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)F354.CB) [> 4.6883 = 7.8137 < 10.1579] w=0.2362 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)G452.CA) [> 3.5428 = 5.9047 < 7.6761] w=0.2361 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)G452.CA) [> 3.5067 = 5.8444 < 7.5978] w=0.2361 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)L453.CB) [> 3.5659 = 5.9431 < 7.7260] w=0.2361 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)L453.CB) [> 3.9778 = 6.6297 < 8.6186] w=0.2361 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)D454.CB) [> 3.5030 = 5.8384 < 7.5899] w=0.2361 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)D454.CB) [> 4.0090 = 6.6817 < 8.6862] w=0.2361 to align # Constraint # added constraint: constraint((T0356)V428.CB, (T0356)Y437.CB) [> 4.1051 = 6.8418 < 8.8944] w=0.2357 to align # Constraint # added constraint: constraint((T0356)A39.CB, (T0356)K96.CB) [> 4.0538 = 6.7563 < 8.7832] w=0.2356 to align # Constraint # added constraint: constraint((T0356)L13.CB, (T0356)R24.CB) [> 3.8992 = 6.4987 < 8.4482] w=0.2337 to align # Constraint # added constraint: constraint((T0356)L13.CB, (T0356)L22.CB) [> 3.5451 = 5.9085 < 7.6811] w=0.2337 to align # Constraint # added constraint: constraint((T0356)L91.CB, (T0356)F114.CB) [> 4.3977 = 7.3295 < 9.5283] w=0.2336 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)I417.CB) [> 4.0108 = 6.6846 < 8.6900] w=0.2331 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)E281.CB) [> 3.4217 = 5.7028 < 7.4136] w=0.2323 to align # Constraint # added constraint: constraint((T0356)T418.CB, (T0356)S442.CB) [> 3.1354 = 5.2257 < 6.7934] w=0.2316 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)S442.CB) [> 3.6105 = 6.0176 < 7.8229] w=0.2316 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)N175.CB) [> 4.1047 = 6.8411 < 8.8934] w=0.2313 to align # Constraint # added constraint: constraint((T0356)I38.CB, (T0356)L51.CB) [> 4.6790 = 7.7983 < 10.1378] w=0.2296 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)T164.CB) [> 4.1110 = 6.8517 < 8.9072] w=0.2296 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)T164.CB) [> 4.4492 = 7.4153 < 9.6399] w=0.2296 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)A223.CB) [> 3.0117 = 5.0195 < 6.5254] w=0.2296 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)R364.CB) [> 3.5075 = 5.8459 < 7.5997] w=0.2278 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)M382.CB) [> 3.2671 = 5.4452 < 7.0787] w=0.2278 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)V381.CB) [> 4.7548 = 7.9246 < 10.3020] w=0.2278 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)A378.CB) [> 3.6321 = 6.0534 < 7.8694] w=0.2278 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)V368.CB) [> 2.9723 = 4.9539 < 6.4400] w=0.2278 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)A366.CB) [> 4.5301 = 7.5501 < 9.8152] w=0.2278 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)A378.CB) [> 2.5963 = 4.3271 < 5.6252] w=0.2278 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)H377.CB) [> 4.5628 = 7.6046 < 9.8860] w=0.2278 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)Y374.CB) [> 3.2103 = 5.3504 < 6.9556] w=0.2278 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)A378.CB) [> 4.2515 = 7.0858 < 9.2116] w=0.2278 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)M382.CB) [> 4.7379 = 7.8965 < 10.2655] w=0.2278 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)H377.CB) [> 4.5965 = 7.6608 < 9.9590] w=0.2278 to align # Constraint # added constraint: constraint((T0356)P326.CB, (T0356)G360.CA) [> 4.1546 = 6.9244 < 9.0017] w=0.2278 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)A366.CB) [> 3.3533 = 5.5889 < 7.2656] w=0.2278 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)A245.CB) [> 3.7932 = 6.3220 < 8.2186] w=0.2270 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)V256.CB) [> 4.1937 = 6.9894 < 9.0863] w=0.2270 to align # Constraint # added constraint: constraint((T0356)E431.CB, (T0356)P443.CB) [> 3.0293 = 5.0489 < 6.5635] w=0.2261 to align # Constraint # added constraint: constraint((T0356)E431.CB, (T0356)S442.CB) [> 3.2516 = 5.4193 < 7.0451] w=0.2261 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)G127.CA) [> 3.9125 = 6.5208 < 8.4771] w=0.2230 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)G127.CA) [> 4.4639 = 7.4398 < 9.6717] w=0.2230 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)R126.CB) [> 4.3643 = 7.2739 < 9.4560] w=0.2230 to align # Constraint # added constraint: constraint((T0356)G177.CA, (T0356)L194.CB) [> 3.5561 = 5.9268 < 7.7049] w=0.2229 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)G177.CA) [> 4.5272 = 7.5454 < 9.8090] w=0.2225 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)G177.CA) [> 3.7006 = 6.1676 < 8.0178] w=0.2225 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)I178.CB) [> 3.3166 = 5.5277 < 7.1860] w=0.2225 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)I178.CB) [> 3.5507 = 5.9179 < 7.6932] w=0.2225 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)T418.CB) [> 4.6007 = 7.6678 < 9.9681] w=0.2208 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)T418.CB) [> 3.2651 = 5.4418 < 7.0744] w=0.2208 to align # Constraint # added constraint: constraint((T0356)D404.CB, (T0356)I417.CB) [> 4.4370 = 7.3950 < 9.6135] w=0.2208 to align # Constraint # added constraint: constraint((T0356)D404.CB, (T0356)T418.CB) [> 2.3092 = 3.8486 < 5.0032] w=0.2208 to align # Constraint # added constraint: constraint((T0356)D404.CB, (T0356)T419.CB) [> 3.3461 = 5.5769 < 7.2500] w=0.2208 to align # Constraint # added constraint: constraint((T0356)D404.CB, (T0356)D422.CB) [> 4.6518 = 7.7530 < 10.0789] w=0.2208 to align # Constraint # added constraint: constraint((T0356)T418.CB, (T0356)V428.CB) [> 4.0178 = 6.6964 < 8.7053] w=0.2208 to align # Constraint # added constraint: constraint((T0356)I471.CB, (T0356)I481.CB) [> 4.0805 = 6.8008 < 8.8410] w=0.2208 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)Y317.CB) [> 3.1135 = 5.1891 < 6.7459] w=0.2203 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)Y317.CB) [> 3.8848 = 6.4747 < 8.4171] w=0.2203 to align # Constraint # added constraint: constraint((T0356)D454.CB, (T0356)W467.CB) [> 3.1407 = 5.2344 < 6.8048] w=0.2195 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)V368.CB) [> 3.8681 = 6.4468 < 8.3808] w=0.2191 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)K450.CB) [> 3.1470 = 5.2449 < 6.8184] w=0.2184 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)L163.CB) [> 4.1360 = 6.8934 < 8.9614] w=0.2177 to align # Constraint # added constraint: constraint((T0356)Y179.CB, (T0356)I190.CB) [> 3.8789 = 6.4649 < 8.4043] w=0.2174 to align # Constraint # added constraint: constraint((T0356)M421.CB, (T0356)K450.CB) [> 4.4312 = 7.3853 < 9.6009] w=0.2164 to align # Constraint # added constraint: constraint((T0356)M383.CB, (T0356)M421.CB) [> 3.8640 = 6.4399 < 8.3719] w=0.2147 to align # Constraint # added constraint: constraint((T0356)G384.CA, (T0356)M421.CB) [> 4.7788 = 7.9647 < 10.3541] w=0.2147 to align # Constraint # added constraint: constraint((T0356)R180.CB, (T0356)M191.CB) [> 3.3255 = 5.5425 < 7.2052] w=0.2141 to align # Constraint # added constraint: constraint((T0356)G177.CA, (T0356)S195.CB) [> 3.4982 = 5.8304 < 7.5795] w=0.2141 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)Y179.CB) [> 4.6039 = 7.6732 < 9.9752] w=0.2136 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)Y179.CB) [> 3.4396 = 5.7326 < 7.4524] w=0.2136 to align # Constraint # added constraint: constraint((T0356)L91.CB, (T0356)K110.CB) [> 3.6141 = 6.0236 < 7.8306] w=0.2131 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)A220.CB) [> 3.6776 = 6.1293 < 7.9681] w=0.2117 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)L248.CB) [> 3.3600 = 5.6000 < 7.2800] w=0.2117 to align # Constraint # added constraint: constraint((T0356)W206.CB, (T0356)V217.CB) [> 2.4874 = 4.1457 < 5.3894] w=0.2117 to align # Constraint # added constraint: constraint((T0356)W206.CB, (T0356)A220.CB) [> 3.5638 = 5.9397 < 7.7216] w=0.2117 to align # Constraint # added constraint: constraint((T0356)C207.CB, (T0356)E254.CB) [> 4.3369 = 7.2282 < 9.3967] w=0.2117 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)F244.CB) [> 4.7333 = 7.8888 < 10.2554] w=0.2117 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)K450.CB) [> 4.2789 = 7.1315 < 9.2709] w=0.2117 to align # Constraint # added constraint: constraint((T0356)V265.CB, (T0356)I351.CB) [> 3.8721 = 6.4534 < 8.3895] w=0.2117 to align # Constraint # added constraint: constraint((T0356)V265.CB, (T0356)S449.CB) [> 4.5008 = 7.5013 < 9.7517] w=0.2117 to align # Constraint # added constraint: constraint((T0356)V265.CB, (T0356)K450.CB) [> 3.5227 = 5.8712 < 7.6325] w=0.2117 to align # Constraint # added constraint: constraint((T0356)A267.CB, (T0356)W386.CB) [> 2.2332 = 3.7221 < 4.8387] w=0.2117 to align # Constraint # added constraint: constraint((T0356)A267.CB, (T0356)S387.CB) [> 4.5082 = 7.5136 < 9.7676] w=0.2117 to align # Constraint # added constraint: constraint((T0356)P48.CB, (T0356)P61.CB) [> 3.3083 = 5.5139 < 7.1680] w=0.2117 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)M60.CB) [> 3.1660 = 5.2766 < 6.8596] w=0.2117 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)P61.CB) [> 2.8615 = 4.7692 < 6.1999] w=0.2117 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)V62.CB) [> 4.3031 = 7.1718 < 9.3234] w=0.2117 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)M60.CB) [> 3.9751 = 6.6251 < 8.6127] w=0.2117 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)P61.CB) [> 4.0459 = 6.7432 < 8.7662] w=0.2117 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)V62.CB) [> 2.6351 = 4.3918 < 5.7093] w=0.2117 to align # Constraint # added constraint: constraint((T0356)N54.CB, (T0356)F67.CB) [> 2.7435 = 4.5724 < 5.9442] w=0.2117 to align # Constraint # added constraint: constraint((T0356)P55.CB, (T0356)F67.CB) [> 3.6956 = 6.1593 < 8.0071] w=0.2117 to align # Constraint # added constraint: constraint((T0356)H196.CB, (T0356)Y242.CB) [> 4.4711 = 7.4519 < 9.6874] w=0.2117 to align # Constraint # added constraint: constraint((T0356)A200.CB, (T0356)F244.CB) [> 3.4514 = 5.7524 < 7.4781] w=0.2117 to align # Constraint # added constraint: constraint((T0356)L201.CB, (T0356)L247.CB) [> 4.6813 = 7.8022 < 10.1428] w=0.2117 to align # Constraint # added constraint: constraint((T0356)N457.CB, (T0356)R469.CB) [> 4.5970 = 7.6616 < 9.9601] w=0.2117 to align # Constraint # added constraint: constraint((T0356)T456.CB, (T0356)P470.CB) [> 3.1034 = 5.1724 < 6.7241] w=0.2117 to align # Constraint # added constraint: constraint((T0356)T456.CB, (T0356)R469.CB) [> 4.3839 = 7.3066 < 9.4985] w=0.2117 to align # Constraint # added constraint: constraint((T0356)A455.CB, (T0356)V477.CB) [> 2.7165 = 4.5275 < 5.8857] w=0.2117 to align # Constraint # added constraint: constraint((T0356)M383.CB, (T0356)T419.CB) [> 3.0621 = 5.1034 < 6.6345] w=0.2117 to align # Constraint # added constraint: constraint((T0356)G360.CA, (T0356)D409.CB) [> 4.6308 = 7.7180 < 10.0334] w=0.2117 to align # Constraint # added constraint: constraint((T0356)E359.CB, (T0356)D409.CB) [> 3.0190 = 5.0317 < 6.5411] w=0.2117 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)V400.CB) [> 3.8282 = 6.3804 < 8.2945] w=0.2117 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)I399.CB) [> 3.6527 = 6.0878 < 7.9141] w=0.2117 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)L389.CB) [> 3.8499 = 6.4165 < 8.3415] w=0.2117 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)D353.CB) [> 3.6138 = 6.0230 < 7.8299] w=0.2117 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)D353.CB) [> 4.4973 = 7.4955 < 9.7441] w=0.2117 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)Y355.CB) [> 4.0399 = 6.7331 < 8.7530] w=0.2117 to align # Constraint # added constraint: constraint((T0356)L332.CB, (T0356)P357.CB) [> 4.0127 = 6.6879 < 8.6942] w=0.2117 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)C64.CB) [> 4.1238 = 6.8729 < 8.9348] w=0.2101 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)V62.CB) [> 3.9489 = 6.5815 < 8.5560] w=0.2101 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)I159.CB) [> 3.9609 = 6.6015 < 8.5820] w=0.2101 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)M451.CB) [> 4.5833 = 7.6389 < 9.9305] w=0.2095 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)M451.CB) [> 3.9555 = 6.5925 < 8.5703] w=0.2095 to align # Constraint # added constraint: constraint((T0356)D402.CB, (T0356)V444.CB) [> 4.2195 = 7.0325 < 9.1423] w=0.2093 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)A378.CB) [> 4.0665 = 6.7775 < 8.8107] w=0.2077 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)H377.CB) [> 3.0966 = 5.1610 < 6.7094] w=0.2077 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)I435.CB) [> 4.1949 = 6.9915 < 9.0889] w=0.2058 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)F440.CB) [> 4.1403 = 6.9006 < 8.9708] w=0.2058 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)L221.CB) [> 4.4645 = 7.4409 < 9.6731] w=0.2050 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)V219.CB) [> 4.0913 = 6.8189 < 8.8646] w=0.2050 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)S218.CB) [> 4.1925 = 6.9875 < 9.0837] w=0.2050 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)V303.CB) [> 3.2786 = 5.4643 < 7.1036] w=0.2048 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)V298.CB) [> 4.2703 = 7.1172 < 9.2524] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L189.CB, (T0356)G275.CA) [> 4.2583 = 7.0971 < 9.2262] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L189.CB, (T0356)V219.CB) [> 3.7387 = 6.2312 < 8.1005] w=0.2048 to align # Constraint # added constraint: constraint((T0356)K188.CB, (T0356)E278.CB) [> 3.9578 = 6.5963 < 8.5752] w=0.2048 to align # Constraint # added constraint: constraint((T0356)N187.CB, (T0356)I309.CB) [> 4.5672 = 7.6121 < 9.8957] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Q182.CB, (T0356)M191.CB) [> 3.1653 = 5.2754 < 6.8580] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)V232.CB) [> 3.0518 = 5.0863 < 6.6122] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)A231.CB) [> 3.4844 = 5.8073 < 7.5496] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)L229.CB) [> 4.3022 = 7.1703 < 9.3213] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)I228.CB) [> 3.2452 = 5.4087 < 7.0312] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G177.CA, (T0356)V232.CB) [> 3.8357 = 6.3929 < 8.3108] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G177.CA, (T0356)A231.CB) [> 2.7297 = 4.5496 < 5.9145] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L176.CB, (T0356)P266.CB) [> 4.2192 = 7.0319 < 9.1415] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)N261.CB) [> 4.5727 = 7.6212 < 9.9075] w=0.2048 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)I277.CB) [> 3.9216 = 6.5360 < 8.4967] w=0.2048 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)Y276.CB) [> 3.4311 = 5.7184 < 7.4340] w=0.2048 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)G275.CA) [> 3.6212 = 6.0353 < 7.8459] w=0.2048 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)E274.CB) [> 4.6482 = 7.7470 < 10.0711] w=0.2048 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)L263.CB) [> 3.3492 = 5.5820 < 7.2567] w=0.2048 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)N261.CB) [> 2.4901 = 4.1502 < 5.3952] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Q204.CB, (T0356)Y295.CB) [> 4.0093 = 6.6821 < 8.6867] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Q204.CB, (T0356)I277.CB) [> 4.7926 = 7.9877 < 10.3840] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)Y295.CB) [> 3.8897 = 6.4829 < 8.4277] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)I277.CB) [> 3.2881 = 5.4801 < 7.1241] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)V217.CB) [> 3.2227 = 5.3712 < 6.9825] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)P216.CB) [> 4.2228 = 7.0380 < 9.1494] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A200.CB, (T0356)Y295.CB) [> 4.4608 = 7.4346 < 9.6650] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)D237.CB) [> 4.2130 = 7.0216 < 9.1281] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L194.CB, (T0356)S300.CB) [> 4.2519 = 7.0865 < 9.2125] w=0.2048 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)P216.CB) [> 4.1820 = 6.9700 < 9.0610] w=0.2048 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)Y203.CB) [> 3.4754 = 5.7923 < 7.5300] w=0.2048 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)G198.CA) [> 4.3217 = 7.2028 < 9.3637] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)P266.CB) [> 3.9088 = 6.5147 < 8.4691] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)V265.CB) [> 4.3904 = 7.3174 < 9.5126] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)L263.CB) [> 2.5699 = 4.2832 < 5.5681] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)V255.CB) [> 4.1727 = 6.9545 < 9.0408] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)Y242.CB) [> 4.6169 = 7.6948 < 10.0032] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)S218.CB) [> 2.8173 = 4.6954 < 6.1041] w=0.2048 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)Y179.CB) [> 3.4894 = 5.8157 < 7.5605] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)A269.CB) [> 4.1369 = 6.8948 < 8.9633] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)P266.CB) [> 3.5806 = 5.9677 < 7.7580] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)A231.CB) [> 3.5143 = 5.8572 < 7.6144] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)I228.CB) [> 3.2808 = 5.4680 < 7.1084] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)G177.CA) [> 3.1757 = 5.2929 < 6.8807] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)I228.CB) [> 4.3702 = 7.2837 < 9.4688] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)G222.CA) [> 3.3473 = 5.5788 < 7.2524] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)L221.CB) [> 3.8486 = 6.4143 < 8.3386] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L176.CB, (T0356)A231.CB) [> 2.8713 = 4.7855 < 6.2212] w=0.2048 to align # Constraint # added constraint: constraint((T0356)N175.CB, (T0356)G198.CA) [> 3.3715 = 5.6191 < 7.3048] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Q174.CB, (T0356)V255.CB) [> 3.9201 = 6.5335 < 8.4935] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Q174.CB, (T0356)Y242.CB) [> 3.9200 = 6.5334 < 8.4934] w=0.2048 to align # Constraint # added constraint: constraint((T0356)R167.CB, (T0356)L263.CB) [> 3.0591 = 5.0985 < 6.6281] w=0.2048 to align # Constraint # added constraint: constraint((T0356)R167.CB, (T0356)P216.CB) [> 4.5140 = 7.5233 < 9.7803] w=0.2048 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)L263.CB) [> 3.0181 = 5.0302 < 6.5392] w=0.2048 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)S218.CB) [> 4.7551 = 7.9251 < 10.3027] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I271.CB, (T0356)I309.CB) [> 4.6403 = 7.7338 < 10.0540] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E270.CB, (T0356)R312.CB) [> 2.4501 = 4.0835 < 5.3085] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E270.CB, (T0356)Q311.CB) [> 3.7938 = 6.3230 < 8.2199] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A269.CB, (T0356)R312.CB) [> 4.4907 = 7.4845 < 9.7299] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V265.CB, (T0356)E274.CB) [> 4.5334 = 7.5556 < 9.8223] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)E274.CB) [> 4.7380 = 7.8966 < 10.2656] w=0.2048 to align # Constraint # added constraint: constraint((T0356)N261.CB, (T0356)H308.CB) [> 4.3405 = 7.2342 < 9.4044] w=0.2048 to align # Constraint # added constraint: constraint((T0356)N261.CB, (T0356)T307.CB) [> 3.9143 = 6.5238 < 8.4810] w=0.2048 to align # Constraint # added constraint: constraint((T0356)N261.CB, (T0356)G275.CA) [> 3.5649 = 5.9415 < 7.7239] w=0.2048 to align # Constraint # added constraint: constraint((T0356)N261.CB, (T0356)E274.CB) [> 2.8985 = 4.8308 < 6.2801] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)H308.CB) [> 2.3995 = 3.9991 < 5.1988] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)T307.CB) [> 2.6046 = 4.3410 < 5.6432] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)Y276.CB) [> 4.7266 = 7.8776 < 10.2409] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)G275.CA) [> 4.5678 = 7.6131 < 9.8970] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)E274.CB) [> 2.9448 = 4.9080 < 6.3804] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)T310.CB) [> 4.2999 = 7.1666 < 9.3165] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)H308.CB) [> 2.9392 = 4.8986 < 6.3682] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)E274.CB) [> 4.0029 = 6.6714 < 8.6728] w=0.2048 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)H308.CB) [> 4.0157 = 6.6928 < 8.7007] w=0.2048 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)E274.CB) [> 2.9511 = 4.9185 < 6.3940] w=0.2048 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)V272.CB) [> 4.2508 = 7.0847 < 9.2101] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)V265.CB) [> 3.1785 = 5.2975 < 6.8867] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E278.CB, (T0356)T305.CB) [> 3.1661 = 5.2769 < 6.8599] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E278.CB, (T0356)Y294.CB) [> 2.7294 = 4.5491 < 5.9138] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I277.CB, (T0356)F304.CB) [> 3.5275 = 5.8791 < 7.6429] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I277.CB, (T0356)Y295.CB) [> 3.9357 = 6.5595 < 8.5273] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I277.CB, (T0356)Y294.CB) [> 4.4537 = 7.4228 < 9.6496] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Y276.CB, (T0356)T307.CB) [> 3.0745 = 5.1241 < 6.6613] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)H308.CB) [> 4.4158 = 7.3597 < 9.5676] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)T307.CB) [> 3.1940 = 5.3233 < 6.9203] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)V306.CB) [> 3.2490 = 5.4151 < 7.0396] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E274.CB, (T0356)T310.CB) [> 4.6384 = 7.7307 < 10.0499] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E274.CB, (T0356)I309.CB) [> 4.1767 = 6.9611 < 9.0494] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E274.CB, (T0356)H308.CB) [> 2.2458 = 3.7431 < 4.8660] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L273.CB, (T0356)I309.CB) [> 3.4243 = 5.7071 < 7.4192] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V272.CB, (T0356)Q311.CB) [> 4.4831 = 7.4718 < 9.7134] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V272.CB, (T0356)T310.CB) [> 2.8616 = 4.7693 < 6.2001] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V272.CB, (T0356)I309.CB) [> 4.0123 = 6.6872 < 8.6933] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V272.CB, (T0356)H308.CB) [> 4.6886 = 7.8144 < 10.1587] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I271.CB, (T0356)A315.CB) [> 3.6006 = 6.0010 < 7.8013] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I271.CB, (T0356)R312.CB) [> 4.3280 = 7.2133 < 9.3773] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I271.CB, (T0356)Q311.CB) [> 3.1639 = 5.2732 < 6.8551] w=0.2048 to align # Constraint # added constraint: constraint((T0356)I271.CB, (T0356)T310.CB) [> 4.5604 = 7.6006 < 9.8808] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)I271.CB) [> 2.1995 = 3.6659 < 4.7657] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)E270.CB) [> 3.2888 = 5.4813 < 7.1257] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)A269.CB) [> 3.1085 = 5.1809 < 6.7352] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)L273.CB) [> 4.7621 = 7.9368 < 10.3178] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)V272.CB) [> 3.4802 = 5.8003 < 7.5404] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)I271.CB) [> 4.3556 = 7.2593 < 9.4371] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)A269.CB) [> 2.2947 = 3.8245 < 4.9718] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)P266.CB) [> 2.6217 = 4.3696 < 5.6804] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)L273.CB) [> 2.3826 = 3.9710 < 5.1623] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)V272.CB) [> 4.2357 = 7.0595 < 9.1773] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)L273.CB) [> 3.8457 = 6.4095 < 8.3323] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)V272.CB) [> 3.3937 = 5.6561 < 7.3530] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)P266.CB) [> 4.7771 = 7.9618 < 10.3503] w=0.2048 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)L263.CB) [> 2.8896 = 4.8159 < 6.2607] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)F304.CB) [> 4.0162 = 6.6936 < 8.7017] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)I277.CB) [> 4.4067 = 7.3446 < 9.5479] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)G275.CA) [> 3.4569 = 5.7615 < 7.4899] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)L263.CB) [> 3.4949 = 5.8248 < 7.5723] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V255.CB, (T0356)A267.CB) [> 3.7200 = 6.2000 < 8.0600] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V255.CB, (T0356)P266.CB) [> 3.2236 = 5.3726 < 6.9844] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E254.CB, (T0356)S268.CB) [> 3.9104 = 6.5173 < 8.4724] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E254.CB, (T0356)A267.CB) [> 2.1804 = 3.6340 < 4.7242] w=0.2048 to align # Constraint # added constraint: constraint((T0356)E254.CB, (T0356)P266.CB) [> 4.2072 = 7.0120 < 9.1156] w=0.2048 to align # Constraint # added constraint: constraint((T0356)T253.CB, (T0356)A267.CB) [> 4.3640 = 7.2734 < 9.4554] w=0.2048 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)V272.CB) [> 4.4960 = 7.4933 < 9.7413] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)A269.CB) [> 3.4889 = 5.8149 < 7.5594] w=0.2048 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)E270.CB) [> 4.4769 = 7.4615 < 9.6999] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)S268.CB) [> 4.1307 = 6.8844 < 8.9497] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)A269.CB) [> 4.1714 = 6.9523 < 9.0379] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)E270.CB) [> 3.2364 = 5.3939 < 7.0121] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A231.CB, (T0356)A245.CB) [> 2.9306 = 4.8843 < 6.3496] w=0.2048 to align # Constraint # added constraint: constraint((T0356)A231.CB, (T0356)T253.CB) [> 4.2973 = 7.1622 < 9.3108] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V235.CB, (T0356)F244.CB) [> 3.6508 = 6.0846 < 7.9100] w=0.2048 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)E254.CB) [> 4.3555 = 7.2593 < 9.4370] w=0.2048 to align # Constraint # added constraint: constraint((T0356)V430.CB, (T0356)K450.CB) [> 4.2548 = 7.0913 < 9.2187] w=0.2042 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)V255.CB) [> 4.4873 = 7.4788 < 9.7225] w=0.2035 to align # Constraint # added constraint: constraint((T0356)A39.CB, (T0356)L92.CB) [> 2.9064 = 4.8440 < 6.2972] w=0.2035 to align # Constraint # added constraint: constraint((T0356)G68.CA, (T0356)Q79.CB) [> 3.7576 = 6.2626 < 8.1413] w=0.2025 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)I399.CB) [> 2.9749 = 4.9582 < 6.4456] w=0.2025 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)V398.CB) [> 3.6151 = 6.0251 < 7.8327] w=0.1997 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)D422.CB) [> 4.5162 = 7.5271 < 9.7852] w=0.1980 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)W459.CB) [> 3.4283 = 5.7139 < 7.4280] w=0.1977 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)A378.CB) [> 4.7867 = 7.9779 < 10.3712] w=0.1974 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)W410.CB) [> 3.7694 = 6.2824 < 8.1671] w=0.1948 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)V405.CB) [> 4.0920 = 6.8200 < 8.8660] w=0.1947 to align # Constraint # added constraint: constraint((T0356)T36.CB, (T0356)M77.CB) [> 2.5365 = 4.2276 < 5.4959] w=0.1941 to align # Constraint # added constraint: constraint((T0356)T36.CB, (T0356)Q79.CB) [> 3.8381 = 6.3968 < 8.3159] w=0.1941 to align # Constraint # added constraint: constraint((T0356)A39.CB, (T0356)V73.CB) [> 3.5951 = 5.9919 < 7.7895] w=0.1941 to align # Constraint # added constraint: constraint((T0356)D40.CB, (T0356)G68.CA) [> 4.4634 = 7.4390 < 9.6707] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L43.CB, (T0356)G68.CA) [> 2.9681 = 4.9469 < 6.4310] w=0.1941 to align # Constraint # added constraint: constraint((T0356)G46.CA, (T0356)F67.CB) [> 3.9949 = 6.6582 < 8.6557] w=0.1941 to align # Constraint # added constraint: constraint((T0356)D8.CB, (T0356)T42.CB) [> 2.3598 = 3.9331 < 5.1130] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L9.CB, (T0356)I35.CB) [> 4.1772 = 6.9620 < 9.0506] w=0.1941 to align # Constraint # added constraint: constraint((T0356)R10.CB, (T0356)I38.CB) [> 4.5494 = 7.5823 < 9.8569] w=0.1941 to align # Constraint # added constraint: constraint((T0356)F12.CB, (T0356)I38.CB) [> 2.7209 = 4.5349 < 5.8953] w=0.1941 to align # Constraint # added constraint: constraint((T0356)F12.CB, (T0356)T42.CB) [> 3.7744 = 6.2907 < 8.1779] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L13.CB, (T0356)E34.CB) [> 3.8559 = 6.4265 < 8.3545] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L13.CB, (T0356)I35.CB) [> 3.6372 = 6.0619 < 7.8805] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L16.CB, (T0356)E34.CB) [> 3.7277 = 6.2128 < 8.0767] w=0.1941 to align # Constraint # added constraint: constraint((T0356)Q19.CB, (T0356)L95.CB) [> 3.8581 = 6.4301 < 8.3591] w=0.1941 to align # Constraint # added constraint: constraint((T0356)H32.CB, (T0356)G78.CA) [> 4.7450 = 7.9083 < 10.2808] w=0.1941 to align # Constraint # added constraint: constraint((T0356)T36.CB, (T0356)V73.CB) [> 3.3373 = 5.5621 < 7.2308] w=0.1941 to align # Constraint # added constraint: constraint((T0356)T36.CB, (T0356)A74.CB) [> 4.5290 = 7.5484 < 9.8129] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L111.CB, (T0356)Y203.CB) [> 3.8946 = 6.4910 < 8.4383] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L111.CB, (T0356)L229.CB) [> 3.6891 = 6.1485 < 7.9931] w=0.1941 to align # Constraint # added constraint: constraint((T0356)F114.CB, (T0356)L229.CB) [> 3.7507 = 6.2512 < 8.1266] w=0.1941 to align # Constraint # added constraint: constraint((T0356)F114.CB, (T0356)G230.CA) [> 4.1436 = 6.9061 < 8.9779] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L118.CB, (T0356)Y242.CB) [> 4.0064 = 6.6773 < 8.6805] w=0.1941 to align # Constraint # added constraint: constraint((T0356)P121.CB, (T0356)R249.CB) [> 4.3007 = 7.1678 < 9.3182] w=0.1941 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)A245.CB) [> 3.4002 = 5.6670 < 7.3671] w=0.1941 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)R249.CB) [> 3.9550 = 6.5916 < 8.5691] w=0.1941 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)K110.CB) [> 2.4654 = 4.1090 < 5.3417] w=0.1941 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)Q113.CB) [> 3.0082 = 5.0136 < 6.5177] w=0.1941 to align # Constraint # added constraint: constraint((T0356)G68.CA, (T0356)Q113.CB) [> 4.6000 = 7.6667 < 9.9667] w=0.1941 to align # Constraint # added constraint: constraint((T0356)T69.CB, (T0356)A226.CB) [> 3.6542 = 6.0903 < 7.9174] w=0.1941 to align # Constraint # added constraint: constraint((T0356)R105.CB, (T0356)P225.CB) [> 4.2157 = 7.0262 < 9.1341] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L107.CB, (T0356)P225.CB) [> 2.8077 = 4.6795 < 6.0834] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L107.CB, (T0356)I228.CB) [> 2.8371 = 4.7285 < 6.1471] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L107.CB, (T0356)L229.CB) [> 2.7949 = 4.6581 < 6.0555] w=0.1941 to align # Constraint # added constraint: constraint((T0356)F108.CB, (T0356)L229.CB) [> 4.6561 = 7.7602 < 10.0883] w=0.1941 to align # Constraint # added constraint: constraint((T0356)L111.CB, (T0356)A200.CB) [> 3.2901 = 5.4835 < 7.1285] w=0.1941 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)V400.CB) [> 4.1031 = 6.8386 < 8.8902] w=0.1936 to align # Constraint # added constraint: constraint((T0356)P55.CB, (T0356)V73.CB) [> 4.0931 = 6.8218 < 8.8683] w=0.1921 to align # Constraint # added constraint: constraint((T0356)P55.CB, (T0356)C64.CB) [> 4.1808 = 6.9679 < 9.0583] w=0.1921 to align # Constraint # added constraint: constraint((T0356)N432.CB, (T0356)G446.CA) [> 3.6388 = 6.0647 < 7.8841] w=0.1919 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)F244.CB) [> 3.4160 = 5.6933 < 7.4012] w=0.1918 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)Y242.CB) [> 4.7998 = 7.9997 < 10.3996] w=0.1918 to align # Constraint # added constraint: constraint((T0356)S218.CB, (T0356)G230.CA) [> 3.0092 = 5.0153 < 6.5200] w=0.1918 to align # Constraint # added constraint: constraint((T0356)E213.CB, (T0356)L248.CB) [> 4.2041 = 7.0069 < 9.1089] w=0.1918 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)L229.CB) [> 3.8958 = 6.4929 < 8.4408] w=0.1918 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)I228.CB) [> 4.5395 = 7.5658 < 9.8355] w=0.1918 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)P225.CB) [> 3.4039 = 5.6732 < 7.3752] w=0.1918 to align # Constraint # added constraint: constraint((T0356)R197.CB, (T0356)P225.CB) [> 3.8283 = 6.3806 < 8.2947] w=0.1918 to align # Constraint # added constraint: constraint((T0356)R420.CB, (T0356)D474.CB) [> 4.3106 = 7.1843 < 9.3396] w=0.1918 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)L229.CB) [> 3.8719 = 6.4532 < 8.3892] w=0.1918 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)G230.CA) [> 2.5805 = 4.3008 < 5.5910] w=0.1918 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)Y242.CB) [> 4.3208 = 7.2014 < 9.3618] w=0.1918 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)S218.CB) [> 3.2041 = 5.3402 < 6.9423] w=0.1912 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)L221.CB) [> 4.1223 = 6.8706 < 8.9317] w=0.1912 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)L221.CB) [> 4.3505 = 7.2509 < 9.4261] w=0.1912 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)L221.CB) [> 2.5966 = 4.3277 < 5.6260] w=0.1912 to align # Constraint # added constraint: constraint((T0356)T166.CB, (T0356)A223.CB) [> 2.9122 = 4.8537 < 6.3098] w=0.1912 to align # Constraint # added constraint: constraint((T0356)I435.CB, (T0356)D454.CB) [> 4.0995 = 6.8324 < 8.8821] w=0.1912 to align # Constraint # added constraint: constraint((T0356)L189.CB, (T0356)F304.CB) [> 3.1290 = 5.2150 < 6.7794] w=0.1909 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)I190.CB) [> 3.9746 = 6.6244 < 8.6117] w=0.1905 to align # Constraint # added constraint: constraint((T0356)L92.CB, (T0356)T164.CB) [> 4.4267 = 7.3778 < 9.5912] w=0.1905 to align # Constraint # added constraint: constraint((T0356)Y295.CB, (T0356)F304.CB) [> 3.4163 = 5.6938 < 7.4019] w=0.1900 to align # Constraint # added constraint: constraint((T0356)S240.CB, (T0356)N432.CB) [> 3.6562 = 6.0936 < 7.9217] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L239.CB, (T0356)C401.CB) [> 3.7501 = 6.2501 < 8.1251] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L239.CB, (T0356)T369.CB) [> 3.1913 = 5.3188 < 6.9144] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L239.CB, (T0356)V368.CB) [> 3.9113 = 6.5189 < 8.4745] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L239.CB, (T0356)P325.CB) [> 4.7546 = 7.9243 < 10.3017] w=0.1892 to align # Constraint # added constraint: constraint((T0356)D237.CB, (T0356)P325.CB) [> 3.5830 = 5.9717 < 7.7632] w=0.1892 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)T320.CB) [> 4.5685 = 7.6142 < 9.8985] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)Y355.CB) [> 4.6055 = 7.6759 < 9.9787] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)I399.CB) [> 3.8054 = 6.3424 < 8.2451] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)C401.CB) [> 3.7791 = 6.2985 < 8.1880] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)V430.CB) [> 3.9182 = 6.5303 < 8.4895] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L247.CB, (T0356)V430.CB) [> 4.7315 = 7.8858 < 10.2515] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L247.CB, (T0356)N432.CB) [> 2.7713 = 4.6188 < 6.0044] w=0.1892 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)V306.CB) [> 4.6246 = 7.7077 < 10.0200] w=0.1892 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)T320.CB) [> 4.6347 = 7.7245 < 10.0419] w=0.1892 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)Y321.CB) [> 3.4827 = 5.8044 < 7.5457] w=0.1892 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)I351.CB) [> 3.5918 = 5.9864 < 7.7823] w=0.1892 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)T320.CB) [> 2.9562 = 4.9270 < 6.4051] w=0.1892 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)Y321.CB) [> 3.6606 = 6.1011 < 7.9314] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)G323.CA) [> 4.1542 = 6.9237 < 9.0008] w=0.1892 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)D237.CB) [> 4.5407 = 7.5678 < 9.8382] w=0.1892 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)V368.CB) [> 4.2090 = 7.0151 < 9.1196] w=0.1892 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)A378.CB) [> 4.3819 = 7.3031 < 9.4941] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)K396.CB) [> 3.2433 = 5.4054 < 7.0271] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)F397.CB) [> 4.4310 = 7.3849 < 9.6004] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)V398.CB) [> 3.1805 = 5.3008 < 6.8910] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)I399.CB) [> 4.1824 = 6.9706 < 9.0618] w=0.1892 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)I417.CB) [> 3.4840 = 5.8067 < 7.5487] w=0.1892 to align # Constraint # added constraint: constraint((T0356)I370.CB, (T0356)W410.CB) [> 4.3808 = 7.3014 < 9.4918] w=0.1892 to align # Constraint # added constraint: constraint((T0356)K371.CB, (T0356)V405.CB) [> 3.7869 = 6.3115 < 8.2049] w=0.1892 to align # Constraint # added constraint: constraint((T0356)Y374.CB, (T0356)I417.CB) [> 3.2733 = 5.4554 < 7.0921] w=0.1892 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)K396.CB) [> 4.0210 = 6.7017 < 8.7122] w=0.1892 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)K396.CB) [> 3.2090 = 5.3483 < 6.9528] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)I484.CB) [> 3.5538 = 5.9230 < 7.6999] w=0.1892 to align # Constraint # added constraint: constraint((T0356)I414.CB, (T0356)T427.CB) [> 3.9288 = 6.5480 < 8.5124] w=0.1892 to align # Constraint # added constraint: constraint((T0356)I414.CB, (T0356)L429.CB) [> 3.6551 = 6.0918 < 7.9194] w=0.1892 to align # Constraint # added constraint: constraint((T0356)R249.CB, (T0356)H318.CB) [> 4.7205 = 7.8676 < 10.2278] w=0.1892 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)Y394.CB) [> 4.0768 = 6.7948 < 8.8332] w=0.1892 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)Y394.CB) [> 4.2677 = 7.1129 < 9.2468] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)V385.CB) [> 4.2550 = 7.0917 < 9.2192] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)M382.CB) [> 3.6397 = 6.0661 < 7.8860] w=0.1892 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)V368.CB) [> 4.0380 = 6.7301 < 8.7491] w=0.1892 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)V398.CB) [> 4.6893 = 7.8155 < 10.1602] w=0.1892 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)F397.CB) [> 2.9508 = 4.9180 < 6.3934] w=0.1892 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)K396.CB) [> 4.4518 = 7.4197 < 9.6456] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)K396.CB) [> 3.0809 = 5.1348 < 6.6753] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)T395.CB) [> 4.4702 = 7.4503 < 9.6854] w=0.1892 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)Y394.CB) [> 3.4093 = 5.6822 < 7.3868] w=0.1892 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)K396.CB) [> 3.9604 = 6.6006 < 8.5808] w=0.1892 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)T395.CB) [> 2.7306 = 4.5511 < 5.9164] w=0.1892 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)T433.CB) [> 3.7433 = 6.2388 < 8.1104] w=0.1878 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)Y437.CB) [> 3.1156 = 5.1927 < 6.7505] w=0.1878 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)L438.CB) [> 3.9881 = 6.6468 < 8.6408] w=0.1878 to align # Constraint # added constraint: constraint((T0356)A416.CB, (T0356)T433.CB) [> 4.3232 = 7.2054 < 9.3670] w=0.1878 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)T433.CB) [> 3.5792 = 5.9654 < 7.7550] w=0.1878 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)Y437.CB) [> 3.3955 = 5.6592 < 7.3569] w=0.1878 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)D454.CB) [> 4.2972 = 7.1620 < 9.3106] w=0.1860 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)I399.CB) [> 3.6338 = 6.0563 < 7.8732] w=0.1856 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)P121.CB) [> 3.0199 = 5.0332 < 6.5432] w=0.1855 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)C401.CB) [> 3.2658 = 5.4430 < 7.0759] w=0.1848 to align # Constraint # added constraint: constraint((T0356)G89.CA, (T0356)T122.CB) [> 3.7000 = 6.1666 < 8.0167] w=0.1846 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)L248.CB) [> 4.0989 = 6.8315 < 8.8809] w=0.1838 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)L453.CB) [> 4.4062 = 7.3436 < 9.5467] w=0.1829 to align # Constraint # added constraint: constraint((T0356)F12.CB, (T0356)L92.CB) [> 4.2720 = 7.1200 < 9.2559] w=0.1791 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)Y295.CB) [> 3.1836 = 5.3059 < 6.8977] w=0.1779 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)G293.CA) [> 3.4479 = 5.7464 < 7.4704] w=0.1779 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)G452.CA) [> 4.7116 = 7.8527 < 10.2086] w=0.1772 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)P443.CB) [> 4.0174 = 6.6957 < 8.7044] w=0.1770 to align # Constraint # added constraint: constraint((T0356)R214.CB, (T0356)G250.CA) [> 3.1769 = 5.2948 < 6.8833] w=0.1770 to align # Constraint # added constraint: constraint((T0356)R214.CB, (T0356)T251.CB) [> 3.8976 = 6.4960 < 8.4448] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)A267.CB) [> 4.6590 = 7.7649 < 10.0944] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)D353.CB) [> 4.3489 = 7.2482 < 9.4227] w=0.1770 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)A267.CB) [> 3.2679 = 5.4465 < 7.0805] w=0.1770 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)Y355.CB) [> 4.3591 = 7.2651 < 9.4446] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)K257.CB) [> 3.2307 = 5.3845 < 6.9998] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)C258.CB) [> 4.7270 = 7.8784 < 10.2419] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)L263.CB) [> 4.5837 = 7.6395 < 9.9314] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)A267.CB) [> 3.5133 = 5.8554 < 7.6121] w=0.1770 to align # Constraint # added constraint: constraint((T0356)D224.CB, (T0356)V265.CB) [> 4.6514 = 7.7524 < 10.0781] w=0.1770 to align # Constraint # added constraint: constraint((T0356)D224.CB, (T0356)L356.CB) [> 3.4907 = 5.8178 < 7.5632] w=0.1770 to align # Constraint # added constraint: constraint((T0356)P225.CB, (T0356)G360.CA) [> 3.0036 = 5.0060 < 6.5079] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V29.CB, (T0356)I190.CB) [> 3.9413 = 6.5688 < 8.5394] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V29.CB, (T0356)M191.CB) [> 4.6776 = 7.7961 < 10.1349] w=0.1770 to align # Constraint # added constraint: constraint((T0356)P31.CB, (T0356)E87.CB) [> 2.4291 = 4.0485 < 5.2631] w=0.1770 to align # Constraint # added constraint: constraint((T0356)H32.CB, (T0356)E87.CB) [> 4.3675 = 7.2792 < 9.4630] w=0.1770 to align # Constraint # added constraint: constraint((T0356)I35.CB, (T0356)E87.CB) [> 2.5663 = 4.2773 < 5.5604] w=0.1770 to align # Constraint # added constraint: constraint((T0356)I35.CB, (T0356)V88.CB) [> 3.9306 = 6.5510 < 8.5162] w=0.1770 to align # Constraint # added constraint: constraint((T0356)I35.CB, (T0356)G89.CA) [> 4.7137 = 7.8562 < 10.2131] w=0.1770 to align # Constraint # added constraint: constraint((T0356)I35.CB, (T0356)L91.CB) [> 2.4500 = 4.0833 < 5.3083] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A39.CB, (T0356)F94.CB) [> 4.6812 = 7.8021 < 10.1427] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)E431.CB) [> 3.7901 = 6.3168 < 8.2119] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)I435.CB) [> 3.3105 = 5.5175 < 7.1727] w=0.1770 to align # Constraint # added constraint: constraint((T0356)G384.CA, (T0356)T427.CB) [> 4.4004 = 7.3340 < 9.5341] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)L429.CB) [> 4.0486 = 6.7477 < 8.7720] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)Y437.CB) [> 4.6855 = 7.8092 < 10.1519] w=0.1770 to align # Constraint # added constraint: constraint((T0356)L389.CB, (T0356)T427.CB) [> 3.9214 = 6.5357 < 8.4964] w=0.1770 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)T427.CB) [> 4.4403 = 7.4005 < 9.6207] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)P423.CB) [> 4.7542 = 7.9237 < 10.3008] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)R425.CB) [> 2.6427 = 4.4046 < 5.7259] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V405.CB, (T0356)L429.CB) [> 4.0461 = 6.7434 < 8.7664] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V405.CB, (T0356)V430.CB) [> 3.7414 = 6.2357 < 8.1064] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V405.CB, (T0356)E431.CB) [> 3.1691 = 5.2818 < 6.8663] w=0.1770 to align # Constraint # added constraint: constraint((T0356)I414.CB, (T0356)D436.CB) [> 3.3672 = 5.6120 < 7.2956] w=0.1770 to align # Constraint # added constraint: constraint((T0356)T418.CB, (T0356)L438.CB) [> 4.4285 = 7.3808 < 9.5950] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A424.CB, (T0356)L438.CB) [> 4.5667 = 7.6112 < 9.8945] w=0.1770 to align # Constraint # added constraint: constraint((T0356)R425.CB, (T0356)L438.CB) [> 3.5250 = 5.8751 < 7.6376] w=0.1770 to align # Constraint # added constraint: constraint((T0356)D426.CB, (T0356)L438.CB) [> 4.0910 = 6.8183 < 8.8638] w=0.1770 to align # Constraint # added constraint: constraint((T0356)T427.CB, (T0356)D436.CB) [> 4.5136 = 7.5227 < 9.7795] w=0.1770 to align # Constraint # added constraint: constraint((T0356)V428.CB, (T0356)S442.CB) [> 4.7967 = 7.9945 < 10.3928] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A226.CB, (T0356)P357.CB) [> 3.4043 = 5.6738 < 7.3759] w=0.1770 to align # Constraint # added constraint: constraint((T0356)A226.CB, (T0356)G360.CA) [> 3.1205 = 5.2008 < 6.7610] w=0.1770 to align # Constraint # added constraint: constraint((T0356)H377.CB, (T0356)I435.CB) [> 3.1713 = 5.2855 < 6.8712] w=0.1770 to align # Constraint # added constraint: constraint((T0356)H377.CB, (T0356)E431.CB) [> 4.1993 = 6.9989 < 9.0986] w=0.1770 to align # Constraint # added constraint: constraint((T0356)H377.CB, (T0356)V430.CB) [> 4.3239 = 7.2065 < 9.3685] w=0.1770 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)H377.CB) [> 3.7208 = 6.2013 < 8.0617] w=0.1770 to align # Constraint # added constraint: constraint((T0356)S362.CB, (T0356)P434.CB) [> 3.5389 = 5.8981 < 7.6676] w=0.1770 to align # Constraint # added constraint: constraint((T0356)P434.CB, (T0356)P470.CB) [> 3.3378 = 5.5630 < 7.2319] w=0.1763 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)L194.CB) [> 4.0881 = 6.8136 < 8.8576] w=0.1719 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)T164.CB) [> 4.1127 = 6.8544 < 8.9108] w=0.1716 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)S449.CB) [> 4.4969 = 7.4948 < 9.7433] w=0.1683 to align # Constraint # added constraint: constraint((T0356)M393.CB, (T0356)S449.CB) [> 4.0072 = 6.6786 < 8.6822] w=0.1683 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)W206.CB) [> 3.3700 = 5.6167 < 7.3017] w=0.1677 to align # Constraint # added constraint: constraint((T0356)W410.CB, (T0356)A441.CB) [> 4.5765 = 7.6275 < 9.9158] w=0.1673 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)V428.CB) [> 4.0937 = 6.8229 < 8.8698] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)P70.CB) [> 4.6824 = 7.8039 < 10.1451] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)L453.CB) [> 4.3591 = 7.2652 < 9.4447] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)G452.CA) [> 3.0954 = 5.1590 < 6.7067] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)M451.CB) [> 4.5977 = 7.6628 < 9.9616] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)S449.CB) [> 2.4324 = 4.0540 < 5.2702] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)G448.CA) [> 4.6484 = 7.7473 < 10.0715] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)V430.CB) [> 4.4101 = 7.3502 < 9.5553] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)L429.CB) [> 3.0688 = 5.1147 < 6.6491] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)V428.CB) [> 4.7499 = 7.9165 < 10.2915] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)L453.CB) [> 3.5750 = 5.9584 < 7.7459] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)G452.CA) [> 3.3081 = 5.5136 < 7.1676] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)M451.CB) [> 2.9128 = 4.8547 < 6.3110] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)K450.CB) [> 4.1556 = 6.9259 < 9.0037] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)S449.CB) [> 3.6733 = 6.1222 < 7.9588] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)L429.CB) [> 4.3525 = 7.2541 < 9.4304] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)V428.CB) [> 3.0354 = 5.0589 < 6.5766] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)T427.CB) [> 4.4136 = 7.3560 < 9.5628] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)M451.CB) [> 4.5302 = 7.5503 < 9.8154] w=0.1664 to align # Constraint # added constraint: constraint((T0356)Y58.CB, (T0356)N457.CB) [> 3.2317 = 5.3861 < 7.0019] w=0.1664 to align # Constraint # added constraint: constraint((T0356)Y58.CB, (T0356)A455.CB) [> 2.6498 = 4.4164 < 5.7413] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G57.CA, (T0356)N457.CB) [> 4.4175 = 7.3625 < 9.5712] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P55.CB, (T0356)N457.CB) [> 4.5555 = 7.5926 < 9.8703] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P55.CB, (T0356)T456.CB) [> 4.4563 = 7.4273 < 9.6554] w=0.1664 to align # Constraint # added constraint: constraint((T0356)N54.CB, (T0356)T456.CB) [> 3.4217 = 5.7029 < 7.4137] w=0.1664 to align # Constraint # added constraint: constraint((T0356)N54.CB, (T0356)A455.CB) [> 2.1861 = 3.6435 < 4.7366] w=0.1664 to align # Constraint # added constraint: constraint((T0356)N54.CB, (T0356)D454.CB) [> 3.3540 = 5.5901 < 7.2671] w=0.1664 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)A455.CB) [> 4.2158 = 7.0262 < 9.1341] w=0.1664 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)D454.CB) [> 3.3990 = 5.6650 < 7.3645] w=0.1664 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)L453.CB) [> 4.2803 = 7.1338 < 9.2740] w=0.1664 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)G452.CA) [> 3.8113 = 6.3521 < 8.2578] w=0.1664 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)V430.CB) [> 4.7256 = 7.8760 < 10.2388] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)A455.CB) [> 3.6950 = 6.1583 < 8.0058] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)D454.CB) [> 4.6989 = 7.8316 < 10.1811] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)L453.CB) [> 2.6334 = 4.3890 < 5.7057] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)G452.CA) [> 4.1445 = 6.9074 < 8.9797] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)V430.CB) [> 2.9701 = 4.9503 < 6.4353] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)L429.CB) [> 4.3906 = 7.3176 < 9.5129] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A45.CB, (T0356)M451.CB) [> 4.0203 = 6.7006 < 8.7108] w=0.1664 to align # Constraint # added constraint: constraint((T0356)V29.CB, (T0356)L453.CB) [> 4.4483 = 7.4138 < 9.6380] w=0.1664 to align # Constraint # added constraint: constraint((T0356)V29.CB, (T0356)G47.CA) [> 3.4879 = 5.8132 < 7.5571] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P28.CB, (T0356)G468.CA) [> 4.3854 = 7.3089 < 9.5016] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L27.CB, (T0356)L453.CB) [> 3.5773 = 5.9622 < 7.7509] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L27.CB, (T0356)T69.CB) [> 4.2987 = 7.1645 < 9.3139] w=0.1664 to align # Constraint # added constraint: constraint((T0356)I25.CB, (T0356)R465.CB) [> 4.6517 = 7.7528 < 10.0787] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)K450.CB) [> 2.9701 = 4.9501 < 6.4352] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)L429.CB) [> 4.5216 = 7.5361 < 9.7969] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)T427.CB) [> 3.0292 = 5.0486 < 6.5631] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)D426.CB) [> 4.6810 = 7.8017 < 10.1423] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)T418.CB) [> 3.6974 = 6.1623 < 8.0110] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)I417.CB) [> 3.4952 = 5.8253 < 7.5730] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P48.CB, (T0356)K450.CB) [> 3.5581 = 5.9302 < 7.7093] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P48.CB, (T0356)T427.CB) [> 4.4251 = 7.3751 < 9.5876] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P48.CB, (T0356)D426.CB) [> 3.4818 = 5.8030 < 7.5439] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P48.CB, (T0356)R425.CB) [> 4.7300 = 7.8834 < 10.2484] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P48.CB, (T0356)P423.CB) [> 3.8274 = 6.3790 < 8.2927] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G47.CA, (T0356)K450.CB) [> 2.5487 = 4.2477 < 5.5221] w=0.1664 to align # Constraint # added constraint: constraint((T0356)S449.CB, (T0356)I471.CB) [> 3.0728 = 5.1214 < 6.6578] w=0.1664 to align # Constraint # added constraint: constraint((T0356)Y394.CB, (T0356)R425.CB) [> 3.6957 = 6.1596 < 8.0074] w=0.1664 to align # Constraint # added constraint: constraint((T0356)M383.CB, (T0356)C401.CB) [> 3.7580 = 6.2633 < 8.1423] w=0.1664 to align # Constraint # added constraint: constraint((T0356)T456.CB, (T0356)W467.CB) [> 4.4485 = 7.4142 < 9.6384] w=0.1664 to align # Constraint # added constraint: constraint((T0356)T456.CB, (T0356)R465.CB) [> 2.8438 = 4.7396 < 6.1614] w=0.1664 to align # Constraint # added constraint: constraint((T0356)A455.CB, (T0356)R465.CB) [> 4.2043 = 7.0072 < 9.1093] w=0.1664 to align # Constraint # added constraint: constraint((T0356)D454.CB, (T0356)R469.CB) [> 4.0179 = 6.6966 < 8.7055] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G452.CA, (T0356)I471.CB) [> 3.6933 = 6.1555 < 8.0021] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G452.CA, (T0356)P470.CB) [> 4.5000 = 7.5000 < 9.7500] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G78.CA, (T0356)Y203.CB) [> 3.8824 = 6.4707 < 8.4119] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G78.CA, (T0356)M191.CB) [> 3.5370 = 5.8950 < 7.6635] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G76.CA, (T0356)M191.CB) [> 2.5613 = 4.2688 < 5.5494] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G76.CA, (T0356)I190.CB) [> 4.6512 = 7.7520 < 10.0776] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G76.CA, (T0356)L189.CB) [> 3.6291 = 6.0485 < 7.8630] w=0.1664 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)F104.CB) [> 3.8583 = 6.4306 < 8.3597] w=0.1664 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)V428.CB) [> 4.4940 = 7.4900 < 9.7370] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P70.CB, (T0356)V430.CB) [> 3.8841 = 6.4734 < 8.4155] w=0.1664 to align # Constraint # added constraint: constraint((T0356)P70.CB, (T0356)V428.CB) [> 4.7400 = 7.9001 < 10.2701] w=0.1664 to align # Constraint # added constraint: constraint((T0356)T69.CB, (T0356)L453.CB) [> 4.4975 = 7.4958 < 9.7445] w=0.1664 to align # Constraint # added constraint: constraint((T0356)L189.CB, (T0356)Y203.CB) [> 4.5523 = 7.5872 < 9.8633] w=0.1664 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)I190.CB) [> 4.0765 = 6.7942 < 8.8325] w=0.1664 to align # Constraint # added constraint: constraint((T0356)G177.CA, (T0356)R192.CB) [> 3.2113 = 5.3521 < 6.9578] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F104.CB, (T0356)W193.CB) [> 3.3715 = 5.6192 < 7.3050] w=0.1664 to align # Constraint # added constraint: constraint((T0356)F104.CB, (T0356)M120.CB) [> 3.2712 = 5.4521 < 7.0877] w=0.1664 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)Y321.CB) [> 4.7828 = 7.9713 < 10.3627] w=0.1657 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)W459.CB) [> 4.2315 = 7.0526 < 9.1683] w=0.1639 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)W459.CB) [> 3.7059 = 6.1764 < 8.0294] w=0.1639 to align # Constraint # added constraint: constraint((T0356)F108.CB, (T0356)P357.CB) [> 4.7601 = 7.9335 < 10.3135] w=0.1631 to align # Constraint # added constraint: constraint((T0356)F104.CB, (T0356)P358.CB) [> 4.6171 = 7.6951 < 10.0037] w=0.1631 to align # Constraint # added constraint: constraint((T0356)T122.CB, (T0356)T164.CB) [> 3.2499 = 5.4166 < 7.0415] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L118.CB, (T0356)D353.CB) [> 4.5225 = 7.5375 < 9.7988] w=0.1631 to align # Constraint # added constraint: constraint((T0356)E87.CB, (T0356)F114.CB) [> 3.4747 = 5.7912 < 7.5286] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L91.CB, (T0356)V331.CB) [> 2.3451 = 3.9084 < 5.0809] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L92.CB, (T0356)V331.CB) [> 2.9046 = 4.8410 < 6.2933] w=0.1631 to align # Constraint # added constraint: constraint((T0356)P98.CB, (T0356)L107.CB) [> 4.4000 = 7.3333 < 9.5332] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)H377.CB) [> 2.2676 = 3.7793 < 4.9131] w=0.1631 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)V400.CB) [> 4.6922 = 7.8203 < 10.1664] w=0.1631 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)Y394.CB) [> 4.5554 = 7.5923 < 9.8700] w=0.1631 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)T395.CB) [> 3.6603 = 6.1004 < 7.9306] w=0.1631 to align # Constraint # added constraint: constraint((T0356)M451.CB, (T0356)D482.CB) [> 3.8709 = 6.4516 < 8.3870] w=0.1631 to align # Constraint # added constraint: constraint((T0356)E431.CB, (T0356)A441.CB) [> 1.4638 = 2.4397 < 3.1716] w=0.1631 to align # Constraint # added constraint: constraint((T0356)E431.CB, (T0356)F440.CB) [> 4.0001 = 6.6669 < 8.6670] w=0.1631 to align # Constraint # added constraint: constraint((T0356)V430.CB, (T0356)A441.CB) [> 4.1609 = 6.9348 < 9.0152] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L429.CB, (T0356)A441.CB) [> 3.4491 = 5.7484 < 7.4730] w=0.1631 to align # Constraint # added constraint: constraint((T0356)T122.CB, (T0356)V165.CB) [> 4.2216 = 7.0361 < 9.1469] w=0.1631 to align # Constraint # added constraint: constraint((T0356)R124.CB, (T0356)L163.CB) [> 3.8100 = 6.3500 < 8.2550] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L125.CB, (T0356)L163.CB) [> 3.6106 = 6.0177 < 7.8230] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L125.CB, (T0356)P357.CB) [> 4.1380 = 6.8967 < 8.9658] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L125.CB, (T0356)H377.CB) [> 3.8501 = 6.4169 < 8.3419] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)F354.CB) [> 3.3964 = 5.6607 < 7.3589] w=0.1631 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)D353.CB) [> 3.2278 = 5.3797 < 6.9936] w=0.1631 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)F354.CB) [> 4.2842 = 7.1403 < 9.2824] w=0.1631 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)V352.CB) [> 3.2748 = 5.4580 < 7.0954] w=0.1631 to align # Constraint # added constraint: constraint((T0356)G333.CA, (T0356)T427.CB) [> 4.6251 = 7.7085 < 10.0211] w=0.1631 to align # Constraint # added constraint: constraint((T0356)Y179.CB, (T0356)L194.CB) [> 3.2428 = 5.4047 < 7.0261] w=0.1631 to align # Constraint # added constraint: constraint((T0356)G168.CA, (T0356)I351.CB) [> 4.3797 = 7.2994 < 9.4893] w=0.1631 to align # Constraint # added constraint: constraint((T0356)L429.CB, (T0356)L438.CB) [> 4.0173 = 6.6955 < 8.7042] w=0.1621 to align # Constraint # added constraint: constraint((T0356)V265.CB, (T0356)G293.CA) [> 3.5504 = 5.9173 < 7.6925] w=0.1613 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)L365.CB) [> 3.9253 = 6.5422 < 8.5049] w=0.1603 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)L365.CB) [> 4.3336 = 7.2227 < 9.3895] w=0.1603 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)A366.CB) [> 3.2584 = 5.4306 < 7.0598] w=0.1603 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)Y363.CB) [> 3.5753 = 5.9589 < 7.7465] w=0.1603 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)H377.CB) [> 4.3781 = 7.2969 < 9.4860] w=0.1595 to align # Constraint # added constraint: constraint((T0356)Q373.CB, (T0356)N411.CB) [> 3.3272 = 5.5452 < 7.2088] w=0.1595 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)I417.CB) [> 4.7242 = 7.8736 < 10.2357] w=0.1595 to align # Constraint # added constraint: constraint((T0356)M393.CB, (T0356)G448.CA) [> 2.8470 = 4.7450 < 6.1686] w=0.1595 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)D314.CB) [> 3.6153 = 6.0255 < 7.8332] w=0.1595 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)Y242.CB) [> 4.0472 = 6.7454 < 8.7690] w=0.1595 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)V352.CB) [> 4.7880 = 7.9799 < 10.3739] w=0.1595 to align # Constraint # added constraint: constraint((T0356)D262.CB, (T0356)Q279.CB) [> 3.1987 = 5.3312 < 6.9306] w=0.1595 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)Q279.CB) [> 4.4624 = 7.4374 < 9.6686] w=0.1595 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)G280.CA) [> 3.9056 = 6.5093 < 8.4621] w=0.1595 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)M451.CB) [> 2.4509 = 4.0848 < 5.3102] w=0.1595 to align # Constraint # added constraint: constraint((T0356)T418.CB, (T0356)L488.CB) [> 3.7304 = 6.2173 < 8.0825] w=0.1595 to align # Constraint # added constraint: constraint((T0356)L447.CB, (T0356)L488.CB) [> 3.9544 = 6.5906 < 8.5678] w=0.1595 to align # Constraint # added constraint: constraint((T0356)W415.CB, (T0356)I484.CB) [> 3.9318 = 6.5530 < 8.5189] w=0.1595 to align # Constraint # added constraint: constraint((T0356)I414.CB, (T0356)G452.CA) [> 4.7192 = 7.8654 < 10.2250] w=0.1595 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)T164.CB) [> 2.4777 = 4.1295 < 5.3684] w=0.1590 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)L163.CB) [> 4.0311 = 6.7185 < 8.7340] w=0.1590 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)V73.CB) [> 3.9676 = 6.6126 < 8.5964] w=0.1590 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)L163.CB) [> 3.0610 = 5.1016 < 6.6321] w=0.1590 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)G162.CA) [> 3.9456 = 6.5760 < 8.5488] w=0.1590 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)T164.CB) [> 3.6185 = 6.0308 < 7.8400] w=0.1590 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)G162.CA) [> 2.9384 = 4.8973 < 6.3665] w=0.1590 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)W161.CB) [> 3.7159 = 6.1932 < 8.0512] w=0.1590 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)G162.CA) [> 4.3998 = 7.3330 < 9.5329] w=0.1590 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)W161.CB) [> 3.6556 = 6.0928 < 7.9206] w=0.1590 to align # Constraint # added constraint: constraint((T0356)M60.CB, (T0356)W161.CB) [> 3.2916 = 5.4860 < 7.1318] w=0.1590 to align # Constraint # added constraint: constraint((T0356)N54.CB, (T0356)C64.CB) [> 4.4860 = 7.4766 < 9.7196] w=0.1590 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)N65.CB) [> 4.0447 = 6.7411 < 8.7635] w=0.1590 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)C64.CB) [> 3.5868 = 5.9779 < 7.7713] w=0.1590 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)N65.CB) [> 4.0100 = 6.6832 < 8.6882] w=0.1590 to align # Constraint # added constraint: constraint((T0356)A226.CB, (T0356)E241.CB) [> 3.6078 = 6.0130 < 7.8169] w=0.1590 to align # Constraint # added constraint: constraint((T0356)V88.CB, (T0356)I159.CB) [> 3.9620 = 6.6033 < 8.5843] w=0.1590 to align # Constraint # added constraint: constraint((T0356)A74.CB, (T0356)I159.CB) [> 2.9167 = 4.8611 < 6.3195] w=0.1590 to align # Constraint # added constraint: constraint((T0356)T69.CB, (T0356)G168.CA) [> 3.8671 = 6.4452 < 8.3788] w=0.1590 to align # Constraint # added constraint: constraint((T0356)T69.CB, (T0356)R167.CB) [> 3.7477 = 6.2461 < 8.1200] w=0.1590 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)G168.CA) [> 4.3885 = 7.3141 < 9.5084] w=0.1590 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)R167.CB) [> 4.0710 = 6.7849 < 8.8204] w=0.1590 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)T166.CB) [> 3.6642 = 6.1070 < 7.9391] w=0.1590 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)V165.CB) [> 3.6398 = 6.0664 < 7.8863] w=0.1590 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)V165.CB) [> 4.1639 = 6.9398 < 9.0217] w=0.1590 to align # Constraint # added constraint: constraint((T0356)L9.CB, (T0356)M120.CB) [> 4.0876 = 6.8127 < 8.8565] w=0.1580 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)I417.CB) [> 3.7602 = 6.2670 < 8.1470] w=0.1564 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)M451.CB) [> 3.7274 = 6.2124 < 8.0761] w=0.1564 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)V256.CB) [> 2.4739 = 4.1232 < 5.3602] w=0.1531 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)K257.CB) [> 4.7359 = 7.8932 < 10.2611] w=0.1531 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)C258.CB) [> 2.9186 = 4.8643 < 6.3236] w=0.1531 to align # Constraint # added constraint: constraint((T0356)P236.CB, (T0356)E328.CB) [> 4.1102 = 6.8503 < 8.9054] w=0.1531 to align # Constraint # added constraint: constraint((T0356)P236.CB, (T0356)H291.CB) [> 4.4290 = 7.3817 < 9.5962] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V235.CB, (T0356)A330.CB) [> 4.3046 = 7.1744 < 9.3267] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V235.CB, (T0356)H291.CB) [> 2.4803 = 4.1338 < 5.3740] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V235.CB, (T0356)D290.CB) [> 4.4526 = 7.4209 < 9.6472] w=0.1531 to align # Constraint # added constraint: constraint((T0356)P234.CB, (T0356)A330.CB) [> 3.3744 = 5.6241 < 7.3113] w=0.1531 to align # Constraint # added constraint: constraint((T0356)P234.CB, (T0356)H291.CB) [> 4.6674 = 7.7791 < 10.1128] w=0.1531 to align # Constraint # added constraint: constraint((T0356)T233.CB, (T0356)V331.CB) [> 4.7218 = 7.8696 < 10.2305] w=0.1531 to align # Constraint # added constraint: constraint((T0356)T233.CB, (T0356)A330.CB) [> 2.4135 = 4.0226 < 5.2293] w=0.1531 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)D290.CB) [> 4.4128 = 7.3548 < 9.5612] w=0.1531 to align # Constraint # added constraint: constraint((T0356)K257.CB, (T0356)V303.CB) [> 3.6892 = 6.1487 < 7.9933] w=0.1531 to align # Constraint # added constraint: constraint((T0356)K257.CB, (T0356)V298.CB) [> 3.5724 = 5.9540 < 7.7402] w=0.1531 to align # Constraint # added constraint: constraint((T0356)K257.CB, (T0356)Y295.CB) [> 3.9110 = 6.5183 < 8.4738] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)V298.CB) [> 4.1223 = 6.8706 < 8.9317] w=0.1531 to align # Constraint # added constraint: constraint((T0356)L247.CB, (T0356)V256.CB) [> 3.4345 = 5.7242 < 7.4415] w=0.1531 to align # Constraint # added constraint: constraint((T0356)G246.CA, (T0356)V256.CB) [> 4.0613 = 6.7689 < 8.7996] w=0.1531 to align # Constraint # added constraint: constraint((T0356)T233.CB, (T0356)H291.CB) [> 4.2394 = 7.0656 < 9.1853] w=0.1531 to align # Constraint # added constraint: constraint((T0356)T233.CB, (T0356)D290.CB) [> 2.9886 = 4.9810 < 6.4753] w=0.1531 to align # Constraint # added constraint: constraint((T0356)T233.CB, (T0356)I259.CB) [> 4.2182 = 7.0303 < 9.1393] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)I259.CB) [> 4.0369 = 6.7282 < 8.7466] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)L365.CB) [> 4.6106 = 7.6844 < 9.9897] w=0.1531 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)A366.CB) [> 3.5551 = 5.9252 < 7.7028] w=0.1531 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)L365.CB) [> 4.2991 = 7.1652 < 9.3147] w=0.1531 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)R364.CB) [> 3.5482 = 5.9137 < 7.6878] w=0.1531 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)Y317.CB) [> 4.0759 = 6.7932 < 8.8312] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)L365.CB) [> 4.0733 = 6.7889 < 8.8255] w=0.1531 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)L356.CB) [> 4.6504 = 7.7506 < 10.0758] w=0.1531 to align # Constraint # added constraint: constraint((T0356)P302.CB, (T0356)H318.CB) [> 4.0495 = 6.7491 < 8.7738] w=0.1531 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)L356.CB) [> 4.7330 = 7.8884 < 10.2549] w=0.1531 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)L356.CB) [> 3.6014 = 6.0023 < 7.8030] w=0.1531 to align # Constraint # added constraint: constraint((T0356)D314.CB, (T0356)H377.CB) [> 3.9537 = 6.5895 < 8.5663] w=0.1531 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)L356.CB) [> 3.7831 = 6.3052 < 8.1968] w=0.1531 to align # Constraint # added constraint: constraint((T0356)H291.CB, (T0356)A330.CB) [> 4.2203 = 7.0338 < 9.1439] w=0.1531 to align # Constraint # added constraint: constraint((T0356)D290.CB, (T0356)A330.CB) [> 2.5234 = 4.2057 < 5.4675] w=0.1531 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)G293.CA) [> 2.6405 = 4.4009 < 5.7212] w=0.1531 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)T292.CB) [> 4.7431 = 7.9051 < 10.2767] w=0.1531 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)H291.CB) [> 4.7769 = 7.9615 < 10.3500] w=0.1531 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)D290.CB) [> 3.4036 = 5.6726 < 7.3744] w=0.1531 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)L125.CB) [> 3.1042 = 5.1737 < 6.7258] w=0.1524 to align # Constraint # added constraint: constraint((T0356)C130.CB, (T0356)P225.CB) [> 3.9661 = 6.6101 < 8.5932] w=0.1524 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)P287.CB) [> 3.8088 = 6.3481 < 8.2525] w=0.1524 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)Y321.CB) [> 3.2935 = 5.4891 < 7.1358] w=0.1524 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)T322.CB) [> 3.0219 = 5.0365 < 6.5474] w=0.1524 to align # Constraint # added constraint: constraint((T0356)H291.CB, (T0356)R324.CB) [> 4.5488 = 7.5814 < 9.8558] w=0.1524 to align # Constraint # added constraint: constraint((T0356)T292.CB, (T0356)R324.CB) [> 3.7125 = 6.1875 < 8.0437] w=0.1524 to align # Constraint # added constraint: constraint((T0356)G293.CA, (T0356)P325.CB) [> 4.2938 = 7.1564 < 9.3033] w=0.1524 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)R312.CB) [> 3.2783 = 5.4638 < 7.1030] w=0.1500 to align # Constraint # added constraint: constraint((T0356)E264.CB, (T0356)T310.CB) [> 3.6395 = 6.0657 < 7.8855] w=0.1500 to align # Constraint # added constraint: constraint((T0356)E264.CB, (T0356)Q311.CB) [> 2.7572 = 4.5954 < 5.9740] w=0.1500 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)Y355.CB) [> 2.6254 = 4.3756 < 5.6883] w=0.1491 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)F354.CB) [> 4.3115 = 7.1858 < 9.3415] w=0.1491 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)D353.CB) [> 4.4588 = 7.4313 < 9.6608] w=0.1491 to align # Constraint # added constraint: constraint((T0356)L16.CB, (T0356)K133.CB) [> 4.7970 = 7.9950 < 10.3935] w=0.1491 to align # Constraint # added constraint: constraint((T0356)L15.CB, (T0356)G76.CA) [> 4.5859 = 7.6432 < 9.9361] w=0.1491 to align # Constraint # added constraint: constraint((T0356)F12.CB, (T0356)V88.CB) [> 3.8227 = 6.3712 < 8.2825] w=0.1491 to align # Constraint # added constraint: constraint((T0356)F12.CB, (T0356)M77.CB) [> 3.9605 = 6.6008 < 8.5811] w=0.1491 to align # Constraint # added constraint: constraint((T0356)S195.CB, (T0356)V352.CB) [> 4.0443 = 6.7406 < 8.7627] w=0.1491 to align # Constraint # added constraint: constraint((T0356)T42.CB, (T0356)M60.CB) [> 3.0081 = 5.0135 < 6.5175] w=0.1471 to align # Constraint # added constraint: constraint((T0356)E21.CB, (T0356)R72.CB) [> 3.7304 = 6.2173 < 8.0825] w=0.1452 to align # Constraint # added constraint: constraint((T0356)L22.CB, (T0356)V73.CB) [> 3.4447 = 5.7411 < 7.4634] w=0.1452 to align # Constraint # added constraint: constraint((T0356)R24.CB, (T0356)L63.CB) [> 3.9775 = 6.6292 < 8.6180] w=0.1452 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)F397.CB) [> 3.9678 = 6.6130 < 8.5969] w=0.1442 to align # Constraint # added constraint: constraint((T0356)R167.CB, (T0356)A223.CB) [> 3.7066 = 6.1777 < 8.0310] w=0.1411 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)V219.CB) [> 4.5942 = 7.6569 < 9.9540] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)V256.CB) [> 4.6091 = 7.6818 < 9.9863] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)S218.CB) [> 3.2195 = 5.3658 < 6.9756] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)V217.CB) [> 3.1023 = 5.1705 < 6.7216] w=0.1411 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)V256.CB) [> 3.8784 = 6.4640 < 8.4033] w=0.1411 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)V256.CB) [> 4.4700 = 7.4501 < 9.6851] w=0.1411 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)C258.CB) [> 2.7355 = 4.5591 < 5.9269] w=0.1411 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)K257.CB) [> 3.5209 = 5.8681 < 7.6286] w=0.1411 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)V256.CB) [> 2.8582 = 4.7636 < 6.1927] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I159.CB, (T0356)C258.CB) [> 3.2720 = 5.4533 < 7.0893] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L158.CB, (T0356)I259.CB) [> 3.4979 = 5.8299 < 7.5788] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L158.CB, (T0356)C258.CB) [> 3.3320 = 5.5534 < 7.2194] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)Q311.CB) [> 4.2695 = 7.1158 < 9.2506] w=0.1411 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)F244.CB) [> 3.7807 = 6.3011 < 8.1915] w=0.1411 to align # Constraint # added constraint: constraint((T0356)A226.CB, (T0356)A243.CB) [> 4.1904 = 6.9839 < 9.0791] w=0.1411 to align # Constraint # added constraint: constraint((T0356)A226.CB, (T0356)Y242.CB) [> 3.4794 = 5.7990 < 7.5388] w=0.1411 to align # Constraint # added constraint: constraint((T0356)P225.CB, (T0356)Y242.CB) [> 3.8519 = 6.4199 < 8.3459] w=0.1411 to align # Constraint # added constraint: constraint((T0356)A200.CB, (T0356)T227.CB) [> 4.4193 = 7.3654 < 9.5751] w=0.1411 to align # Constraint # added constraint: constraint((T0356)Q174.CB, (T0356)G185.CA) [> 2.7994 = 4.6657 < 6.0654] w=0.1411 to align # Constraint # added constraint: constraint((T0356)P169.CB, (T0356)T227.CB) [> 4.1125 = 6.8542 < 8.9104] w=0.1411 to align # Constraint # added constraint: constraint((T0356)P169.CB, (T0356)A223.CB) [> 4.2685 = 7.1142 < 9.2484] w=0.1411 to align # Constraint # added constraint: constraint((T0356)P169.CB, (T0356)G222.CA) [> 4.0863 = 6.8105 < 8.8537] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I35.CB, (T0356)E53.CB) [> 4.0607 = 6.7678 < 8.7982] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L33.CB, (T0356)M383.CB) [> 4.0807 = 6.8012 < 8.8416] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L33.CB, (T0356)S268.CB) [> 4.2194 = 7.0323 < 9.1420] w=0.1411 to align # Constraint # added constraint: constraint((T0356)P31.CB, (T0356)S268.CB) [> 4.0781 = 6.7968 < 8.8358] w=0.1411 to align # Constraint # added constraint: constraint((T0356)V29.CB, (T0356)N54.CB) [> 4.1304 = 6.8840 < 8.9492] w=0.1411 to align # Constraint # added constraint: constraint((T0356)E17.CB, (T0356)G47.CA) [> 4.3525 = 7.2542 < 9.4304] w=0.1411 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)A223.CB) [> 2.9823 = 4.9705 < 6.4617] w=0.1411 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)G222.CA) [> 4.5958 = 7.6597 < 9.9576] w=0.1411 to align # Constraint # added constraint: constraint((T0356)N54.CB, (T0356)L66.CB) [> 3.3499 = 5.5832 < 7.2581] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)V219.CB) [> 4.7851 = 7.9752 < 10.3678] w=0.1411 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)S59.CB) [> 4.6092 = 7.6820 < 9.9866] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)V430.CB) [> 4.3771 = 7.2951 < 9.4837] w=0.1411 to align # Constraint # added constraint: constraint((T0356)A407.CB, (T0356)E431.CB) [> 4.2464 = 7.0773 < 9.2005] w=0.1411 to align # Constraint # added constraint: constraint((T0356)A407.CB, (T0356)V430.CB) [> 4.5481 = 7.5801 < 9.8541] w=0.1411 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)E431.CB) [> 3.3693 = 5.6155 < 7.3001] w=0.1411 to align # Constraint # added constraint: constraint((T0356)M383.CB, (T0356)R420.CB) [> 4.5428 = 7.5713 < 9.8427] w=0.1411 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)A407.CB) [> 4.3797 = 7.2996 < 9.4895] w=0.1411 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)E431.CB) [> 4.6190 = 7.6983 < 10.0078] w=0.1411 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)A407.CB) [> 4.5990 = 7.6651 < 9.9646] w=0.1411 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)E431.CB) [> 3.8017 = 6.3362 < 8.2370] w=0.1411 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)V400.CB) [> 2.8584 = 4.7639 < 6.1931] w=0.1411 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)I399.CB) [> 3.5873 = 5.9788 < 7.7724] w=0.1411 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)V398.CB) [> 3.5102 = 5.8504 < 7.6055] w=0.1411 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)I399.CB) [> 3.7081 = 6.1801 < 8.0341] w=0.1411 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)V398.CB) [> 3.5691 = 5.9486 < 7.7332] w=0.1411 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)Q391.CB) [> 3.3574 = 5.5957 < 7.2744] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)L429.CB) [> 3.8864 = 6.4773 < 8.4205] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)I399.CB) [> 3.7599 = 6.2664 < 8.1464] w=0.1411 to align # Constraint # added constraint: constraint((T0356)D436.CB, (T0356)N457.CB) [> 2.5626 = 4.2710 < 5.5523] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I435.CB, (T0356)N457.CB) [> 3.0984 = 5.1639 < 6.7131] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I435.CB, (T0356)A455.CB) [> 3.8459 = 6.4098 < 8.3328] w=0.1411 to align # Constraint # added constraint: constraint((T0356)P434.CB, (T0356)T456.CB) [> 3.2566 = 5.4277 < 7.0560] w=0.1411 to align # Constraint # added constraint: constraint((T0356)P434.CB, (T0356)D454.CB) [> 2.9618 = 4.9364 < 6.4173] w=0.1411 to align # Constraint # added constraint: constraint((T0356)V430.CB, (T0356)M451.CB) [> 3.0986 = 5.1644 < 6.7137] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)V398.CB) [> 3.6851 = 6.1419 < 7.9844] w=0.1411 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)Q391.CB) [> 3.4471 = 5.7451 < 7.4686] w=0.1411 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)L429.CB) [> 4.6519 = 7.7532 < 10.0791] w=0.1411 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)V352.CB) [> 4.6157 = 7.6928 < 10.0006] w=0.1411 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)V352.CB) [> 3.8319 = 6.3865 < 8.3025] w=0.1411 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)D353.CB) [> 4.1561 = 6.9269 < 9.0050] w=0.1411 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)F354.CB) [> 3.1842 = 5.3070 < 6.8991] w=0.1411 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)Y355.CB) [> 3.4431 = 5.7385 < 7.4601] w=0.1411 to align # Constraint # added constraint: constraint((T0356)A74.CB, (T0356)V88.CB) [> 3.3703 = 5.6172 < 7.3024] w=0.1395 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)E87.CB) [> 3.3908 = 5.6513 < 7.3466] w=0.1395 to align # Constraint # added constraint: constraint((T0356)R72.CB, (T0356)E87.CB) [> 3.9831 = 6.6385 < 8.6301] w=0.1395 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)P61.CB) [> 3.8113 = 6.3522 < 8.2578] w=0.1395 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)P61.CB) [> 4.1061 = 6.8435 < 8.8965] w=0.1395 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)L66.CB) [> 3.9676 = 6.6127 < 8.5965] w=0.1395 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)R192.CB) [> 3.5550 = 5.9250 < 7.7025] w=0.1395 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)I190.CB) [> 3.8290 = 6.3817 < 8.2962] w=0.1395 to align # Constraint # added constraint: constraint((T0356)I159.CB, (T0356)M191.CB) [> 3.6723 = 6.1205 < 7.9566] w=0.1395 to align # Constraint # added constraint: constraint((T0356)L158.CB, (T0356)L194.CB) [> 3.9942 = 6.6570 < 8.6540] w=0.1395 to align # Constraint # added constraint: constraint((T0356)L158.CB, (T0356)W193.CB) [> 4.5921 = 7.6535 < 9.9495] w=0.1395 to align # Constraint # added constraint: constraint((T0356)P157.CB, (T0356)W193.CB) [> 3.3029 = 5.5049 < 7.1563] w=0.1395 to align # Constraint # added constraint: constraint((T0356)A156.CB, (T0356)S195.CB) [> 4.4419 = 7.4032 < 9.6241] w=0.1395 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)V82.CB) [> 2.9876 = 4.9793 < 6.4731] w=0.1386 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)V255.CB) [> 4.7264 = 7.8773 < 10.2405] w=0.1386 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)V256.CB) [> 4.0464 = 6.7440 < 8.7672] w=0.1386 to align # Constraint # added constraint: constraint((T0356)D224.CB, (T0356)G323.CA) [> 3.9992 = 6.6653 < 8.6649] w=0.1386 to align # Constraint # added constraint: constraint((T0356)G246.CA, (T0356)V255.CB) [> 3.6647 = 6.1079 < 7.9402] w=0.1386 to align # Constraint # added constraint: constraint((T0356)Q182.CB, (T0356)V219.CB) [> 4.3712 = 7.2853 < 9.4709] w=0.1365 to align # Constraint # added constraint: constraint((T0356)Q182.CB, (T0356)R192.CB) [> 4.6657 = 7.7762 < 10.1091] w=0.1365 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)F304.CB) [> 4.6907 = 7.8178 < 10.1632] w=0.1365 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)A245.CB) [> 2.6837 = 4.4728 < 5.8147] w=0.1365 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)S268.CB) [> 4.3502 = 7.2503 < 9.4253] w=0.1365 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)F304.CB) [> 2.6362 = 4.3936 < 5.7117] w=0.1365 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)T305.CB) [> 3.6438 = 6.0730 < 7.8949] w=0.1365 to align # Constraint # added constraint: constraint((T0356)Y276.CB, (T0356)F304.CB) [> 3.3875 = 5.6459 < 7.3397] w=0.1365 to align # Constraint # added constraint: constraint((T0356)Y276.CB, (T0356)T305.CB) [> 2.9162 = 4.8603 < 6.3184] w=0.1365 to align # Constraint # added constraint: constraint((T0356)E278.CB, (T0356)F304.CB) [> 3.2593 = 5.4322 < 7.0618] w=0.1365 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)T122.CB) [> 3.5770 = 5.9616 < 7.7501] w=0.1345 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)T122.CB) [> 3.9987 = 6.6645 < 8.6638] w=0.1345 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)V219.CB) [> 4.5198 = 7.5329 < 9.7928] w=0.1345 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)L125.CB) [> 4.2927 = 7.1544 < 9.3008] w=0.1345 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)V219.CB) [> 3.6477 = 6.0795 < 7.9034] w=0.1345 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)L125.CB) [> 2.6349 = 4.3915 < 5.7089] w=0.1345 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)F354.CB) [> 3.7155 = 6.1925 < 8.0503] w=0.1345 to align # Constraint # added constraint: constraint((T0356)P121.CB, (T0356)L176.CB) [> 4.0104 = 6.6841 < 8.6893] w=0.1342 to align # Constraint # added constraint: constraint((T0356)D403.CB, (T0356)A455.CB) [> 3.4655 = 5.7759 < 7.5086] w=0.1329 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)A455.CB) [> 4.0089 = 6.6815 < 8.6859] w=0.1329 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)D454.CB) [> 4.3124 = 7.1874 < 9.3436] w=0.1329 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)R364.CB) [> 4.4911 = 7.4852 < 9.7308] w=0.1316 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)A455.CB) [> 4.1131 = 6.8552 < 8.9117] w=0.1298 to align # Constraint # added constraint: constraint((T0356)T36.CB, (T0356)L85.CB) [> 3.2179 = 5.3632 < 6.9722] w=0.1294 to align # Constraint # added constraint: constraint((T0356)V232.CB, (T0356)A245.CB) [> 3.6547 = 6.0911 < 7.9185] w=0.1294 to align # Constraint # added constraint: constraint((T0356)V232.CB, (T0356)F244.CB) [> 3.5125 = 5.8542 < 7.6104] w=0.1294 to align # Constraint # added constraint: constraint((T0356)V232.CB, (T0356)Y242.CB) [> 3.1705 = 5.2842 < 6.8695] w=0.1294 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)V232.CB) [> 2.7343 = 4.5571 < 5.9243] w=0.1294 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)L438.CB) [> 3.8980 = 6.4967 < 8.4457] w=0.1292 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)Y437.CB) [> 4.0265 = 6.7109 < 8.7241] w=0.1292 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)L438.CB) [> 2.9924 = 4.9873 < 6.4835] w=0.1292 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)F440.CB) [> 4.0042 = 6.6737 < 8.6758] w=0.1292 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)D290.CB) [> 4.7263 = 7.8772 < 10.2403] w=0.1279 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)I351.CB) [> 4.6824 = 7.8040 < 10.1451] w=0.1279 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)G289.CA) [> 3.0413 = 5.0688 < 6.5894] w=0.1279 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)D290.CB) [> 3.7323 = 6.2205 < 8.0866] w=0.1279 to align # Constraint # added constraint: constraint((T0356)I228.CB, (T0356)G289.CA) [> 4.2028 = 7.0047 < 9.1061] w=0.1279 to align # Constraint # added constraint: constraint((T0356)G230.CA, (T0356)Y295.CB) [> 4.6161 = 7.6936 < 10.0016] w=0.1279 to align # Constraint # added constraint: constraint((T0356)H196.CB, (T0356)P225.CB) [> 3.1276 = 5.2127 < 6.7766] w=0.1279 to align # Constraint # added constraint: constraint((T0356)D290.CB, (T0356)L356.CB) [> 4.2269 = 7.0449 < 9.1584] w=0.1279 to align # Constraint # added constraint: constraint((T0356)D290.CB, (T0356)Y355.CB) [> 4.6905 = 7.8175 < 10.1628] w=0.1279 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)I351.CB) [> 4.5349 = 7.5581 < 9.8256] w=0.1279 to align # Constraint # added constraint: constraint((T0356)A245.CB, (T0356)E285.CB) [> 2.9009 = 4.8349 < 6.2854] w=0.1279 to align # Constraint # added constraint: constraint((T0356)G246.CA, (T0356)T282.CB) [> 4.2169 = 7.0282 < 9.1366] w=0.1279 to align # Constraint # added constraint: constraint((T0356)G246.CA, (T0356)E285.CB) [> 2.2684 = 3.7807 < 4.9149] w=0.1279 to align # Constraint # added constraint: constraint((T0356)Y288.CB, (T0356)V385.CB) [> 4.0153 = 6.6921 < 8.6998] w=0.1279 to align # Constraint # added constraint: constraint((T0356)Y288.CB, (T0356)F388.CB) [> 3.5760 = 5.9600 < 7.7480] w=0.1279 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)V398.CB) [> 4.1822 = 6.9704 < 9.0615] w=0.1261 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)V398.CB) [> 3.3720 = 5.6201 < 7.3061] w=0.1261 to align # Constraint # added constraint: constraint((T0356)F244.CB, (T0356)V367.CB) [> 3.4346 = 5.7243 < 7.4416] w=0.1261 to align # Constraint # added constraint: constraint((T0356)P236.CB, (T0356)A378.CB) [> 4.0984 = 6.8306 < 8.8798] w=0.1261 to align # Constraint # added constraint: constraint((T0356)P236.CB, (T0356)H377.CB) [> 3.7959 = 6.3264 < 8.2244] w=0.1261 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)V367.CB) [> 2.8916 = 4.8193 < 6.2651] w=0.1261 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)V367.CB) [> 4.2953 = 7.1589 < 9.3065] w=0.1261 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)V367.CB) [> 4.0714 = 6.7857 < 8.8214] w=0.1261 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)V430.CB) [> 4.6674 = 7.7790 < 10.1127] w=0.1261 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)M382.CB) [> 3.1789 = 5.2982 < 6.8876] w=0.1246 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)L356.CB) [> 4.2146 = 7.0243 < 9.1316] w=0.1237 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)L63.CB) [> 3.8435 = 6.4058 < 8.3275] w=0.1216 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)C64.CB) [> 3.4872 = 5.8120 < 7.5555] w=0.1216 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)T164.CB) [> 3.5922 = 5.9870 < 7.7831] w=0.1216 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)T164.CB) [> 3.8043 = 6.3405 < 8.2426] w=0.1216 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)V367.CB) [> 4.2846 = 7.1410 < 9.2833] w=0.1210 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)K495.CB) [> 4.6254 = 7.7090 < 10.0217] w=0.1210 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)V368.CB) [> 4.4063 = 7.3439 < 9.5471] w=0.1210 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)L365.CB) [> 3.5555 = 5.9259 < 7.7036] w=0.1210 to align # Constraint # added constraint: constraint((T0356)V334.CB, (T0356)P460.CB) [> 4.4840 = 7.4732 < 9.7152] w=0.1210 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)F491.CB) [> 3.3850 = 5.6417 < 7.3342] w=0.1210 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)I490.CB) [> 3.9988 = 6.6647 < 8.6642] w=0.1210 to align # Constraint # added constraint: constraint((T0356)M383.CB, (T0356)A489.CB) [> 4.6057 = 7.6762 < 9.9790] w=0.1210 to align # Constraint # added constraint: constraint((T0356)T433.CB, (T0356)W467.CB) [> 3.1321 = 5.2202 < 6.7863] w=0.1210 to align # Constraint # added constraint: constraint((T0356)A335.CB, (T0356)D439.CB) [> 3.3388 = 5.5646 < 7.2340] w=0.1210 to align # Constraint # added constraint: constraint((T0356)V339.CB, (T0356)D439.CB) [> 3.9707 = 6.6178 < 8.6032] w=0.1210 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)F304.CB) [> 4.2867 = 7.1444 < 9.2877] w=0.1179 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)K396.CB) [> 3.9647 = 6.6078 < 8.5901] w=0.1173 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)T395.CB) [> 3.8153 = 6.3588 < 8.2664] w=0.1173 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)K396.CB) [> 2.8178 = 4.6963 < 6.1052] w=0.1173 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)T395.CB) [> 4.3329 = 7.2215 < 9.3879] w=0.1173 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)K396.CB) [> 4.1799 = 6.9665 < 9.0564] w=0.1173 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)T395.CB) [> 2.6554 = 4.4257 < 5.7533] w=0.1173 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)Y394.CB) [> 3.9320 = 6.5533 < 8.5193] w=0.1173 to align # Constraint # added constraint: constraint((T0356)Y363.CB, (T0356)Y394.CB) [> 3.4430 = 5.7383 < 7.4598] w=0.1173 to align # Constraint # added constraint: constraint((T0356)W415.CB, (T0356)N432.CB) [> 4.5002 = 7.5004 < 9.7505] w=0.1173 to align # Constraint # added constraint: constraint((T0356)I414.CB, (T0356)F440.CB) [> 4.4455 = 7.4092 < 9.6320] w=0.1173 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)L438.CB) [> 3.7262 = 6.2102 < 8.0733] w=0.1173 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)Y437.CB) [> 4.3878 = 7.3130 < 9.5069] w=0.1173 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)Y437.CB) [> 3.5302 = 5.8836 < 7.6487] w=0.1173 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)D436.CB) [> 3.3702 = 5.6170 < 7.3020] w=0.1173 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)D436.CB) [> 3.2900 = 5.4833 < 7.1282] w=0.1173 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)P434.CB) [> 3.6795 = 6.1325 < 7.9723] w=0.1173 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)P434.CB) [> 3.6118 = 6.0197 < 7.8256] w=0.1173 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)F354.CB) [> 3.6020 = 6.0033 < 7.8043] w=0.1171 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)T122.CB) [> 4.3592 = 7.2653 < 9.4450] w=0.1150 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)M382.CB) [> 4.1786 = 6.9643 < 9.0536] w=0.1145 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)S319.CB) [> 3.5178 = 5.8630 < 7.6219] w=0.1140 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)S319.CB) [> 3.5708 = 5.9513 < 7.7367] w=0.1140 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)T320.CB) [> 3.9082 = 6.5137 < 8.4678] w=0.1140 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)T320.CB) [> 3.4191 = 5.6984 < 7.4080] w=0.1140 to align # Constraint # added constraint: constraint((T0356)G293.CA, (T0356)T307.CB) [> 3.8972 = 6.4954 < 8.4440] w=0.1129 to align # Constraint # added constraint: constraint((T0356)G293.CA, (T0356)V306.CB) [> 3.6898 = 6.1497 < 7.9946] w=0.1129 to align # Constraint # added constraint: constraint((T0356)T292.CB, (T0356)V306.CB) [> 3.8769 = 6.4616 < 8.4000] w=0.1129 to align # Constraint # added constraint: constraint((T0356)P434.CB, (T0356)P460.CB) [> 3.3219 = 5.5364 < 7.1974] w=0.1104 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)K458.CB) [> 3.5411 = 5.9018 < 7.6723] w=0.1092 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)K458.CB) [> 4.0961 = 6.8268 < 8.8749] w=0.1092 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)W459.CB) [> 3.6679 = 6.1132 < 7.9472] w=0.1092 to align # Constraint # added constraint: constraint((T0356)L332.CB, (T0356)V385.CB) [> 4.0984 = 6.8306 < 8.8798] w=0.1092 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)A366.CB) [> 4.3909 = 7.3182 < 9.5136] w=0.1092 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)L365.CB) [> 2.8420 = 4.7367 < 6.1577] w=0.1092 to align # Constraint # added constraint: constraint((T0356)T307.CB, (T0356)Y321.CB) [> 4.6645 = 7.7742 < 10.1065] w=0.1092 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)V368.CB) [> 4.3425 = 7.2376 < 9.4088] w=0.1092 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)V367.CB) [> 4.6389 = 7.7315 < 10.0510] w=0.1092 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)V367.CB) [> 3.1901 = 5.3168 < 6.9119] w=0.1092 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)A366.CB) [> 4.4307 = 7.3846 < 9.5999] w=0.1092 to align # Constraint # added constraint: constraint((T0356)V385.CB, (T0356)K458.CB) [> 3.5524 = 5.9206 < 7.6968] w=0.1092 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)K458.CB) [> 2.5498 = 4.2497 < 5.5246] w=0.1092 to align # Constraint # added constraint: constraint((T0356)L332.CB, (T0356)F392.CB) [> 4.4203 = 7.3672 < 9.5774] w=0.1092 to align # Constraint # added constraint: constraint((T0356)L125.CB, (T0356)W161.CB) [> 2.6442 = 4.4070 < 5.7291] w=0.1087 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)H377.CB) [> 2.8918 = 4.8196 < 6.2655] w=0.1087 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)V352.CB) [> 3.3695 = 5.6159 < 7.3007] w=0.1087 to align # Constraint # added constraint: constraint((T0356)P98.CB, (T0356)V272.CB) [> 4.0758 = 6.7930 < 8.8309] w=0.1087 to align # Constraint # added constraint: constraint((T0356)G293.CA, (T0356)P302.CB) [> 4.5508 = 7.5848 < 9.8602] w=0.1087 to align # Constraint # added constraint: constraint((T0356)G293.CA, (T0356)V303.CB) [> 3.7873 = 6.3121 < 8.2057] w=0.1087 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)D353.CB) [> 4.5658 = 7.6096 < 9.8925] w=0.1087 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)Y355.CB) [> 4.3497 = 7.2495 < 9.4243] w=0.1087 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)G384.CA) [> 4.5750 = 7.6251 < 9.9126] w=0.1087 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)V385.CB) [> 3.8242 = 6.3737 < 8.2858] w=0.1087 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)V352.CB) [> 3.9175 = 6.5291 < 8.4878] w=0.1087 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)I351.CB) [> 4.7078 = 7.8464 < 10.2003] w=0.1087 to align # Constraint # added constraint: constraint((T0356)Q174.CB, (T0356)I351.CB) [> 4.6647 = 7.7745 < 10.1069] w=0.1087 to align # Constraint # added constraint: constraint((T0356)E264.CB, (T0356)Q279.CB) [> 2.9731 = 4.9552 < 6.4418] w=0.1063 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)Y317.CB) [> 3.2769 = 5.4615 < 7.1000] w=0.1063 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)Y355.CB) [> 4.7551 = 7.9251 < 10.3026] w=0.1063 to align # Constraint # added constraint: constraint((T0356)S449.CB, (T0356)I490.CB) [> 3.2574 = 5.4290 < 7.0577] w=0.1063 to align # Constraint # added constraint: constraint((T0356)I417.CB, (T0356)I490.CB) [> 4.0526 = 6.7543 < 8.7806] w=0.1063 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)I414.CB) [> 4.6006 = 7.6676 < 9.9679] w=0.1063 to align # Constraint # added constraint: constraint((T0356)D403.CB, (T0356)L453.CB) [> 3.5916 = 5.9860 < 7.7818] w=0.1063 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)V368.CB) [> 3.7219 = 6.2031 < 8.0641] w=0.1056 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)V367.CB) [> 4.4974 = 7.4956 < 9.7443] w=0.1056 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)V367.CB) [> 4.1692 = 6.9486 < 9.0332] w=0.1056 to align # Constraint # added constraint: constraint((T0356)V255.CB, (T0356)G275.CA) [> 4.2939 = 7.1564 < 9.3034] w=0.1044 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)R192.CB) [> 4.1319 = 6.8864 < 8.9524] w=0.1020 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)R192.CB) [> 4.5826 = 7.6376 < 9.9289] w=0.1020 to align # Constraint # added constraint: constraint((T0356)Q19.CB, (T0356)K188.CB) [> 3.6503 = 6.0839 < 7.9090] w=0.1020 to align # Constraint # added constraint: constraint((T0356)Q19.CB, (T0356)L189.CB) [> 3.5988 = 5.9979 < 7.7973] w=0.1020 to align # Constraint # added constraint: constraint((T0356)L22.CB, (T0356)V117.CB) [> 3.2221 = 5.3702 < 6.9812] w=0.1020 to align # Constraint # added constraint: constraint((T0356)L27.CB, (T0356)I190.CB) [> 4.4675 = 7.4458 < 9.6795] w=0.1020 to align # Constraint # added constraint: constraint((T0356)G57.CA, (T0356)P121.CB) [> 4.2345 = 7.0574 < 9.1747] w=0.1020 to align # Constraint # added constraint: constraint((T0356)V255.CB, (T0356)L365.CB) [> 4.0630 = 6.7718 < 8.8033] w=0.1020 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)M382.CB) [> 4.7743 = 7.9572 < 10.3444] w=0.1020 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)L163.CB) [> 4.0097 = 6.6829 < 8.6877] w=0.1011 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)L163.CB) [> 4.5335 = 7.5558 < 9.8225] w=0.1011 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)G162.CA) [> 3.4307 = 5.7179 < 7.4332] w=0.1011 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)L163.CB) [> 2.4733 = 4.1221 < 5.3587] w=0.1011 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)V82.CB) [> 3.8799 = 6.4666 < 8.4065] w=0.1011 to align # Constraint # added constraint: constraint((T0356)M120.CB, (T0356)Q131.CB) [> 4.7018 = 7.8363 < 10.1872] w=0.0994 to align # Constraint # added constraint: constraint((T0356)L142.CB, (T0356)R173.CB) [> 2.8579 = 4.7631 < 6.1921] w=0.0994 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)Y317.CB) [> 3.6416 = 6.0693 < 7.8901] w=0.0994 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)S319.CB) [> 3.8540 = 6.4233 < 8.3503] w=0.0994 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)R192.CB) [> 4.2725 = 7.1208 < 9.2571] w=0.0973 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)R192.CB) [> 2.7466 = 4.5777 < 5.9510] w=0.0973 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)N406.CB) [> 2.9248 = 4.8748 < 6.3372] w=0.0973 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)C401.CB) [> 4.2677 = 7.1128 < 9.2466] w=0.0971 to align # Constraint # added constraint: constraint((T0356)K23.CB, (T0356)C64.CB) [> 4.0348 = 6.7246 < 8.7420] w=0.0968 to align # Constraint # added constraint: constraint((T0356)L22.CB, (T0356)C64.CB) [> 3.1586 = 5.2643 < 6.8436] w=0.0968 to align # Constraint # added constraint: constraint((T0356)T26.CB, (T0356)P61.CB) [> 3.8552 = 6.4254 < 8.3530] w=0.0968 to align # Constraint # added constraint: constraint((T0356)T26.CB, (T0356)V62.CB) [> 4.1414 = 6.9023 < 8.9730] w=0.0968 to align # Constraint # added constraint: constraint((T0356)I134.CB, (T0356)A245.CB) [> 2.9515 = 4.9191 < 6.3949] w=0.0913 to align # Constraint # added constraint: constraint((T0356)T42.CB, (T0356)L66.CB) [> 4.0527 = 6.7546 < 8.7809] w=0.0913 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)I159.CB) [> 4.4855 = 7.4759 < 9.7187] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)T160.CB) [> 3.6173 = 6.0289 < 7.8375] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)C130.CB) [> 4.5678 = 7.6130 < 9.8968] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)K133.CB) [> 2.0196 = 3.3659 < 4.3757] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)A156.CB) [> 4.4349 = 7.3914 < 9.6089] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)K133.CB) [> 4.7407 = 7.9012 < 10.2715] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)T160.CB) [> 3.1020 = 5.1700 < 6.7210] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)A156.CB) [> 2.6634 = 4.4389 < 5.7706] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)A155.CB) [> 4.3911 = 7.3185 < 9.5141] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)E153.CB) [> 2.6360 = 4.3934 < 5.7114] w=0.0885 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)L163.CB) [> 4.4375 = 7.3959 < 9.6146] w=0.0885 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)G162.CA) [> 3.8486 = 6.4143 < 8.3386] w=0.0885 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)W161.CB) [> 4.5007 = 7.5011 < 9.7515] w=0.0885 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)T160.CB) [> 2.4855 = 4.1426 < 5.3854] w=0.0885 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)I159.CB) [> 4.1395 = 6.8991 < 8.9689] w=0.0885 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)L158.CB) [> 4.7532 = 7.9220 < 10.2986] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)T160.CB) [> 3.7710 = 6.2850 < 8.1705] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)I159.CB) [> 2.1644 = 3.6074 < 4.6896] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)L158.CB) [> 4.1271 = 6.8784 < 8.9420] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)T160.CB) [> 2.7176 = 4.5293 < 5.8882] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)L158.CB) [> 3.3893 = 5.6488 < 7.3435] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)P157.CB) [> 4.5179 = 7.5298 < 9.7887] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)A156.CB) [> 4.5349 = 7.5582 < 9.8256] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)I147.CB) [> 4.0599 = 6.7666 < 8.7966] w=0.0885 to align # Constraint # added constraint: constraint((T0356)K56.CB, (T0356)C361.CB) [> 4.5222 = 7.5371 < 9.7982] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)P157.CB) [> 3.7541 = 6.2569 < 8.1340] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)A156.CB) [> 3.9658 = 6.6096 < 8.5925] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)A155.CB) [> 2.8662 = 4.7770 < 6.2101] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)D154.CB) [> 3.8358 = 6.3930 < 8.3109] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)E153.CB) [> 3.5429 = 5.9048 < 7.6762] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)F67.CB) [> 4.2638 = 7.1064 < 9.2383] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)A155.CB) [> 4.7116 = 7.8526 < 10.2084] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)P152.CB) [> 4.4744 = 7.4573 < 9.6945] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)W151.CB) [> 4.1751 = 6.9585 < 9.0461] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)W151.CB) [> 3.3658 = 5.6096 < 7.2925] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)M148.CB) [> 2.5905 = 4.3175 < 5.6127] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)I147.CB) [> 3.1861 = 5.3102 < 6.9032] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)K133.CB) [> 3.9439 = 6.5731 < 8.5451] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M77.CB, (T0356)A441.CB) [> 4.6295 = 7.7159 < 10.0307] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M77.CB, (T0356)W415.CB) [> 4.3142 = 7.1904 < 9.3475] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G76.CA, (T0356)P443.CB) [> 3.9246 = 6.5409 < 8.5032] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G76.CA, (T0356)A441.CB) [> 3.9287 = 6.5479 < 8.5123] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)T418.CB) [> 4.4563 = 7.4272 < 9.6554] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)I159.CB) [> 3.0798 = 5.1329 < 6.6728] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)V165.CB) [> 4.7332 = 7.8887 < 10.2553] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)W161.CB) [> 3.8556 = 6.4260 < 8.3538] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)T160.CB) [> 4.1768 = 6.9614 < 9.0498] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)I159.CB) [> 4.4450 = 7.4084 < 9.6309] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)V82.CB) [> 3.2887 = 5.4812 < 7.1255] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)L263.CB) [> 2.9660 = 4.9433 < 6.4262] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)T227.CB) [> 4.1669 = 6.9449 < 9.0284] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)V165.CB) [> 4.0952 = 6.8253 < 8.8729] w=0.0885 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)L263.CB) [> 4.7675 = 7.9459 < 10.3297] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)G286.CA) [> 4.5285 = 7.5474 < 9.8117] w=0.0885 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)L263.CB) [> 2.9170 = 4.8617 < 6.3201] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I25.CB, (T0356)G199.CA) [> 3.7890 = 6.3150 < 8.2094] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I25.CB, (T0356)G198.CA) [> 3.9483 = 6.5805 < 8.5547] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I25.CB, (T0356)L189.CB) [> 2.6937 = 4.4894 < 5.8363] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I25.CB, (T0356)K188.CB) [> 4.1122 = 6.8537 < 8.9099] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L33.CB, (T0356)Y203.CB) [> 4.2979 = 7.1632 < 9.3122] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P31.CB, (T0356)V73.CB) [> 4.0086 = 6.6810 < 8.6853] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P31.CB, (T0356)R72.CB) [> 3.7348 = 6.2246 < 8.0920] w=0.0885 to align # Constraint # added constraint: constraint((T0356)R10.CB, (T0356)E53.CB) [> 3.3181 = 5.5301 < 7.1892] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T42.CB, (T0356)A155.CB) [> 3.3528 = 5.5880 < 7.2644] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)F67.CB) [> 4.0113 = 6.6854 < 8.6910] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)L66.CB) [> 3.3763 = 5.6272 < 7.3154] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)F67.CB) [> 1.9033 = 3.1721 < 4.1237] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)L66.CB) [> 4.3032 = 7.1721 < 9.3237] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)F67.CB) [> 3.4857 = 5.8094 < 7.5522] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L43.CB, (T0356)A441.CB) [> 4.1207 = 6.8678 < 8.9282] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)I351.CB) [> 4.1857 = 6.9761 < 9.0689] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)L356.CB) [> 3.7455 = 6.2425 < 8.1153] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)S260.CB) [> 3.3261 = 5.5436 < 7.2066] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)C258.CB) [> 3.2226 = 5.3710 < 6.9824] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G230.CA, (T0356)C361.CB) [> 4.5305 = 7.5509 < 9.8161] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)S260.CB) [> 3.0856 = 5.1427 < 6.6855] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)I259.CB) [> 3.8599 = 6.4332 < 8.3632] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)C258.CB) [> 2.7812 = 4.6353 < 6.0259] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P287.CB, (T0356)T322.CB) [> 3.0315 = 5.0525 < 6.5682] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P287.CB, (T0356)Y321.CB) [> 3.3369 = 5.5615 < 7.2300] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G286.CA, (T0356)Y321.CB) [> 3.3315 = 5.5525 < 7.2183] w=0.0885 to align # Constraint # added constraint: constraint((T0356)S268.CB, (T0356)G323.CA) [> 3.5792 = 5.9654 < 7.7550] w=0.0885 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)G286.CA) [> 4.2925 = 7.1541 < 9.3004] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)E285.CB) [> 3.3438 = 5.5730 < 7.2449] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)L356.CB) [> 4.6869 = 7.8114 < 10.1549] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)S260.CB) [> 2.9021 = 4.8369 < 6.2880] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)I259.CB) [> 3.8342 = 6.3903 < 8.3074] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)G230.CA) [> 4.0744 = 6.7907 < 8.8279] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)S260.CB) [> 4.6268 = 7.7114 < 10.0248] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)S260.CB) [> 4.2950 = 7.1583 < 9.3058] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)G246.CA) [> 4.7357 = 7.8927 < 10.2606] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)Y355.CB) [> 3.7117 = 6.1861 < 8.0419] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)I351.CB) [> 3.1604 = 5.2673 < 6.8475] w=0.0885 to align # Constraint # added constraint: constraint((T0356)R214.CB, (T0356)E254.CB) [> 3.4914 = 5.8190 < 7.5647] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A226.CB, (T0356)L356.CB) [> 2.3031 = 3.8386 < 4.9901] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)G286.CA) [> 3.6611 = 6.1019 < 7.9324] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)E285.CB) [> 2.6244 = 4.3740 < 5.6861] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)S260.CB) [> 3.7252 = 6.2086 < 8.0712] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)S260.CB) [> 4.6774 = 7.7956 < 10.1343] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)L429.CB) [> 4.0452 = 6.7421 < 8.7647] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)T427.CB) [> 2.7950 = 4.6584 < 6.0559] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)N406.CB) [> 4.5553 = 7.5921 < 9.8697] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V428.CB, (T0356)F440.CB) [> 4.3061 = 7.1768 < 9.3299] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V428.CB, (T0356)D439.CB) [> 4.7505 = 7.9175 < 10.2928] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T427.CB, (T0356)F440.CB) [> 4.6288 = 7.7146 < 10.0290] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T427.CB, (T0356)D439.CB) [> 4.1465 = 6.9108 < 8.9840] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)P423.CB) [> 4.6594 = 7.7656 < 10.0953] w=0.0885 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)P423.CB) [> 4.1541 = 6.9236 < 9.0006] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T395.CB, (T0356)T427.CB) [> 4.2550 = 7.0917 < 9.2193] w=0.0885 to align # Constraint # added constraint: constraint((T0356)H377.CB, (T0356)D436.CB) [> 3.9899 = 6.6499 < 8.6449] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M148.CB, (T0356)S195.CB) [> 4.6864 = 7.8106 < 10.1538] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M148.CB, (T0356)L194.CB) [> 3.0566 = 5.0944 < 6.6227] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I147.CB, (T0356)A156.CB) [> 4.4638 = 7.4397 < 9.6716] w=0.0885 to align # Constraint # added constraint: constraint((T0356)K133.CB, (T0356)L158.CB) [> 3.0565 = 5.0942 < 6.6224] w=0.0885 to align # Constraint # added constraint: constraint((T0356)K133.CB, (T0356)A156.CB) [> 3.6240 = 6.0400 < 7.8520] w=0.0885 to align # Constraint # added constraint: constraint((T0356)K133.CB, (T0356)M148.CB) [> 3.9483 = 6.5806 < 8.5548] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Q132.CB, (T0356)P225.CB) [> 4.6225 = 7.7041 < 10.0153] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Q132.CB, (T0356)I147.CB) [> 3.6915 = 6.1526 < 7.9983] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Q131.CB, (T0356)G446.CA) [> 3.5672 = 5.9453 < 7.7289] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Q131.CB, (T0356)P443.CB) [> 3.3962 = 5.6603 < 7.3584] w=0.0885 to align # Constraint # added constraint: constraint((T0356)Q131.CB, (T0356)S362.CB) [> 3.1178 = 5.1964 < 6.7553] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C130.CB, (T0356)R192.CB) [> 4.2448 = 7.0746 < 9.1970] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C130.CB, (T0356)G162.CA) [> 4.4971 = 7.4952 < 9.7438] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L158.CB, (T0356)R192.CB) [> 2.5933 = 4.3222 < 5.6188] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L158.CB, (T0356)M191.CB) [> 4.0444 = 6.7407 < 8.7628] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P157.CB, (T0356)R192.CB) [> 4.3382 = 7.2303 < 9.3994] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P157.CB, (T0356)M191.CB) [> 3.6909 = 6.1515 < 7.9969] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T149.CB, (T0356)P443.CB) [> 4.2307 = 7.0511 < 9.1664] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T149.CB, (T0356)G198.CA) [> 3.0947 = 5.1578 < 6.7052] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T149.CB, (T0356)R197.CB) [> 3.0955 = 5.1592 < 6.7070] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T149.CB, (T0356)H196.CB) [> 4.4165 = 7.3609 < 9.5692] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M148.CB, (T0356)G199.CA) [> 4.6161 = 7.6936 < 10.0016] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M148.CB, (T0356)G198.CA) [> 2.4620 = 4.1034 < 5.3344] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M148.CB, (T0356)R197.CB) [> 4.4481 = 7.4135 < 9.6376] w=0.0885 to align # Constraint # added constraint: constraint((T0356)M148.CB, (T0356)H196.CB) [> 4.2194 = 7.0324 < 9.1421] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C130.CB, (T0356)T160.CB) [> 3.5474 = 5.9123 < 7.6860] w=0.0885 to align # Constraint # added constraint: constraint((T0356)C130.CB, (T0356)L158.CB) [> 3.1189 = 5.1981 < 6.7575] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P129.CB, (T0356)L229.CB) [> 3.4562 = 5.7603 < 7.4884] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P129.CB, (T0356)I228.CB) [> 4.3690 = 7.2816 < 9.4661] w=0.0885 to align # Constraint # added constraint: constraint((T0356)P129.CB, (T0356)A226.CB) [> 3.3612 = 5.6020 < 7.2826] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A128.CB, (T0356)I147.CB) [> 4.3538 = 7.2563 < 9.4332] w=0.0885 to align # Constraint # added constraint: constraint((T0356)K123.CB, (T0356)W151.CB) [> 3.3564 = 5.5940 < 7.2722] w=0.0885 to align # Constraint # added constraint: constraint((T0356)I184.CB, (T0356)G323.CA) [> 4.7332 = 7.8886 < 10.2552] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)A441.CB) [> 3.9287 = 6.5479 < 8.5123] w=0.0885 to align # Constraint # added constraint: constraint((T0356)K186.CB, (T0356)G286.CA) [> 3.6312 = 6.0519 < 7.8675] w=0.0885 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)G198.CA) [> 3.3068 = 5.5114 < 7.1648] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)G323.CA) [> 4.5748 = 7.6247 < 9.9121] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)G198.CA) [> 4.2952 = 7.1586 < 9.3062] w=0.0885 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)I184.CB) [> 3.3440 = 5.5732 < 7.2452] w=0.0885 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)I184.CB) [> 2.2905 = 3.8175 < 4.9627] w=0.0885 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)G198.CA) [> 4.7308 = 7.8846 < 10.2500] w=0.0885 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)I399.CB) [> 4.1813 = 6.9688 < 9.0595] w=0.0852 to align # Constraint # added constraint: constraint((T0356)G177.CA, (T0356)M191.CB) [> 3.6901 = 6.1502 < 7.9952] w=0.0832 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)E431.CB) [> 3.3988 = 5.6646 < 7.3640] w=0.0832 to align # Constraint # added constraint: constraint((T0356)R72.CB, (T0356)Y179.CB) [> 2.9214 = 4.8690 < 6.3297] w=0.0832 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)R180.CB) [> 4.4605 = 7.4342 < 9.6644] w=0.0832 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)Q181.CB) [> 4.4315 = 7.3859 < 9.6016] w=0.0832 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)I399.CB) [> 3.3999 = 5.6665 < 7.3664] w=0.0832 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)V400.CB) [> 3.3337 = 5.5562 < 7.2230] w=0.0832 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)G177.CA) [> 4.7913 = 7.9855 < 10.3811] w=0.0832 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)I178.CB) [> 3.2701 = 5.4502 < 7.0852] w=0.0832 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)Y179.CB) [> 3.1145 = 5.1908 < 6.7480] w=0.0832 to align # Constraint # added constraint: constraint((T0356)G76.CA, (T0356)Q181.CB) [> 3.3850 = 5.6417 < 7.3342] w=0.0832 to align # Constraint # added constraint: constraint((T0356)M77.CB, (T0356)R180.CB) [> 4.4865 = 7.4775 < 9.7207] w=0.0832 to align # Constraint # added constraint: constraint((T0356)H377.CB, (T0356)V405.CB) [> 3.3715 = 5.6191 < 7.3049] w=0.0832 to align # Constraint # added constraint: constraint((T0356)H377.CB, (T0356)N406.CB) [> 3.4396 = 5.7327 < 7.4525] w=0.0832 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)T427.CB) [> 4.0819 = 6.8032 < 8.8442] w=0.0832 to align # Constraint # added constraint: constraint((T0356)F94.CB, (T0356)L107.CB) [> 2.9135 = 4.8559 < 6.3127] w=0.0809 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)I399.CB) [> 3.7637 = 6.2729 < 8.1547] w=0.0763 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)G384.CA) [> 2.9925 = 4.9875 < 6.4837] w=0.0736 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)V385.CB) [> 2.7491 = 4.5818 < 5.9564] w=0.0736 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)T395.CB) [> 4.5410 = 7.5683 < 9.8388] w=0.0736 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)H377.CB) [> 3.7775 = 6.2959 < 8.1847] w=0.0736 to align # Constraint # added constraint: constraint((T0356)L43.CB, (T0356)Y394.CB) [> 4.4068 = 7.3446 < 9.5480] w=0.0736 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)A378.CB) [> 4.0975 = 6.8292 < 8.8780] w=0.0736 to align # Constraint # added constraint: constraint((T0356)L429.CB, (T0356)D439.CB) [> 3.8606 = 6.4343 < 8.3646] w=0.0736 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)H377.CB) [> 3.5297 = 5.8828 < 7.6476] w=0.0736 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)M382.CB) [> 3.2944 = 5.4907 < 7.1379] w=0.0736 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)V385.CB) [> 3.9075 = 6.5125 < 8.4663] w=0.0736 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)M382.CB) [> 3.2285 = 5.3809 < 6.9952] w=0.0736 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)V385.CB) [> 4.6605 = 7.7675 < 10.0978] w=0.0736 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)H377.CB) [> 3.3571 = 5.5952 < 7.2738] w=0.0736 to align # Constraint # added constraint: constraint((T0356)F94.CB, (T0356)F114.CB) [> 3.1796 = 5.2994 < 6.8892] w=0.0706 to align # Constraint # added constraint: constraint((T0356)M77.CB, (T0356)I159.CB) [> 4.6181 = 7.6968 < 10.0059] w=0.0706 to align # Constraint # added constraint: constraint((T0356)E87.CB, (T0356)V117.CB) [> 4.3063 = 7.1771 < 9.3303] w=0.0706 to align # Constraint # added constraint: constraint((T0356)E87.CB, (T0356)L158.CB) [> 4.3094 = 7.1822 < 9.3369] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V117.CB, (T0356)C258.CB) [> 3.3663 = 5.6105 < 7.2936] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V117.CB, (T0356)I259.CB) [> 3.5272 = 5.8786 < 7.6422] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y58.CB, (T0356)A269.CB) [> 4.6867 = 7.8112 < 10.1546] w=0.0706 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)W161.CB) [> 3.0659 = 5.1098 < 6.6428] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y6.CB, (T0356)E37.CB) [> 2.7232 = 4.5386 < 5.9002] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y6.CB, (T0356)R41.CB) [> 2.8354 = 4.7257 < 6.1434] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y6.CB, (T0356)T418.CB) [> 4.6652 = 7.7754 < 10.1080] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V73.CB, (T0356)V165.CB) [> 3.8470 = 6.4116 < 8.3351] w=0.0706 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)L158.CB) [> 3.2603 = 5.4338 < 7.0640] w=0.0706 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)I309.CB) [> 4.1321 = 6.8868 < 8.9529] w=0.0706 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)T427.CB) [> 3.7834 = 6.3056 < 8.1973] w=0.0706 to align # Constraint # added constraint: constraint((T0356)K396.CB, (T0356)Y437.CB) [> 4.1570 = 6.9283 < 9.0068] w=0.0706 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)Y437.CB) [> 3.4735 = 5.7891 < 7.5258] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)D439.CB) [> 4.4979 = 7.4965 < 9.7455] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V398.CB, (T0356)F440.CB) [> 3.0584 = 5.0973 < 6.6265] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)E431.CB) [> 3.1271 = 5.2118 < 6.7753] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)D439.CB) [> 3.2905 = 5.4841 < 7.1294] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I399.CB, (T0356)F440.CB) [> 3.7017 = 6.1694 < 8.0203] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)R420.CB) [> 4.1367 = 6.8945 < 8.9628] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V400.CB, (T0356)F440.CB) [> 2.1756 = 3.6260 < 4.7138] w=0.0706 to align # Constraint # added constraint: constraint((T0356)C401.CB, (T0356)D439.CB) [> 4.6787 = 7.7978 < 10.1372] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)T395.CB) [> 3.4896 = 5.8161 < 7.5609] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)K396.CB) [> 2.7104 = 4.5174 < 5.8726] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)F397.CB) [> 4.0584 = 6.7641 < 8.7933] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I351.CB, (T0356)V400.CB) [> 3.3082 = 5.5137 < 7.1677] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)K396.CB) [> 4.5134 = 7.5224 < 9.7791] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)F397.CB) [> 3.3470 = 5.5784 < 7.2519] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V352.CB, (T0356)V400.CB) [> 4.0440 = 6.7401 < 8.7621] w=0.0706 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)N406.CB) [> 3.0431 = 5.0718 < 6.5933] w=0.0706 to align # Constraint # added constraint: constraint((T0356)D353.CB, (T0356)F440.CB) [> 3.7414 = 6.2357 < 8.1064] w=0.0706 to align # Constraint # added constraint: constraint((T0356)F354.CB, (T0356)C401.CB) [> 3.6214 = 6.0357 < 7.8465] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)V400.CB) [> 2.5229 = 4.2048 < 5.4662] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)C401.CB) [> 4.6414 = 7.7356 < 10.0563] w=0.0706 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)C401.CB) [> 4.4329 = 7.3882 < 9.6046] w=0.0706 to align # Constraint # added constraint: constraint((T0356)M382.CB, (T0356)V400.CB) [> 4.3287 = 7.2145 < 9.3788] w=0.0706 to align # Constraint # added constraint: constraint((T0356)S445.CB, (T0356)K458.CB) [> 4.5859 = 7.6431 < 9.9360] w=0.0706 to align # Constraint # added constraint: constraint((T0356)L453.CB, (T0356)L488.CB) [> 4.5296 = 7.5494 < 9.8142] w=0.0706 to align # Constraint # added constraint: constraint((T0356)D436.CB, (T0356)K458.CB) [> 4.7825 = 7.9709 < 10.3621] w=0.0706 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)I277.CB) [> 2.9590 = 4.9316 < 6.4111] w=0.0706 to align # Constraint # added constraint: constraint((T0356)A269.CB, (T0356)S387.CB) [> 4.6368 = 7.7280 < 10.0464] w=0.0706 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)Y276.CB) [> 4.1421 = 6.9036 < 8.9746] w=0.0706 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)V385.CB) [> 4.7550 = 7.9250 < 10.3026] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)Y355.CB) [> 2.3096 = 3.8493 < 5.0040] w=0.0706 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)V400.CB) [> 4.2176 = 7.0293 < 9.1381] w=0.0706 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)L356.CB) [> 4.1818 = 6.9697 < 9.0606] w=0.0706 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)V385.CB) [> 4.7550 = 7.9250 < 10.3026] w=0.0706 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)D353.CB) [> 4.3793 = 7.2988 < 9.4884] w=0.0706 to align # Constraint # added constraint: constraint((T0356)G323.CA, (T0356)F354.CB) [> 4.4889 = 7.4816 < 9.7260] w=0.0706 to align # Constraint # added constraint: constraint((T0356)E270.CB, (T0356)T395.CB) [> 3.0027 = 5.0045 < 6.5059] w=0.0706 to align # Constraint # added constraint: constraint((T0356)E270.CB, (T0356)K396.CB) [> 3.8903 = 6.4839 < 8.4291] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V272.CB, (T0356)I351.CB) [> 3.4894 = 5.8158 < 7.5605] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V272.CB, (T0356)T395.CB) [> 4.1349 = 6.8915 < 8.9589] w=0.0706 to align # Constraint # added constraint: constraint((T0356)I277.CB, (T0356)E313.CB) [> 3.5699 = 5.9499 < 7.7349] w=0.0706 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)I399.CB) [> 3.2960 = 5.4933 < 7.1413] w=0.0706 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)V400.CB) [> 3.3139 = 5.5231 < 7.1800] w=0.0706 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)V352.CB) [> 3.7460 = 6.2433 < 8.1163] w=0.0706 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)Y355.CB) [> 4.0513 = 6.7522 < 8.7778] w=0.0706 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)V385.CB) [> 3.5355 = 5.8925 < 7.6603] w=0.0687 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)I178.CB) [> 3.4545 = 5.7574 < 7.4847] w=0.0683 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)Y179.CB) [> 4.3992 = 7.3320 < 9.5316] w=0.0683 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)G222.CA) [> 3.7662 = 6.2770 < 8.1601] w=0.0683 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)Q181.CB) [> 3.9650 = 6.6083 < 8.5907] w=0.0683 to align # Constraint # added constraint: constraint((T0356)Q181.CB, (T0356)V219.CB) [> 4.3712 = 7.2853 < 9.4709] w=0.0683 to align # Constraint # added constraint: constraint((T0356)A226.CB, (T0356)S268.CB) [> 2.9033 = 4.8389 < 6.2906] w=0.0683 to align # Constraint # added constraint: constraint((T0356)I147.CB, (T0356)W161.CB) [> 3.9789 = 6.6315 < 8.6210] w=0.0678 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)F397.CB) [> 4.3656 = 7.2760 < 9.4588] w=0.0675 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)F397.CB) [> 2.9073 = 4.8455 < 6.2991] w=0.0675 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)F397.CB) [> 3.2863 = 5.4772 < 7.1204] w=0.0675 to align # Constraint # added constraint: constraint((T0356)P423.CB, (T0356)D439.CB) [> 4.7098 = 7.8496 < 10.2045] w=0.0658 to align # Constraint # added constraint: constraint((T0356)L15.CB, (T0356)L95.CB) [> 3.6529 = 6.0881 < 7.9145] w=0.0647 to align # Constraint # added constraint: constraint((T0356)G199.CA, (T0356)V232.CB) [> 2.5921 = 4.3201 < 5.6162] w=0.0647 to align # Constraint # added constraint: constraint((T0356)D202.CB, (T0356)G246.CA) [> 4.4083 = 7.3471 < 9.5512] w=0.0647 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)Y242.CB) [> 2.9376 = 4.8959 < 6.3647] w=0.0647 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)G246.CA) [> 4.7321 = 7.8868 < 10.2528] w=0.0647 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)V232.CB) [> 4.6647 = 7.7746 < 10.1069] w=0.0647 to align # Constraint # added constraint: constraint((T0356)V135.CB, (T0356)A245.CB) [> 4.5647 = 7.6079 < 9.8902] w=0.0647 to align # Constraint # added constraint: constraint((T0356)I134.CB, (T0356)T251.CB) [> 3.3781 = 5.6301 < 7.3192] w=0.0647 to align # Constraint # added constraint: constraint((T0356)I134.CB, (T0356)G246.CA) [> 2.9173 = 4.8622 < 6.3209] w=0.0647 to align # Constraint # added constraint: constraint((T0356)I134.CB, (T0356)Y242.CB) [> 4.2825 = 7.1375 < 9.2788] w=0.0647 to align # Constraint # added constraint: constraint((T0356)I134.CB, (T0356)G198.CA) [> 3.7676 = 6.2793 < 8.1631] w=0.0647 to align # Constraint # added constraint: constraint((T0356)C130.CB, (T0356)G198.CA) [> 3.9146 = 6.5243 < 8.4816] w=0.0639 to align # Constraint # added constraint: constraint((T0356)Q131.CB, (T0356)G198.CA) [> 3.0081 = 5.0135 < 6.5176] w=0.0639 to align # Constraint # added constraint: constraint((T0356)V135.CB, (T0356)A226.CB) [> 2.5513 = 4.2522 < 5.5279] w=0.0639 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)V255.CB) [> 3.2166 = 5.3610 < 6.9693] w=0.0639 to align # Constraint # added constraint: constraint((T0356)G198.CA, (T0356)Q311.CB) [> 3.4024 = 5.6707 < 7.3719] w=0.0639 to align # Constraint # added constraint: constraint((T0356)G199.CA, (T0356)Q311.CB) [> 2.5567 = 4.2612 < 5.5396] w=0.0639 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)R214.CB) [> 4.0468 = 6.7447 < 8.7681] w=0.0639 to align # Constraint # added constraint: constraint((T0356)P61.CB, (T0356)P216.CB) [> 3.0134 = 5.0224 < 6.5291] w=0.0639 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)P216.CB) [> 3.7897 = 6.3162 < 8.2110] w=0.0639 to align # Constraint # added constraint: constraint((T0356)V62.CB, (T0356)V217.CB) [> 2.9775 = 4.9625 < 6.4513] w=0.0639 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)V217.CB) [> 4.6254 = 7.7090 < 10.0217] w=0.0639 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)S218.CB) [> 2.8762 = 4.7937 < 6.2319] w=0.0639 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)F244.CB) [> 4.1282 = 6.8803 < 8.9444] w=0.0639 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)S218.CB) [> 4.6546 = 7.7576 < 10.0849] w=0.0639 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)L221.CB) [> 3.5942 = 5.9904 < 7.7875] w=0.0639 to align # Constraint # added constraint: constraint((T0356)P55.CB, (T0356)L95.CB) [> 3.6384 = 6.0641 < 7.8833] w=0.0639 to align # Constraint # added constraint: constraint((T0356)K56.CB, (T0356)L95.CB) [> 2.6919 = 4.4865 < 5.8324] w=0.0639 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)A226.CB) [> 3.3428 = 5.5713 < 7.2426] w=0.0639 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)S218.CB) [> 3.9718 = 6.6197 < 8.6056] w=0.0639 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)V219.CB) [> 4.2509 = 7.0848 < 9.2102] w=0.0639 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)A220.CB) [> 3.2883 = 5.4805 < 7.1246] w=0.0639 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)A226.CB) [> 3.0756 = 5.1259 < 6.6637] w=0.0639 to align # Constraint # added constraint: constraint((T0356)N65.CB, (T0356)F244.CB) [> 3.8035 = 6.3392 < 8.2409] w=0.0639 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)A220.CB) [> 4.6742 = 7.7903 < 10.1274] w=0.0639 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)L221.CB) [> 2.7114 = 4.5189 < 5.8746] w=0.0639 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)G222.CA) [> 3.6893 = 6.1489 < 7.9936] w=0.0639 to align # Constraint # added constraint: constraint((T0356)L66.CB, (T0356)A226.CB) [> 3.0914 = 5.1524 < 6.6982] w=0.0639 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)L221.CB) [> 4.7899 = 7.9831 < 10.3780] w=0.0639 to align # Constraint # added constraint: constraint((T0356)F67.CB, (T0356)G222.CA) [> 3.5684 = 5.9473 < 7.7315] w=0.0639 to align # Constraint # added constraint: constraint((T0356)G289.CA, (T0356)P325.CB) [> 4.6034 = 7.6723 < 9.9740] w=0.0639 to align # Constraint # added constraint: constraint((T0356)G289.CA, (T0356)I351.CB) [> 4.6962 = 7.8270 < 10.1751] w=0.0639 to align # Constraint # added constraint: constraint((T0356)Y294.CB, (T0356)I309.CB) [> 3.9030 = 6.5051 < 8.4566] w=0.0639 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)T282.CB) [> 4.5211 = 7.5351 < 9.7956] w=0.0639 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)A283.CB) [> 4.2670 = 7.1116 < 9.2451] w=0.0639 to align # Constraint # added constraint: constraint((T0356)Q279.CB, (T0356)Y321.CB) [> 3.8538 = 6.4231 < 8.3500] w=0.0639 to align # Constraint # added constraint: constraint((T0356)P287.CB, (T0356)V352.CB) [> 2.8807 = 4.8012 < 6.2416] w=0.0639 to align # Constraint # added constraint: constraint((T0356)P287.CB, (T0356)V385.CB) [> 4.6928 = 7.8213 < 10.1677] w=0.0639 to align # Constraint # added constraint: constraint((T0356)I309.CB, (T0356)S319.CB) [> 2.8125 = 4.6875 < 6.0938] w=0.0639 to align # Constraint # added constraint: constraint((T0356)Y317.CB, (T0356)Y355.CB) [> 4.3835 = 7.3058 < 9.4976] w=0.0639 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)F354.CB) [> 2.9820 = 4.9701 < 6.4611] w=0.0639 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)Y355.CB) [> 4.5500 = 7.5833 < 9.8583] w=0.0639 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)Y355.CB) [> 2.7875 = 4.6459 < 6.0397] w=0.0639 to align # Constraint # added constraint: constraint((T0356)S319.CB, (T0356)L356.CB) [> 4.5329 = 7.5548 < 9.8212] w=0.0639 to align # Constraint # added constraint: constraint((T0356)T320.CB, (T0356)L356.CB) [> 3.5058 = 5.8431 < 7.5960] w=0.0639 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)R364.CB) [> 3.6801 = 6.1335 < 7.9735] w=0.0639 to align # Constraint # added constraint: constraint((T0356)T322.CB, (T0356)H377.CB) [> 4.0921 = 6.8202 < 8.8662] w=0.0639 to align # Constraint # added constraint: constraint((T0356)I228.CB, (T0356)P287.CB) [> 4.7369 = 7.8949 < 10.2633] w=0.0639 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)T322.CB) [> 2.5608 = 4.2679 < 5.5483] w=0.0639 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)G323.CA) [> 3.7953 = 6.3256 < 8.2232] w=0.0639 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)G286.CA) [> 4.5850 = 7.6416 < 9.9341] w=0.0639 to align # Constraint # added constraint: constraint((T0356)P216.CB, (T0356)P287.CB) [> 4.5633 = 7.6055 < 9.8871] w=0.0639 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)G286.CA) [> 3.6253 = 6.0422 < 7.8549] w=0.0639 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)T322.CB) [> 4.1828 = 6.9714 < 9.0628] w=0.0639 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)H318.CB) [> 2.9376 = 4.8961 < 6.3649] w=0.0639 to align # Constraint # added constraint: constraint((T0356)T227.CB, (T0356)T320.CB) [> 3.9749 = 6.6248 < 8.6123] w=0.0639 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)V368.CB) [> 4.4268 = 7.3780 < 9.5915] w=0.0631 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)H377.CB) [> 3.7959 = 6.3264 < 8.2244] w=0.0631 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)A378.CB) [> 4.0984 = 6.8306 < 8.8798] w=0.0631 to align # Constraint # added constraint: constraint((T0356)D403.CB, (T0356)L429.CB) [> 2.8095 = 4.6825 < 6.0872] w=0.0631 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)A378.CB) [> 2.9915 = 4.9859 < 6.4816] w=0.0599 to align # Constraint # added constraint: constraint((T0356)I145.CB, (T0356)T160.CB) [> 3.2396 = 5.3994 < 7.0192] w=0.0589 to align # Constraint # added constraint: constraint((T0356)V117.CB, (T0356)T164.CB) [> 4.5936 = 7.6560 < 9.9528] w=0.0586 to align # Constraint # added constraint: constraint((T0356)Y6.CB, (T0356)W161.CB) [> 4.1671 = 6.9451 < 9.0287] w=0.0586 to align # Constraint # added constraint: constraint((T0356)Y6.CB, (T0356)F67.CB) [> 4.5061 = 7.5102 < 9.7633] w=0.0586 to align # Constraint # added constraint: constraint((T0356)K5.CB, (T0356)Q79.CB) [> 4.4369 = 7.3948 < 9.6132] w=0.0586 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)P98.CB) [> 4.0132 = 6.6886 < 8.6952] w=0.0586 to align # Constraint # added constraint: constraint((T0356)C64.CB, (T0356)L95.CB) [> 3.6745 = 6.1242 < 7.9615] w=0.0586 to align # Constraint # added constraint: constraint((T0356)F397.CB, (T0356)S496.CB) [> 4.6736 = 7.7894 < 10.1262] w=0.0586 to align # Constraint # added constraint: constraint((T0356)K371.CB, (T0356)R408.CB) [> 4.6295 = 7.7159 < 10.0307] w=0.0586 to align # Constraint # added constraint: constraint((T0356)L488.CB, (T0356)A497.CB) [> 3.2056 = 5.3426 < 6.9454] w=0.0586 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)L498.CB) [> 3.2531 = 5.4218 < 7.0484] w=0.0586 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)A497.CB) [> 3.9207 = 6.5345 < 8.4949] w=0.0586 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)S496.CB) [> 3.2605 = 5.4342 < 7.0645] w=0.0586 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)H500.CB) [> 4.5191 = 7.5319 < 9.7914] w=0.0586 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)L498.CB) [> 4.5712 = 7.6187 < 9.9044] w=0.0586 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)H500.CB) [> 3.8430 = 6.4049 < 8.3264] w=0.0586 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)L498.CB) [> 3.7608 = 6.2680 < 8.1484] w=0.0586 to align # Constraint # added constraint: constraint((T0356)L356.CB, (T0356)Y437.CB) [> 4.4715 = 7.4526 < 9.6883] w=0.0586 to align # Constraint # added constraint: constraint((T0356)Y355.CB, (T0356)I417.CB) [> 4.1185 = 6.8642 < 8.9235] w=0.0586 to align # Constraint # added constraint: constraint((T0356)T369.CB, (T0356)S496.CB) [> 4.5203 = 7.5339 < 9.7940] w=0.0586 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)A497.CB) [> 4.7250 = 7.8750 < 10.2375] w=0.0586 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)S496.CB) [> 2.9555 = 4.9258 < 6.4036] w=0.0586 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)A497.CB) [> 2.6226 = 4.3710 < 5.6823] w=0.0586 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)S496.CB) [> 4.2695 = 7.1158 < 9.2505] w=0.0586 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)F397.CB) [> 4.7349 = 7.8915 < 10.2589] w=0.0586 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)V352.CB) [> 4.0449 = 6.7414 < 8.7639] w=0.0546 to align # Constraint # added constraint: constraint((T0356)V303.CB, (T0356)V368.CB) [> 4.4122 = 7.3537 < 9.5597] w=0.0546 to align # Constraint # added constraint: constraint((T0356)F304.CB, (T0356)W467.CB) [> 3.5315 = 5.8859 < 7.6516] w=0.0546 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)W467.CB) [> 4.1875 = 6.9792 < 9.0730] w=0.0546 to align # Constraint # added constraint: constraint((T0356)V306.CB, (T0356)W467.CB) [> 3.2723 = 5.4538 < 7.0899] w=0.0546 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)W467.CB) [> 4.7778 = 7.9630 < 10.3519] w=0.0546 to align # Constraint # added constraint: constraint((T0356)D422.CB, (T0356)S442.CB) [> 4.2006 = 7.0010 < 9.1013] w=0.0546 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)H377.CB) [> 3.9027 = 6.5045 < 8.4559] w=0.0546 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)L356.CB) [> 4.6107 = 7.6846 < 9.9899] w=0.0544 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)Y355.CB) [> 2.8542 = 4.7571 < 6.1842] w=0.0544 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)F354.CB) [> 3.6830 = 6.1384 < 7.9799] w=0.0544 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)A378.CB) [> 4.6878 = 7.8130 < 10.1569] w=0.0544 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)R364.CB) [> 4.2127 = 7.0211 < 9.1275] w=0.0544 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)L356.CB) [> 2.8853 = 4.8089 < 6.2515] w=0.0544 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)H377.CB) [> 4.0537 = 6.7561 < 8.7830] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)L356.CB) [> 2.9111 = 4.8518 < 6.3073] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)H377.CB) [> 2.5812 = 4.3019 < 5.5925] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)A378.CB) [> 4.6901 = 7.8169 < 10.1619] w=0.0544 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)Y355.CB) [> 2.3538 = 3.9230 < 5.1000] w=0.0544 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)D353.CB) [> 4.6184 = 7.6974 < 10.0066] w=0.0544 to align # Constraint # added constraint: constraint((T0356)P129.CB, (T0356)L163.CB) [> 3.9297 = 6.5495 < 8.5143] w=0.0544 to align # Constraint # added constraint: constraint((T0356)P129.CB, (T0356)F354.CB) [> 3.8962 = 6.4937 < 8.4418] w=0.0544 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)F354.CB) [> 3.7794 = 6.2989 < 8.1886] w=0.0544 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)Y355.CB) [> 3.8609 = 6.4348 < 8.3653] w=0.0544 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)A269.CB) [> 3.8927 = 6.4878 < 8.4341] w=0.0544 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)F304.CB) [> 4.6409 = 7.7349 < 10.0553] w=0.0544 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)F354.CB) [> 3.2944 = 5.4907 < 7.1378] w=0.0544 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)V385.CB) [> 3.8698 = 6.4497 < 8.3847] w=0.0544 to align # Constraint # added constraint: constraint((T0356)A93.CB, (T0356)T322.CB) [> 3.9608 = 6.6013 < 8.5816] w=0.0544 to align # Constraint # added constraint: constraint((T0356)I271.CB, (T0356)F304.CB) [> 3.5464 = 5.9107 < 7.6840] w=0.0544 to align # Constraint # added constraint: constraint((T0356)I271.CB, (T0356)I316.CB) [> 3.1866 = 5.3109 < 6.9042] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L273.CB, (T0356)H291.CB) [> 2.6521 = 4.4202 < 5.7463] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L273.CB, (T0356)T292.CB) [> 4.7476 = 7.9127 < 10.2865] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L273.CB, (T0356)G293.CA) [> 4.1294 = 6.8823 < 8.9470] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L273.CB, (T0356)F304.CB) [> 4.3962 = 7.3270 < 9.5251] w=0.0544 to align # Constraint # added constraint: constraint((T0356)S268.CB, (T0356)Y294.CB) [> 4.1214 = 6.8690 < 8.9297] w=0.0544 to align # Constraint # added constraint: constraint((T0356)A269.CB, (T0356)D290.CB) [> 3.6939 = 6.1564 < 8.0034] w=0.0544 to align # Constraint # added constraint: constraint((T0356)E270.CB, (T0356)T292.CB) [> 3.9830 = 6.6384 < 8.6299] w=0.0544 to align # Constraint # added constraint: constraint((T0356)E270.CB, (T0356)Y294.CB) [> 3.4737 = 5.7894 < 7.5263] w=0.0544 to align # Constraint # added constraint: constraint((T0356)T292.CB, (T0356)S319.CB) [> 4.3914 = 7.3190 < 9.5147] w=0.0544 to align # Constraint # added constraint: constraint((T0356)E274.CB, (T0356)Y288.CB) [> 4.4784 = 7.4640 < 9.7032] w=0.0544 to align # Constraint # added constraint: constraint((T0356)E274.CB, (T0356)G289.CA) [> 3.8605 = 6.4342 < 8.3645] w=0.0544 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)Y288.CB) [> 3.4546 = 5.7577 < 7.4850] w=0.0544 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)G289.CA) [> 3.0190 = 5.0317 < 6.5412] w=0.0544 to align # Constraint # added constraint: constraint((T0356)G289.CA, (T0356)F304.CB) [> 4.3855 = 7.3092 < 9.5020] w=0.0544 to align # Constraint # added constraint: constraint((T0356)I178.CB, (T0356)Y317.CB) [> 4.3780 = 7.2966 < 9.4856] w=0.0544 to align # Constraint # added constraint: constraint((T0356)R180.CB, (T0356)V255.CB) [> 3.9672 = 6.6120 < 8.5956] w=0.0544 to align # Constraint # added constraint: constraint((T0356)R180.CB, (T0356)I271.CB) [> 3.9672 = 6.6120 < 8.5956] w=0.0544 to align # Constraint # added constraint: constraint((T0356)R180.CB, (T0356)L273.CB) [> 3.9602 = 6.6003 < 8.5804] w=0.0544 to align # Constraint # added constraint: constraint((T0356)R180.CB, (T0356)E313.CB) [> 3.8870 = 6.4784 < 8.4219] w=0.0544 to align # Constraint # added constraint: constraint((T0356)L183.CB, (T0356)R312.CB) [> 4.4871 = 7.4785 < 9.7221] w=0.0544 to align # Constraint # added constraint: constraint((T0356)K252.CB, (T0356)Y288.CB) [> 2.6522 = 4.4204 < 5.7465] w=0.0544 to align # Constraint # added constraint: constraint((T0356)T253.CB, (T0356)Y288.CB) [> 3.6620 = 6.1033 < 7.9343] w=0.0544 to align # Constraint # added constraint: constraint((T0356)E254.CB, (T0356)G275.CA) [> 4.4438 = 7.4063 < 9.6282] w=0.0544 to align # Constraint # added constraint: constraint((T0356)E254.CB, (T0356)Y288.CB) [> 3.0971 = 5.1618 < 6.7104] w=0.0544 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)P234.CB) [> 3.0496 = 5.0826 < 6.6074] w=0.0532 to align # Constraint # added constraint: constraint((T0356)Y242.CB, (T0356)S319.CB) [> 3.3161 = 5.5268 < 7.1848] w=0.0532 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)E278.CB) [> 4.0209 = 6.7014 < 8.7119] w=0.0532 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)E278.CB) [> 3.2778 = 5.4630 < 7.1019] w=0.0532 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)P234.CB) [> 4.7744 = 7.9574 < 10.3446] w=0.0532 to align # Constraint # added constraint: constraint((T0356)E53.CB, (T0356)S136.CB) [> 4.3427 = 7.2379 < 9.4092] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)I178.CB) [> 4.2927 = 7.1545 < 9.3008] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)L95.CB) [> 4.2845 = 7.1407 < 9.2830] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)V165.CB) [> 4.5171 = 7.5286 < 9.7872] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)I178.CB) [> 3.8702 = 6.4504 < 8.3855] w=0.0510 to align # Constraint # added constraint: constraint((T0356)P55.CB, (T0356)V135.CB) [> 2.4374 = 4.0623 < 5.2811] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)V135.CB) [> 4.3674 = 7.2791 < 9.4628] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L63.CB, (T0356)I178.CB) [> 4.3674 = 7.2791 < 9.4628] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L33.CB, (T0356)V165.CB) [> 4.1962 = 6.9937 < 9.0919] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L33.CB, (T0356)L183.CB) [> 4.1954 = 6.9922 < 9.0899] w=0.0510 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)C64.CB) [> 4.4744 = 7.4573 < 9.6945] w=0.0510 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)N65.CB) [> 4.7465 = 7.9108 < 10.2840] w=0.0510 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)V165.CB) [> 3.8844 = 6.4739 < 8.4161] w=0.0510 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)I178.CB) [> 2.3852 = 3.9753 < 5.1679] w=0.0510 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)Y179.CB) [> 4.6035 = 7.6725 < 9.9742] w=0.0510 to align # Constraint # added constraint: constraint((T0356)A49.CB, (T0356)R180.CB) [> 4.3756 = 7.2926 < 9.4804] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)V165.CB) [> 1.9888 = 3.3147 < 4.3092] w=0.0510 to align # Constraint # added constraint: constraint((T0356)I35.CB, (T0356)L183.CB) [> 2.1964 = 3.6607 < 4.7589] w=0.0510 to align # Constraint # added constraint: constraint((T0356)G47.CA, (T0356)Q181.CB) [> 4.4133 = 7.3556 < 9.5622] w=0.0510 to align # Constraint # added constraint: constraint((T0356)I159.CB, (T0356)R192.CB) [> 4.2970 = 7.1617 < 9.3102] w=0.0510 to align # Constraint # added constraint: constraint((T0356)T305.CB, (T0356)R364.CB) [> 4.0654 = 6.7757 < 8.8084] w=0.0510 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)V367.CB) [> 4.6042 = 7.6737 < 9.9758] w=0.0510 to align # Constraint # added constraint: constraint((T0356)V255.CB, (T0356)V367.CB) [> 4.0623 = 6.7705 < 8.8017] w=0.0510 to align # Constraint # added constraint: constraint((T0356)V135.CB, (T0356)G162.CA) [> 3.8511 = 6.4185 < 8.3441] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L118.CB, (T0356)P157.CB) [> 4.4899 = 7.4831 < 9.7280] w=0.0510 to align # Constraint # added constraint: constraint((T0356)L142.CB, (T0356)I351.CB) [> 3.2838 = 5.4730 < 7.1149] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L142.CB, (T0356)V219.CB) [> 3.9881 = 6.6468 < 8.6408] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L142.CB, (T0356)T160.CB) [> 3.9678 = 6.6129 < 8.5968] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V140.CB, (T0356)I351.CB) [> 3.4920 = 5.8200 < 7.5661] w=0.0501 to align # Constraint # added constraint: constraint((T0356)D139.CB, (T0356)I351.CB) [> 3.0691 = 5.1152 < 6.6498] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I147.CB, (T0356)V217.CB) [> 3.5896 = 5.9827 < 7.7775] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I147.CB, (T0356)P216.CB) [> 2.3101 = 3.8501 < 5.0051] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I147.CB, (T0356)T160.CB) [> 2.8512 = 4.7520 < 6.1777] w=0.0501 to align # Constraint # added constraint: constraint((T0356)P146.CB, (T0356)L488.CB) [> 4.6688 = 7.7814 < 10.1158] w=0.0501 to align # Constraint # added constraint: constraint((T0356)P146.CB, (T0356)M393.CB) [> 4.7143 = 7.8571 < 10.2142] w=0.0501 to align # Constraint # added constraint: constraint((T0356)P146.CB, (T0356)V217.CB) [> 2.9277 = 4.8796 < 6.3434] w=0.0501 to align # Constraint # added constraint: constraint((T0356)P146.CB, (T0356)P216.CB) [> 4.6258 = 7.7097 < 10.0226] w=0.0501 to align # Constraint # added constraint: constraint((T0356)P146.CB, (T0356)F215.CB) [> 4.7238 = 7.8730 < 10.2349] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I145.CB, (T0356)M393.CB) [> 4.1200 = 6.8666 < 8.9266] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I145.CB, (T0356)V219.CB) [> 3.1737 = 5.2895 < 6.8763] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I145.CB, (T0356)V217.CB) [> 3.6612 = 6.1020 < 7.9326] w=0.0501 to align # Constraint # added constraint: constraint((T0356)N143.CB, (T0356)M393.CB) [> 4.3273 = 7.2122 < 9.3759] w=0.0501 to align # Constraint # added constraint: constraint((T0356)N143.CB, (T0356)I351.CB) [> 3.6117 = 6.0195 < 7.8253] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L142.CB, (T0356)M393.CB) [> 4.7892 = 7.9820 < 10.3766] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A128.CB, (T0356)L142.CB) [> 4.7077 = 7.8461 < 10.1999] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A128.CB, (T0356)D141.CB) [> 3.7347 = 6.2245 < 8.0919] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A128.CB, (T0356)G137.CA) [> 2.8493 = 4.7488 < 6.1734] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)F244.CB) [> 3.1321 = 5.2201 < 6.7861] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)K396.CB) [> 4.1396 = 6.8993 < 8.9691] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)T395.CB) [> 4.5019 = 7.5031 < 9.7541] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V217.CB, (T0356)Y394.CB) [> 3.2510 = 5.4184 < 7.0439] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I147.CB, (T0356)S218.CB) [> 3.9206 = 6.5343 < 8.4946] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I147.CB, (T0356)V256.CB) [> 4.4054 = 7.3423 < 9.5450] w=0.0501 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)P216.CB) [> 4.3721 = 7.2868 < 9.4729] w=0.0501 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)V217.CB) [> 2.7124 = 4.5206 < 5.8768] w=0.0501 to align # Constraint # added constraint: constraint((T0356)T160.CB, (T0356)S218.CB) [> 4.3374 = 7.2290 < 9.3978] w=0.0501 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)V217.CB) [> 4.6319 = 7.7198 < 10.0358] w=0.0501 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)S218.CB) [> 3.3215 = 5.5359 < 7.1967] w=0.0501 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)V219.CB) [> 4.7681 = 7.9469 < 10.3309] w=0.0501 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)A220.CB) [> 4.0610 = 6.7683 < 8.7988] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)V217.CB) [> 3.9189 = 6.5315 < 8.4909] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G162.CA, (T0356)F244.CB) [> 4.1220 = 6.8700 < 8.9310] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)L221.CB) [> 4.1948 = 6.9913 < 9.0887] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)A223.CB) [> 4.4467 = 7.4111 < 9.6344] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)G222.CA) [> 3.0709 = 5.1181 < 6.6536] w=0.0501 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)F244.CB) [> 3.5950 = 5.9917 < 7.7892] w=0.0501 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)G222.CA) [> 4.4382 = 7.3971 < 9.6162] w=0.0501 to align # Constraint # added constraint: constraint((T0356)P31.CB, (T0356)L63.CB) [> 4.0632 = 6.7720 < 8.8035] w=0.0501 to align # Constraint # added constraint: constraint((T0356)H32.CB, (T0356)L63.CB) [> 2.5366 = 4.2276 < 5.4959] w=0.0501 to align # Constraint # added constraint: constraint((T0356)H32.CB, (T0356)C64.CB) [> 4.7620 = 7.9366 < 10.3176] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)T160.CB) [> 4.4129 = 7.3548 < 9.5613] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)W161.CB) [> 2.6595 = 4.4325 < 5.7622] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L50.CB, (T0356)G162.CA) [> 4.0017 = 6.6695 < 8.6703] w=0.0501 to align # Constraint # added constraint: constraint((T0356)F52.CB, (T0356)W161.CB) [> 4.7588 = 7.9313 < 10.3107] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)G162.CA) [> 3.0584 = 5.0974 < 6.6266] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)W161.CB) [> 4.3592 = 7.2653 < 9.4450] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)T160.CB) [> 3.7195 = 6.1993 < 8.0590] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L51.CB, (T0356)L142.CB) [> 4.2387 = 7.0645 < 9.1838] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G103.CA, (T0356)V400.CB) [> 3.6967 = 6.1611 < 8.0094] w=0.0501 to align # Constraint # added constraint: constraint((T0356)E87.CB, (T0356)Y321.CB) [> 4.4363 = 7.3938 < 9.6119] w=0.0501 to align # Constraint # added constraint: constraint((T0356)D403.CB, (T0356)D439.CB) [> 4.4058 = 7.3430 < 9.5459] w=0.0501 to align # Constraint # added constraint: constraint((T0356)T395.CB, (T0356)I417.CB) [> 3.0646 = 5.1076 < 6.6399] w=0.0501 to align # Constraint # added constraint: constraint((T0356)Q279.CB, (T0356)H291.CB) [> 4.7358 = 7.8929 < 10.2608] w=0.0501 to align # Constraint # added constraint: constraint((T0356)Y321.CB, (T0356)R408.CB) [> 3.1252 = 5.2087 < 6.7712] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A407.CB, (T0356)F440.CB) [> 3.5652 = 5.9421 < 7.7247] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A407.CB, (T0356)G452.CA) [> 2.7925 = 4.6541 < 6.0504] w=0.0501 to align # Constraint # added constraint: constraint((T0356)R408.CB, (T0356)S442.CB) [> 3.7526 = 6.2544 < 8.1307] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V235.CB, (T0356)Y288.CB) [> 4.7859 = 7.9766 < 10.3695] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)T322.CB) [> 2.4915 = 4.1525 < 5.3983] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)Y276.CB) [> 4.4415 = 7.4025 < 9.6232] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)G275.CA) [> 2.6302 = 4.3836 < 5.6987] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V255.CB, (T0356)Y276.CB) [> 4.6751 = 7.7918 < 10.1294] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)T395.CB) [> 2.7560 = 4.5933 < 5.9713] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V219.CB, (T0356)K396.CB) [> 4.2175 = 7.0292 < 9.1379] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)T395.CB) [> 4.6788 = 7.7980 < 10.1374] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)K396.CB) [> 3.1000 = 5.1667 < 6.7167] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)F397.CB) [> 4.6897 = 7.8162 < 10.1611] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A220.CB, (T0356)V398.CB) [> 3.8513 = 6.4188 < 8.3445] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)Y317.CB) [> 4.3646 = 7.2743 < 9.4565] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)H318.CB) [> 3.2350 = 5.3917 < 7.0092] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)T395.CB) [> 3.3309 = 5.5515 < 7.2170] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)K396.CB) [> 4.1487 = 6.9144 < 8.9888] w=0.0501 to align # Constraint # added constraint: constraint((T0356)P234.CB, (T0356)T322.CB) [> 4.1196 = 6.8660 < 8.9258] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)S319.CB) [> 4.1765 = 6.9609 < 9.0492] w=0.0501 to align # Constraint # added constraint: constraint((T0356)A223.CB, (T0356)H318.CB) [> 3.3608 = 5.6013 < 7.2817] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)V400.CB) [> 4.6675 = 7.7791 < 10.1129] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)I399.CB) [> 3.8295 = 6.3826 < 8.2973] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)V398.CB) [> 2.6562 = 4.4269 < 5.7550] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)F397.CB) [> 3.6332 = 6.0554 < 7.8720] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G222.CA, (T0356)H318.CB) [> 3.8516 = 6.4194 < 8.3452] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)I417.CB) [> 4.3084 = 7.1806 < 9.3348] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)V398.CB) [> 4.1893 = 6.9822 < 9.0768] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L221.CB, (T0356)F397.CB) [> 2.8284 = 4.7140 < 6.1282] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L263.CB, (T0356)Y321.CB) [> 3.1151 = 5.1918 < 6.7494] w=0.0501 to align # Constraint # added constraint: constraint((T0356)G275.CA, (T0356)Y317.CB) [> 4.1014 = 6.8356 < 8.8863] w=0.0501 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)C401.CB) [> 3.1023 = 5.1705 < 6.7216] w=0.0501 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)V400.CB) [> 4.2693 = 7.1155 < 9.2501] w=0.0501 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)I399.CB) [> 3.8744 = 6.4573 < 8.3945] w=0.0501 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)T322.CB) [> 3.7025 = 6.1708 < 8.0220] w=0.0501 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)Y321.CB) [> 3.3615 = 5.6025 < 7.2832] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)V400.CB) [> 4.4533 = 7.4222 < 9.6489] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)I399.CB) [> 3.7251 = 6.2084 < 8.0710] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)V398.CB) [> 4.7858 = 7.9763 < 10.3692] w=0.0501 to align # Constraint # added constraint: constraint((T0356)V256.CB, (T0356)F397.CB) [> 4.7748 = 7.9580 < 10.3453] w=0.0501 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)G323.CA) [> 3.1981 = 5.3302 < 6.9293] w=0.0501 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)T322.CB) [> 4.3898 = 7.3163 < 9.5112] w=0.0501 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)Y321.CB) [> 3.1479 = 5.2466 < 6.8205] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)G323.CA) [> 2.2588 = 3.7647 < 4.8941] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)T322.CB) [> 3.4724 = 5.7874 < 7.5236] w=0.0501 to align # Constraint # added constraint: constraint((T0356)I259.CB, (T0356)Y321.CB) [> 4.4345 = 7.3907 < 9.6080] w=0.0501 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)A407.CB) [> 3.3643 = 5.6071 < 7.2893] w=0.0501 to align # Constraint # added constraint: constraint((T0356)C258.CB, (T0356)V405.CB) [> 4.4670 = 7.4449 < 9.6784] w=0.0501 to align # Constraint # added constraint: constraint((T0356)L142.CB, (T0356)K188.CB) [> 3.8635 = 6.4391 < 8.3709] w=0.0497 to align # Constraint # added constraint: constraint((T0356)L142.CB, (T0356)T320.CB) [> 4.3070 = 7.1782 < 9.3317] w=0.0497 to align # Constraint # added constraint: constraint((T0356)N143.CB, (T0356)N187.CB) [> 4.3261 = 7.2102 < 9.3733] w=0.0497 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)V306.CB) [> 4.7363 = 7.8939 < 10.2621] w=0.0497 to align # Constraint # added constraint: constraint((T0356)R192.CB, (T0356)T305.CB) [> 3.4095 = 5.6826 < 7.3874] w=0.0497 to align # Constraint # added constraint: constraint((T0356)Y203.CB, (T0356)V303.CB) [> 3.0739 = 5.1231 < 6.6600] w=0.0497 to align # Constraint # added constraint: constraint((T0356)Q131.CB, (T0356)I259.CB) [> 3.7707 = 6.2845 < 8.1699] w=0.0265 to align # Constraint # added constraint: constraint((T0356)Q131.CB, (T0356)C258.CB) [> 2.9489 = 4.9148 < 6.3892] w=0.0265 to align # Constraint # added constraint: constraint((T0356)R124.CB, (T0356)D141.CB) [> 4.6682 = 7.7803 < 10.1144] w=0.0265 to align # Constraint # added constraint: constraint((T0356)V140.CB, (T0356)V217.CB) [> 3.9395 = 6.5658 < 8.5355] w=0.0265 to align # Constraint # added constraint: constraint((T0356)I134.CB, (T0356)V255.CB) [> 2.6071 = 4.3452 < 5.6487] w=0.0265 to align # Constraint # added constraint: constraint((T0356)M75.CB, (T0356)E87.CB) [> 4.6284 = 7.7140 < 10.0282] w=0.0265 to align # Constraint # added constraint: constraint((T0356)W386.CB, (T0356)W415.CB) [> 3.3819 = 5.6366 < 7.3275] w=0.0265 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)D403.CB) [> 3.7564 = 6.2607 < 8.1390] w=0.0265 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)C401.CB) [> 3.9423 = 6.5705 < 8.5417] w=0.0265 to align # Constraint # added constraint: constraint((T0356)L163.CB, (T0356)Y203.CB) [> 2.9188 = 4.8647 < 6.3241] w=0.0265 to align # Constraint # added constraint: constraint((T0356)W161.CB, (T0356)G198.CA) [> 4.0437 = 6.7396 < 8.7614] w=0.0265 to align # Constraint # added constraint: constraint((T0356)P146.CB, (T0356)S195.CB) [> 3.9777 = 6.6295 < 8.6184] w=0.0265 to align # Constraint # added constraint: constraint((T0356)I145.CB, (T0356)T164.CB) [> 4.7854 = 7.9756 < 10.3683] w=0.0265 to align # Constraint # added constraint: constraint((T0356)I145.CB, (T0356)G162.CA) [> 2.8247 = 4.7079 < 6.1203] w=0.0265 to align # Constraint # added constraint: constraint((T0356)V140.CB, (T0356)V256.CB) [> 4.0486 = 6.7477 < 8.7720] w=0.0265 to align # Constraint # added constraint: constraint((T0356)V140.CB, (T0356)E254.CB) [> 2.9216 = 4.8694 < 6.3302] w=0.0265 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)V400.CB) [> 4.1522 = 6.9204 < 8.9965] w=0.0265 to align # Constraint # added constraint: constraint((T0356)V165.CB, (T0356)I178.CB) [> 4.2095 = 7.0158 < 9.1206] w=0.0177 to align # Constraint # added constraint: constraint((T0356)T164.CB, (T0356)I178.CB) [> 2.4940 = 4.1567 < 5.4037] w=0.0177 to align # Constraint # added constraint: constraint((T0356)P146.CB, (T0356)L336.CB) [> 3.6411 = 6.0686 < 7.8892] w=0.0177 to align # Constraint # added constraint: constraint((T0356)V405.CB, (T0356)A455.CB) [> 3.5480 = 5.9132 < 7.6872] w=0.0177 to align # Constraint # added constraint: constraint((T0356)D403.CB, (T0356)T456.CB) [> 3.6254 = 6.0423 < 7.8550] w=0.0177 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)V385.CB) [> 2.8590 = 4.7650 < 6.1945] w=0.0177 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)C401.CB) [> 3.5630 = 5.9384 < 7.7199] w=0.0177 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)V385.CB) [> 3.0743 = 5.1238 < 6.6609] w=0.0177 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)K396.CB) [> 3.3142 = 5.5236 < 7.1807] w=0.0177 to align # Constraint # added constraint: constraint((T0356)S260.CB, (T0356)G289.CA) [> 4.6957 = 7.8262 < 10.1740] w=0.0088 to align # Constraint # added constraint: constraint((T0356)H318.CB, (T0356)D454.CB) [> 3.7140 = 6.1900 < 8.0470] w=0.0088 to align # Constraint # added constraint: constraint((T0356)R144.CB, (T0356)A283.CB) [> 3.8852 = 6.4753 < 8.4179] w=0.0088 to align # Constraint # added constraint: constraint((T0356)R144.CB, (T0356)Q311.CB) [> 3.8683 = 6.4472 < 8.3813] w=0.0088 to align # Constraint # added constraint: constraint((T0356)V367.CB, (T0356)K396.CB) [> 2.8822 = 4.8037 < 6.2448] w=0.0088 to align # Constraint # added constraint: constraint((T0356)V368.CB, (T0356)V385.CB) [> 3.0802 = 5.1337 < 6.6738] w=0.0088 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)M382.CB) [> 2.7236 = 4.5394 < 5.9012] w=0.0088 to align # Constraint # added constraint: constraint((T0356)L365.CB, (T0356)V400.CB) [> 4.4723 = 7.4538 < 9.6900] w=0.0088 to align # Constraint # added constraint: constraint((T0356)A366.CB, (T0356)C401.CB) [> 2.7963 = 4.6605 < 6.0587] w=0.0088 to align # Constraint # added constraint: constraint((T0356)A407.CB, (T0356)A455.CB) [> 3.5377 = 5.8961 < 7.6649] w=0.0088 to align # Constraint # added constraint: constraint((T0356)A378.CB, (T0356)A407.CB) [> 3.7559 = 6.2599 < 8.1379] w=0.0088 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)V385.CB) [> 3.4858 = 5.8097 < 7.5527] w=0.0088 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)I399.CB) [> 3.9418 = 6.5697 < 8.5406] w=0.0088 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)V400.CB) [> 3.4060 = 5.6766 < 7.3796] w=0.0088 to align # Constraint # added constraint: constraint((T0356)R364.CB, (T0356)C401.CB) [> 4.3285 = 7.2141 < 9.3784] w=0.0088 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0356/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0356/decoys/ # ReadConformPDB reading from PDB file 2nd-chimera-domain-1-and-2-and-3+tag.pdb.gz looking for model 1 # Found a chain break before 496 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file 2nd-chimera-domain-1-and-2-and-3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # ReadConformPDB reading from PDB file 2nd-chimera-domain-1-and-2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # ReadConformPDB reading from PDB file 3rd-chimera-domain-1-and-2-and-3+tag.pdb.gz looking for model 1 # Found a chain break before 496 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file 3rd-chimera-domain-1-and-2-and-3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # ReadConformPDB reading from PDB file 3rd-chimera-domain-1-and-2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # ReadConformPDB reading from PDB file chimera-domain-1-and-2-and-3-proteinshop+tag.pdb.gz looking for model 1 # Found a chain break before 496 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file chimera-domain-1-and-2-and-3-proteinshop.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # ReadConformPDB reading from PDB file chimera-domain-1-and-2-and-3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # Found a chain break before 494 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # Found a chain break before 494 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 415 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 471 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 457 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 468 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 380 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 457 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 474 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 501 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 490 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 501 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 401 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 504 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 468 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 468 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 504 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 485 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # Found a chain break before 477 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # Found a chain break before 485 # copying to AlignedFragments data structure # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 471 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 376 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 457 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 422 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 473 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 504 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # Found a chain break before 499 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # Found a chain break before 447 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 491 in servers/HHpred2_TS1.pdb.gz # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 499 in servers/HHpred3_TS1.pdb.gz # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # Found a chain break before 460 # copying to AlignedFragments data structure # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server2_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server2_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server2_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server2_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server2_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 504 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 502 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 504 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 503 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 502 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # Found a chain break before 301 # copying to AlignedFragments data structure # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS1.pdb.gz looking for model 1 # Found a chain break before 469 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation POMYSL_TS2 # ReadConformPDB reading from PDB file servers/POMYSL_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation POMYSL_TS3 # ReadConformPDB reading from PDB file servers/POMYSL_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation POMYSL_TS4 # ReadConformPDB reading from PDB file servers/POMYSL_TS5.pdb.gz looking for model 1 # Found a chain break before 474 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # Found a chain break before 504 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 498 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 498 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 427 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 472 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 466 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 433 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 495 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 469 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 498 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 394 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 488 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 447 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 497 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 390 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 323 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 323 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)M4.CA and (T0356)M4.CB only 0.000 apart, marking (T0356)M4.CB as missing WARNING: atoms too close: (T0356)N7.CA and (T0356)N7.CB only 0.000 apart, marking (T0356)N7.CB as missing WARNING: atoms too close: (T0356)D11.CA and (T0356)D11.CB only 0.000 apart, marking (T0356)D11.CB as missing WARNING: atoms too close: (T0356)L13.CA and (T0356)L13.CB only 0.000 apart, marking (T0356)L13.CB as missing WARNING: atoms too close: (T0356)L22.CA and (T0356)L22.CB only 0.000 apart, marking (T0356)L22.CB as missing WARNING: atoms too close: (T0356)V29.CA and (T0356)V29.CB only 0.000 apart, marking (T0356)V29.CB as missing WARNING: atoms too close: (T0356)I35.CA and (T0356)I35.CB only 0.000 apart, marking (T0356)I35.CB as missing WARNING: atoms too close: (T0356)T36.CA and (T0356)T36.CB only 0.000 apart, marking (T0356)T36.CB as missing WARNING: atoms too close: (T0356)E53.CA and (T0356)E53.CB only 0.000 apart, marking (T0356)E53.CB as missing WARNING: atoms too close: (T0356)L63.CA and (T0356)L63.CB only 0.000 apart, marking (T0356)L63.CB as missing WARNING: atoms too close: (T0356)F67.CA and (T0356)F67.CB only 0.000 apart, marking (T0356)F67.CB as missing WARNING: atoms too close: (T0356)T69.CA and (T0356)T69.CB only 0.000 apart, marking (T0356)T69.CB as missing WARNING: atoms too close: (T0356)K71.CA and (T0356)K71.CB only 0.000 apart, marking (T0356)K71.CB as missing WARNING: atoms too close: (T0356)Q79.CA and (T0356)Q79.CB only 0.000 apart, marking (T0356)Q79.CB as missing WARNING: atoms too close: (T0356)E80.CA and (T0356)E80.CB only 0.000 apart, marking (T0356)E80.CB as missing WARNING: atoms too close: (T0356)A84.CA and (T0356)A84.CB only 0.000 apart, marking (T0356)A84.CB as missing WARNING: atoms too close: (T0356)K90.CA and (T0356)K90.CB only 0.000 apart, marking (T0356)K90.CB as missing WARNING: atoms too close: (T0356)L92.CA and (T0356)L92.CB only 0.000 apart, marking (T0356)L92.CB as missing WARNING: atoms too close: (T0356)E97.CA and (T0356)E97.CB only 0.000 apart, marking (T0356)E97.CB as missing WARNING: atoms too close: (T0356)F108.CA and (T0356)F108.CB only 0.000 apart, marking (T0356)F108.CB as missing WARNING: atoms too close: (T0356)Q113.CA and (T0356)Q113.CB only 0.000 apart, marking (T0356)Q113.CB as missing WARNING: atoms too close: (T0356)F114.CA and (T0356)F114.CB only 0.000 apart, marking (T0356)F114.CB as missing WARNING: atoms too close: (T0356)L125.CA and (T0356)L125.CB only 0.000 apart, marking (T0356)L125.CB as missing WARNING: atoms too close: (T0356)Q131.CA and (T0356)Q131.CB only 0.000 apart, marking (T0356)Q131.CB as missing WARNING: atoms too close: (T0356)V135.CA and (T0356)V135.CB only 0.000 apart, marking (T0356)V135.CB as missing WARNING: atoms too close: (T0356)D141.CA and (T0356)D141.CB only 0.000 apart, marking (T0356)D141.CB as missing WARNING: atoms too close: (T0356)I147.CA and (T0356)I147.CB only 0.000 apart, marking (T0356)I147.CB as missing WARNING: atoms too close: (T0356)W151.CA and (T0356)W151.CB only 0.000 apart, marking (T0356)W151.CB as missing WARNING: atoms too close: (T0356)L158.CA and (T0356)L158.CB only 0.000 apart, marking (T0356)L158.CB as missing WARNING: atoms too close: (T0356)T160.CA and (T0356)T160.CB only 0.000 apart, marking (T0356)T160.CB as missing WARNING: atoms too close: (T0356)K171.CA and (T0356)K171.CB only 0.000 apart, marking (T0356)K171.CB as missing WARNING: atoms too close: (T0356)L189.CA and (T0356)L189.CB only 0.000 apart, marking (T0356)L189.CB as missing WARNING: atoms too close: (T0356)I190.CA and (T0356)I190.CB only 0.000 apart, marking (T0356)I190.CB as missing WARNING: atoms too close: (T0356)W193.CA and (T0356)W193.CB only 0.000 apart, marking (T0356)W193.CB as missing WARNING: atoms too close: (T0356)V219.CA and (T0356)V219.CB only 0.000 apart, marking (T0356)V219.CB as missing WARNING: atoms too close: (T0356)L229.CA and (T0356)L229.CB only 0.000 apart, marking (T0356)L229.CB as missing WARNING: atoms too close: (T0356)P234.CA and (T0356)P234.CB only 0.000 apart, marking (T0356)P234.CB as missing WARNING: atoms too close: (T0356)L239.CA and (T0356)L239.CB only 0.000 apart, marking (T0356)L239.CB as missing WARNING: atoms too close: (T0356)L247.CA and (T0356)L247.CB only 0.000 apart, marking (T0356)L247.CB as missing WARNING: atoms too close: (T0356)R249.CA and (T0356)R249.CB only 0.000 apart, marking (T0356)R249.CB as missing WARNING: atoms too close: (T0356)T251.CA and (T0356)T251.CB only 0.000 apart, marking (T0356)T251.CB as missing WARNING: atoms too close: (T0356)K252.CA and (T0356)K252.CB only 0.000 apart, marking (T0356)K252.CB as missing WARNING: atoms too close: (T0356)V255.CA and (T0356)V255.CB only 0.000 apart, marking (T0356)V255.CB as missing WARNING: atoms too close: (T0356)K257.CA and (T0356)K257.CB only 0.000 apart, marking (T0356)K257.CB as missing WARNING: atoms too close: (T0356)I259.CA and (T0356)I259.CB only 0.000 apart, marking (T0356)I259.CB as missing WARNING: atoms too close: (T0356)L263.CA and (T0356)L263.CB only 0.000 apart, marking (T0356)L263.CB as missing WARNING: atoms too close: (T0356)V265.CA and (T0356)V265.CB only 0.000 apart, marking (T0356)V265.CB as missing WARNING: atoms too close: (T0356)P266.CA and (T0356)P266.CB only 0.000 apart, marking (T0356)P266.CB as missing WARNING: atoms too close: (T0356)E274.CA and (T0356)E274.CB only 0.000 apart, marking (T0356)E274.CB as missing WARNING: atoms too close: (T0356)E281.CA and (T0356)E281.CB only 0.000 apart, marking (T0356)E281.CB as missing WARNING: atoms too close: (T0356)Y295.CA and (T0356)Y295.CB only 0.000 apart, marking (T0356)Y295.CB as missing WARNING: atoms too close: (T0356)P302.CA and (T0356)P302.CB only 0.000 apart, marking (T0356)P302.CB as missing WARNING: atoms too close: (T0356)P325.CA and (T0356)P325.CB only 0.000 apart, marking (T0356)P325.CB as missing WARNING: atoms too close: (T0356)D327.CA and (T0356)D327.CB only 0.000 apart, marking (T0356)D327.CB as missing WARNING: atoms too close: (T0356)E328.CA and (T0356)E328.CB only 0.000 apart, marking (T0356)E328.CB as missing WARNING: atoms too close: (T0356)L336.CA and (T0356)L336.CB only 0.000 apart, marking (T0356)L336.CB as missing WARNING: atoms too close: (T0356)P342.CA and (T0356)P342.CB only 0.000 apart, marking (T0356)P342.CB as missing WARNING: atoms too close: (T0356)I343.CA and (T0356)I343.CB only 0.000 apart, marking (T0356)I343.CB as missing WARNING: atoms too close: (T0356)Q347.CA and (T0356)Q347.CB only 0.000 apart, marking (T0356)Q347.CB as missing WARNING: atoms too close: (T0356)F348.CA and (T0356)F348.CB only 0.000 apart, marking (T0356)F348.CB as missing WARNING: atoms too close: (T0356)I351.CA and (T0356)I351.CB only 0.000 apart, marking (T0356)I351.CB as missing WARNING: atoms too close: (T0356)P357.CA and (T0356)P357.CB only 0.000 apart, marking (T0356)P357.CB as missing WARNING: atoms too close: (T0356)R364.CA and (T0356)R364.CB only 0.000 apart, marking (T0356)R364.CB as missing WARNING: atoms too close: (T0356)L365.CA and (T0356)L365.CB only 0.000 apart, marking (T0356)L365.CB as missing WARNING: atoms too close: (T0356)K372.CA and (T0356)K372.CB only 0.000 apart, marking (T0356)K372.CB as missing WARNING: atoms too close: (T0356)Q373.CA and (T0356)Q373.CB only 0.000 apart, marking (T0356)Q373.CB as missing WARNING: atoms too close: (T0356)A375.CA and (T0356)A375.CB only 0.000 apart, marking (T0356)A375.CB as missing WARNING: atoms too close: (T0356)A378.CA and (T0356)A378.CB only 0.000 apart, marking (T0356)A378.CB as missing WARNING: atoms too close: (T0356)V381.CA and (T0356)V381.CB only 0.000 apart, marking (T0356)V381.CB as missing WARNING: atoms too close: (T0356)M383.CA and (T0356)M383.CB only 0.000 apart, marking (T0356)M383.CB as missing WARNING: atoms too close: (T0356)V400.CA and (T0356)V400.CB only 0.000 apart, marking (T0356)V400.CB as missing WARNING: atoms too close: (T0356)R408.CA and (T0356)R408.CB only 0.000 apart, marking (T0356)R408.CB as missing WARNING: atoms too close: (T0356)D409.CA and (T0356)D409.CB only 0.000 apart, marking (T0356)D409.CB as missing WARNING: atoms too close: (T0356)W410.CA and (T0356)W410.CB only 0.000 apart, marking (T0356)W410.CB as missing WARNING: atoms too close: (T0356)D426.CA and (T0356)D426.CB only 0.000 apart, marking (T0356)D426.CB as missing WARNING: atoms too close: (T0356)T427.CA and (T0356)T427.CB only 0.000 apart, marking (T0356)T427.CB as missing WARNING: atoms too close: (T0356)D436.CA and (T0356)D436.CB only 0.000 apart, marking (T0356)D436.CB as missing WARNING: atoms too close: (T0356)Y437.CA and (T0356)Y437.CB only 0.000 apart, marking (T0356)Y437.CB as missing WARNING: atoms too close: (T0356)S445.CA and (T0356)S445.CB only 0.000 apart, marking (T0356)S445.CB as missing WARNING: atoms too close: (T0356)K450.CA and (T0356)K450.CB only 0.000 apart, marking (T0356)K450.CB as missing WARNING: atoms too close: (T0356)W459.CA and (T0356)W459.CB only 0.000 apart, marking (T0356)W459.CB as missing WARNING: atoms too close: (T0356)E466.CA and (T0356)E466.CB only 0.000 apart, marking (T0356)E466.CB as missing WARNING: atoms too close: (T0356)W467.CA and (T0356)W467.CB only 0.000 apart, marking (T0356)W467.CB as missing WARNING: atoms too close: (T0356)P470.CA and (T0356)P470.CB only 0.000 apart, marking (T0356)P470.CB as missing WARNING: atoms too close: (T0356)K473.CA and (T0356)K473.CB only 0.000 apart, marking (T0356)K473.CB as missing WARNING: atoms too close: (T0356)D476.CA and (T0356)D476.CB only 0.000 apart, marking (T0356)D476.CB as missing WARNING: atoms too close: (T0356)V478.CA and (T0356)V478.CB only 0.000 apart, marking (T0356)V478.CB as missing WARNING: atoms too close: (T0356)A479.CA and (T0356)A479.CB only 0.000 apart, marking (T0356)A479.CB as missing WARNING: atoms too close: (T0356)W485.CA and (T0356)W485.CB only 0.000 apart, marking (T0356)W485.CB as missing WARNING: atoms too close: (T0356)A497.CA and (T0356)A497.CB only 0.000 apart, marking (T0356)A497.CB as missing WARNING: atoms too close: (T0356)E499.CA and (T0356)E499.CB only 0.000 apart, marking (T0356)E499.CB as missing WARNING: atoms too close: (T0356)H505.CA and (T0356)H505.CB only 0.000 apart, marking (T0356)H505.CB as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)D8.CA and (T0356)D8.CB only 0.000 apart, marking (T0356)D8.CB as missing WARNING: atoms too close: (T0356)K23.CA and (T0356)K23.CB only 0.000 apart, marking (T0356)K23.CB as missing WARNING: atoms too close: (T0356)R24.CA and (T0356)R24.CB only 0.000 apart, marking (T0356)R24.CB as missing WARNING: atoms too close: (T0356)L27.CA and (T0356)L27.CB only 0.000 apart, marking (T0356)L27.CB as missing WARNING: atoms too close: (T0356)V29.CA and (T0356)V29.CB only 0.000 apart, marking (T0356)V29.CB as missing WARNING: atoms too close: (T0356)D30.CA and (T0356)D30.CB only 0.000 apart, marking (T0356)D30.CB as missing WARNING: atoms too close: (T0356)L51.CA and (T0356)L51.CB only 0.000 apart, marking (T0356)L51.CB as missing WARNING: atoms too close: (T0356)K56.CA and (T0356)K56.CB only 0.000 apart, marking (T0356)K56.CB as missing WARNING: atoms too close: (T0356)K71.CA and (T0356)K71.CB only 0.000 apart, marking (T0356)K71.CB as missing WARNING: atoms too close: (T0356)V73.CA and (T0356)V73.CB only 0.000 apart, marking (T0356)V73.CB as missing WARNING: atoms too close: (T0356)M77.CA and (T0356)M77.CB only 0.000 apart, marking (T0356)M77.CB as missing WARNING: atoms too close: (T0356)K90.CA and (T0356)K90.CB only 0.000 apart, marking (T0356)K90.CB as missing WARNING: atoms too close: (T0356)A93.CA and (T0356)A93.CB only 0.000 apart, marking (T0356)A93.CB as missing WARNING: atoms too close: (T0356)E99.CA and (T0356)E99.CB only 0.000 apart, marking (T0356)E99.CB as missing WARNING: atoms too close: (T0356)Q113.CA and (T0356)Q113.CB only 0.000 apart, marking (T0356)Q113.CB as missing WARNING: atoms too close: (T0356)S136.CA and (T0356)S136.CB only 0.000 apart, marking (T0356)S136.CB as missing WARNING: atoms too close: (T0356)D139.CA and (T0356)D139.CB only 0.000 apart, marking (T0356)D139.CB as missing WARNING: atoms too close: (T0356)I145.CA and (T0356)I145.CB only 0.000 apart, marking (T0356)I145.CB as missing WARNING: atoms too close: (T0356)T149.CA and (T0356)T149.CB only 0.000 apart, marking (T0356)T149.CB as missing WARNING: atoms too close: (T0356)P152.CA and (T0356)P152.CB only 0.000 apart, marking (T0356)P152.CB as missing WARNING: atoms too close: (T0356)L158.CA and (T0356)L158.CB only 0.000 apart, marking (T0356)L158.CB as missing WARNING: atoms too close: (T0356)I159.CA and (T0356)I159.CB only 0.000 apart, marking (T0356)I159.CB as missing WARNING: atoms too close: (T0356)L163.CA and (T0356)L163.CB only 0.000 apart, marking (T0356)L163.CB as missing WARNING: atoms too close: (T0356)T164.CA and (T0356)T164.CB only 0.000 apart, marking (T0356)T164.CB as missing WARNING: atoms too close: (T0356)Q174.CA and (T0356)Q174.CB only 0.000 apart, marking (T0356)Q174.CB as missing WARNING: atoms too close: (T0356)Y179.CA and (T0356)Y179.CB only 0.000 apart, marking (T0356)Y179.CB as missing WARNING: atoms too close: (T0356)L189.CA and (T0356)L189.CB only 0.000 apart, marking (T0356)L189.CB as missing WARNING: atoms too close: (T0356)I190.CA and (T0356)I190.CB only 0.000 apart, marking (T0356)I190.CB as missing WARNING: atoms too close: (T0356)R192.CA and (T0356)R192.CB only 0.000 apart, marking (T0356)R192.CB as missing WARNING: atoms too close: (T0356)R197.CA and (T0356)R197.CB only 0.000 apart, marking (T0356)R197.CB as missing WARNING: atoms too close: (T0356)W206.CA and (T0356)W206.CB only 0.000 apart, marking (T0356)W206.CB as missing WARNING: atoms too close: (T0356)A209.CA and (T0356)A209.CB only 0.000 apart, marking (T0356)A209.CB as missing WARNING: atoms too close: (T0356)A231.CA and (T0356)A231.CB only 0.000 apart, marking (T0356)A231.CB as missing WARNING: atoms too close: (T0356)V235.CA and (T0356)V235.CB only 0.000 apart, marking (T0356)V235.CB as missing WARNING: atoms too close: (T0356)K252.CA and (T0356)K252.CB only 0.000 apart, marking (T0356)K252.CB as missing WARNING: atoms too close: (T0356)L263.CA and (T0356)L263.CB only 0.000 apart, marking (T0356)L263.CB as missing WARNING: atoms too close: (T0356)I277.CA and (T0356)I277.CB only 0.000 apart, marking (T0356)I277.CB as missing WARNING: atoms too close: (T0356)Q279.CA and (T0356)Q279.CB only 0.000 apart, marking (T0356)Q279.CB as missing WARNING: atoms too close: (T0356)T282.CA and (T0356)T282.CB only 0.000 apart, marking (T0356)T282.CB as missing WARNING: atoms too close: (T0356)P287.CA and (T0356)P287.CB only 0.000 apart, marking (T0356)P287.CB as missing WARNING: atoms too close: (T0356)D290.CA and (T0356)D290.CB only 0.000 apart, marking (T0356)D290.CB as missing WARNING: atoms too close: (T0356)Y295.CA and (T0356)Y295.CB only 0.000 apart, marking (T0356)Y295.CB as missing WARNING: atoms too close: (T0356)E297.CA and (T0356)E297.CB only 0.000 apart, marking (T0356)E297.CB as missing WARNING: atoms too close: (T0356)S300.CA and (T0356)S300.CB only 0.000 apart, marking (T0356)S300.CB as missing WARNING: atoms too close: (T0356)V303.CA and (T0356)V303.CB only 0.000 apart, marking (T0356)V303.CB as missing WARNING: atoms too close: (T0356)T307.CA and (T0356)T307.CB only 0.000 apart, marking (T0356)T307.CB as missing WARNING: atoms too close: (T0356)H308.CA and (T0356)H308.CB only 0.000 apart, marking (T0356)H308.CB as missing WARNING: atoms too close: (T0356)T310.CA and (T0356)T310.CB only 0.000 apart, marking (T0356)T310.CB as missing WARNING: atoms too close: (T0356)E313.CA and (T0356)E313.CB only 0.000 apart, marking (T0356)E313.CB as missing WARNING: atoms too close: (T0356)Y317.CA and (T0356)Y317.CB only 0.000 apart, marking (T0356)Y317.CB as missing WARNING: atoms too close: (T0356)S319.CA and (T0356)S319.CB only 0.000 apart, marking (T0356)S319.CB as missing WARNING: atoms too close: (T0356)P342.CA and (T0356)P342.CB only 0.000 apart, marking (T0356)P342.CB as missing WARNING: atoms too close: (T0356)I351.CA and (T0356)I351.CB only 0.000 apart, marking (T0356)I351.CB as missing WARNING: atoms too close: (T0356)P357.CA and (T0356)P357.CB only 0.000 apart, marking (T0356)P357.CB as missing WARNING: atoms too close: (T0356)S362.CA and (T0356)S362.CB only 0.000 apart, marking (T0356)S362.CB as missing WARNING: atoms too close: (T0356)R364.CA and (T0356)R364.CB only 0.000 apart, marking (T0356)R364.CB as missing WARNING: atoms too close: (T0356)L365.CA and (T0356)L365.CB only 0.000 apart, marking (T0356)L365.CB as missing WARNING: atoms too close: (T0356)A378.CA and (T0356)A378.CB only 0.000 apart, marking (T0356)A378.CB as missing WARNING: atoms too close: (T0356)L389.CA and (T0356)L389.CB only 0.000 apart, marking (T0356)L389.CB as missing WARNING: atoms too close: (T0356)Q391.CA and (T0356)Q391.CB only 0.000 apart, marking (T0356)Q391.CB as missing WARNING: atoms too close: (T0356)K396.CA and (T0356)K396.CB only 0.000 apart, marking (T0356)K396.CB as missing WARNING: atoms too close: (T0356)I399.CA and (T0356)I399.CB only 0.000 apart, marking (T0356)I399.CB as missing WARNING: atoms too close: (T0356)V400.CA and (T0356)V400.CB only 0.000 apart, marking (T0356)V400.CB as missing WARNING: atoms too close: (T0356)D402.CA and (T0356)D402.CB only 0.000 apart, marking (T0356)D402.CB as missing WARNING: atoms too close: (T0356)D403.CA and (T0356)D403.CB only 0.000 apart, marking (T0356)D403.CB as missing WARNING: atoms too close: (T0356)A407.CA and (T0356)A407.CB only 0.000 apart, marking (T0356)A407.CB as missing WARNING: atoms too close: (T0356)R420.CA and (T0356)R420.CB only 0.000 apart, marking (T0356)R420.CB as missing WARNING: atoms too close: (T0356)A424.CA and (T0356)A424.CB only 0.000 apart, marking (T0356)A424.CB as missing WARNING: atoms too close: (T0356)T427.CA and (T0356)T427.CB only 0.000 apart, marking (T0356)T427.CB as missing WARNING: atoms too close: (T0356)A441.CA and (T0356)A441.CB only 0.000 apart, marking (T0356)A441.CB as missing WARNING: atoms too close: (T0356)S445.CA and (T0356)S445.CB only 0.000 apart, marking (T0356)S445.CB as missing WARNING: atoms too close: (T0356)L447.CA and (T0356)L447.CB only 0.000 apart, marking (T0356)L447.CB as missing WARNING: atoms too close: (T0356)E466.CA and (T0356)E466.CB only 0.000 apart, marking (T0356)E466.CB as missing WARNING: atoms too close: (T0356)P470.CA and (T0356)P470.CB only 0.000 apart, marking (T0356)P470.CB as missing WARNING: atoms too close: (T0356)I471.CA and (T0356)I471.CB only 0.000 apart, marking (T0356)I471.CB as missing WARNING: atoms too close: (T0356)D476.CA and (T0356)D476.CB only 0.000 apart, marking (T0356)D476.CB as missing WARNING: atoms too close: (T0356)A479.CA and (T0356)A479.CB only 0.000 apart, marking (T0356)A479.CB as missing WARNING: atoms too close: (T0356)W485.CA and (T0356)W485.CB only 0.000 apart, marking (T0356)W485.CB as missing WARNING: atoms too close: (T0356)D486.CA and (T0356)D486.CB only 0.000 apart, marking (T0356)D486.CB as missing WARNING: atoms too close: (T0356)N492.CA and (T0356)N492.CB only 0.000 apart, marking (T0356)N492.CB as missing WARNING: atoms too close: (T0356)E499.CA and (T0356)E499.CB only 0.000 apart, marking (T0356)E499.CB as missing WARNING: atoms too close: (T0356)H501.CA and (T0356)H501.CB only 0.000 apart, marking (T0356)H501.CB as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)M1.CA and (T0356)M1.CB only 0.000 apart, marking (T0356)M1.CB as missing WARNING: atoms too close: (T0356)A3.CA and (T0356)A3.CB only 0.000 apart, marking (T0356)A3.CB as missing WARNING: atoms too close: (T0356)Y6.CA and (T0356)Y6.CB only 0.000 apart, marking (T0356)Y6.CB as missing WARNING: atoms too close: (T0356)D11.CA and (T0356)D11.CB only 0.000 apart, marking (T0356)D11.CB as missing WARNING: atoms too close: (T0356)L13.CA and (T0356)L13.CB only 0.000 apart, marking (T0356)L13.CB as missing WARNING: atoms too close: (T0356)T26.CA and (T0356)T26.CB only 0.000 apart, marking (T0356)T26.CB as missing WARNING: atoms too close: (T0356)P31.CA and (T0356)P31.CB only 0.000 apart, marking (T0356)P31.CB as missing WARNING: atoms too close: (T0356)I38.CA and (T0356)I38.CB only 0.000 apart, marking (T0356)I38.CB as missing WARNING: atoms too close: (T0356)A49.CA and (T0356)A49.CB only 0.000 apart, marking (T0356)A49.CB as missing WARNING: atoms too close: (T0356)L51.CA and (T0356)L51.CB only 0.000 apart, marking (T0356)L51.CB as missing WARNING: atoms too close: (T0356)C64.CA and (T0356)C64.CB only 0.000 apart, marking (T0356)C64.CB as missing WARNING: atoms too close: (T0356)K71.CA and (T0356)K71.CB only 0.000 apart, marking (T0356)K71.CB as missing WARNING: atoms too close: (T0356)K90.CA and (T0356)K90.CB only 0.000 apart, marking (T0356)K90.CB as missing WARNING: atoms too close: (T0356)K96.CA and (T0356)K96.CB only 0.000 apart, marking (T0356)K96.CB as missing WARNING: atoms too close: (T0356)R124.CA and (T0356)R124.CB only 0.000 apart, marking (T0356)R124.CB as missing WARNING: atoms too close: (T0356)C130.CA and (T0356)C130.CB only 0.000 apart, marking (T0356)C130.CB as missing WARNING: atoms too close: (T0356)Q131.CA and (T0356)Q131.CB only 0.000 apart, marking (T0356)Q131.CB as missing WARNING: atoms too close: (T0356)I147.CA and (T0356)I147.CB only 0.000 apart, marking (T0356)I147.CB as missing WARNING: atoms too close: (T0356)D154.CA and (T0356)D154.CB only 0.000 apart, marking (T0356)D154.CB as missing WARNING: atoms too close: (T0356)A155.CA and (T0356)A155.CB only 0.000 apart, marking (T0356)A155.CB as missing WARNING: atoms too close: (T0356)T164.CA and (T0356)T164.CB only 0.000 apart, marking (T0356)T164.CB as missing WARNING: atoms too close: (T0356)P169.CA and (T0356)P169.CB only 0.000 apart, marking (T0356)P169.CB as missing WARNING: atoms too close: (T0356)Q174.CA and (T0356)Q174.CB only 0.000 apart, marking (T0356)Q174.CB as missing WARNING: atoms too close: (T0356)I178.CA and (T0356)I178.CB only 0.000 apart, marking (T0356)I178.CB as missing WARNING: atoms too close: (T0356)Q182.CA and (T0356)Q182.CB only 0.000 apart, marking (T0356)Q182.CB as missing WARNING: atoms too close: (T0356)L183.CA and (T0356)L183.CB only 0.000 apart, marking (T0356)L183.CB as missing WARNING: atoms too close: (T0356)I184.CA and (T0356)I184.CB only 0.000 apart, marking (T0356)I184.CB as missing WARNING: atoms too close: (T0356)L189.CA and (T0356)L189.CB only 0.000 apart, marking (T0356)L189.CB as missing WARNING: atoms too close: (T0356)R192.CA and (T0356)R192.CB only 0.000 apart, marking (T0356)R192.CB as missing WARNING: atoms too close: (T0356)W193.CA and (T0356)W193.CB only 0.000 apart, marking (T0356)W193.CB as missing WARNING: atoms too close: (T0356)A200.CA and (T0356)A200.CB only 0.000 apart, marking (T0356)A200.CB as missing WARNING: atoms too close: (T0356)C207.CA and (T0356)C207.CB only 0.000 apart, marking (T0356)C207.CB as missing WARNING: atoms too close: (T0356)P234.CA and (T0356)P234.CB only 0.000 apart, marking (T0356)P234.CB as missing WARNING: atoms too close: (T0356)V235.CA and (T0356)V235.CB only 0.000 apart, marking (T0356)V235.CB as missing WARNING: atoms too close: (T0356)A245.CA and (T0356)A245.CB only 0.000 apart, marking (T0356)A245.CB as missing WARNING: atoms too close: (T0356)K252.CA and (T0356)K252.CB only 0.000 apart, marking (T0356)K252.CB as missing WARNING: atoms too close: (T0356)E254.CA and (T0356)E254.CB only 0.000 apart, marking (T0356)E254.CB as missing WARNING: atoms too close: (T0356)D262.CA and (T0356)D262.CB only 0.000 apart, marking (T0356)D262.CB as missing WARNING: atoms too close: (T0356)V265.CA and (T0356)V265.CB only 0.000 apart, marking (T0356)V265.CB as missing WARNING: atoms too close: (T0356)L273.CA and (T0356)L273.CB only 0.000 apart, marking (T0356)L273.CB as missing WARNING: atoms too close: (T0356)Y276.CA and (T0356)Y276.CB only 0.000 apart, marking (T0356)Y276.CB as missing WARNING: atoms too close: (T0356)E278.CA and (T0356)E278.CB only 0.000 apart, marking (T0356)E278.CB as missing WARNING: atoms too close: (T0356)Q279.CA and (T0356)Q279.CB only 0.000 apart, marking (T0356)Q279.CB as missing WARNING: atoms too close: (T0356)T282.CA and (T0356)T282.CB only 0.000 apart, marking (T0356)T282.CB as missing WARNING: atoms too close: (T0356)T292.CA and (T0356)T292.CB only 0.000 apart, marking (T0356)T292.CB as missing WARNING: atoms too close: (T0356)Y295.CA and (T0356)Y295.CB only 0.000 apart, marking (T0356)Y295.CB as missing WARNING: atoms too close: (T0356)D299.CA and (T0356)D299.CB only 0.000 apart, marking (T0356)D299.CB as missing WARNING: atoms too close: (T0356)R312.CA and (T0356)R312.CB only 0.000 apart, marking (T0356)R312.CB as missing WARNING: atoms too close: (T0356)I316.CA and (T0356)I316.CB only 0.000 apart, marking (T0356)I316.CB as missing WARNING: atoms too close: (T0356)Y317.CA and (T0356)Y317.CB only 0.000 apart, marking (T0356)Y317.CB as missing WARNING: atoms too close: (T0356)H318.CA and (T0356)H318.CB only 0.000 apart, marking (T0356)H318.CB as missing WARNING: atoms too close: (T0356)N337.CA and (T0356)N337.CB only 0.000 apart, marking (T0356)N337.CB as missing WARNING: atoms too close: (T0356)Q347.CA and (T0356)Q347.CB only 0.000 apart, marking (T0356)Q347.CB as missing WARNING: atoms too close: (T0356)P358.CA and (T0356)P358.CB only 0.000 apart, marking (T0356)P358.CB as missing WARNING: atoms too close: (T0356)Y363.CA and (T0356)Y363.CB only 0.000 apart, marking (T0356)Y363.CB as missing WARNING: atoms too close: (T0356)L365.CA and (T0356)L365.CB only 0.000 apart, marking (T0356)L365.CB as missing WARNING: atoms too close: (T0356)H377.CA and (T0356)H377.CB only 0.000 apart, marking (T0356)H377.CB as missing WARNING: atoms too close: (T0356)K396.CA and (T0356)K396.CB only 0.000 apart, marking (T0356)K396.CB as missing WARNING: atoms too close: (T0356)V398.CA and (T0356)V398.CB only 0.000 apart, marking (T0356)V398.CB as missing WARNING: atoms too close: (T0356)I399.CA and (T0356)I399.CB only 0.000 apart, marking (T0356)I399.CB as missing WARNING: atoms too close: (T0356)A407.CA and (T0356)A407.CB only 0.000 apart, marking (T0356)A407.CB as missing WARNING: atoms too close: (T0356)R408.CA and (T0356)R408.CB only 0.000 apart, marking (T0356)R408.CB as missing WARNING: atoms too close: (T0356)A416.CA and (T0356)A416.CB only 0.000 apart, marking (T0356)A416.CB as missing WARNING: atoms too close: (T0356)R425.CA and (T0356)R425.CB only 0.000 apart, marking (T0356)R425.CB as missing WARNING: atoms too close: (T0356)V430.CA and (T0356)V430.CB only 0.000 apart, marking (T0356)V430.CB as missing WARNING: atoms too close: (T0356)N457.CA and (T0356)N457.CB only 0.000 apart, marking (T0356)N457.CB as missing WARNING: atoms too close: (T0356)T463.CA and (T0356)T463.CB only 0.000 apart, marking (T0356)T463.CB as missing WARNING: atoms too close: (T0356)K472.CA and (T0356)K472.CB only 0.000 apart, marking (T0356)K472.CB as missing WARNING: atoms too close: (T0356)K473.CA and (T0356)K473.CB only 0.000 apart, marking (T0356)K473.CB as missing WARNING: atoms too close: (T0356)D476.CA and (T0356)D476.CB only 0.000 apart, marking (T0356)D476.CB as missing WARNING: atoms too close: (T0356)L488.CA and (T0356)L488.CB only 0.000 apart, marking (T0356)L488.CB as missing WARNING: atoms too close: (T0356)N493.CA and (T0356)N493.CB only 0.000 apart, marking (T0356)N493.CB as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)I25.CA and (T0356)I25.CB only 0.000 apart, marking (T0356)I25.CB as missing WARNING: atoms too close: (T0356)V29.CA and (T0356)V29.CB only 0.000 apart, marking (T0356)V29.CB as missing WARNING: atoms too close: (T0356)P31.CA and (T0356)P31.CB only 0.000 apart, marking (T0356)P31.CB as missing WARNING: atoms too close: (T0356)I38.CA and (T0356)I38.CB only 0.000 apart, marking (T0356)I38.CB as missing WARNING: atoms too close: (T0356)L51.CA and (T0356)L51.CB only 0.000 apart, marking (T0356)L51.CB as missing WARNING: atoms too close: (T0356)Y58.CA and (T0356)Y58.CB only 0.000 apart, marking (T0356)Y58.CB as missing WARNING: atoms too close: (T0356)L63.CA and (T0356)L63.CB only 0.000 apart, marking (T0356)L63.CB as missing WARNING: atoms too close: (T0356)C64.CA and (T0356)C64.CB only 0.000 apart, marking (T0356)C64.CB as missing WARNING: atoms too close: (T0356)T69.CA and (T0356)T69.CB only 0.000 apart, marking (T0356)T69.CB as missing WARNING: atoms too close: (T0356)M75.CA and (T0356)M75.CB only 0.000 apart, marking (T0356)M75.CB as missing WARNING: atoms too close: (T0356)K96.CA and (T0356)K96.CB only 0.000 apart, marking (T0356)K96.CB as missing WARNING: atoms too close: (T0356)D109.CA and (T0356)D109.CB only 0.000 apart, marking (T0356)D109.CB as missing WARNING: atoms too close: (T0356)K110.CA and (T0356)K110.CB only 0.000 apart, marking (T0356)K110.CB as missing WARNING: atoms too close: (T0356)P112.CA and (T0356)P112.CB only 0.000 apart, marking (T0356)P112.CB as missing WARNING: atoms too close: (T0356)Q113.CA and (T0356)Q113.CB only 0.000 apart, marking (T0356)Q113.CB as missing WARNING: atoms too close: (T0356)V117.CA and (T0356)V117.CB only 0.000 apart, marking (T0356)V117.CB as missing WARNING: atoms too close: (T0356)L118.CA and (T0356)L118.CB only 0.000 apart, marking (T0356)L118.CB as missing WARNING: atoms too close: (T0356)R124.CA and (T0356)R124.CB only 0.000 apart, marking (T0356)R124.CB as missing WARNING: atoms too close: (T0356)K133.CA and (T0356)K133.CB only 0.000 apart, marking (T0356)K133.CB as missing WARNING: atoms too close: (T0356)I147.CA and (T0356)I147.CB only 0.000 apart, marking (T0356)I147.CB as missing WARNING: atoms too close: (T0356)W151.CA and (T0356)W151.CB only 0.000 apart, marking (T0356)W151.CB as missing WARNING: atoms too close: (T0356)E153.CA and (T0356)E153.CB only 0.000 apart, marking (T0356)E153.CB as missing WARNING: atoms too close: (T0356)D154.CA and (T0356)D154.CB only 0.000 apart, marking (T0356)D154.CB as missing WARNING: atoms too close: (T0356)A156.CA and (T0356)A156.CB only 0.000 apart, marking (T0356)A156.CB as missing WARNING: atoms too close: (T0356)W161.CA and (T0356)W161.CB only 0.000 apart, marking (T0356)W161.CB as missing WARNING: atoms too close: (T0356)P169.CA and (T0356)P169.CB only 0.000 apart, marking (T0356)P169.CB as missing WARNING: atoms too close: (T0356)K171.CA and (T0356)K171.CB only 0.000 apart, marking (T0356)K171.CB as missing WARNING: atoms too close: (T0356)Q174.CA and (T0356)Q174.CB only 0.000 apart, marking (T0356)Q174.CB as missing WARNING: atoms too close: (T0356)I184.CA and (T0356)I184.CB only 0.000 apart, marking (T0356)I184.CB as missing WARNING: atoms too close: (T0356)N187.CA and (T0356)N187.CB only 0.000 apart, marking (T0356)N187.CB as missing WARNING: atoms too close: (T0356)R192.CA and (T0356)R192.CB only 0.000 apart, marking (T0356)R192.CB as missing WARNING: atoms too close: (T0356)L194.CA and (T0356)L194.CB only 0.000 apart, marking (T0356)L194.CB as missing WARNING: atoms too close: (T0356)H196.CA and (T0356)H196.CB only 0.000 apart, marking (T0356)H196.CB as missing WARNING: atoms too close: (T0356)R197.CA and (T0356)R197.CB only 0.000 apart, marking (T0356)R197.CB as missing WARNING: atoms too close: (T0356)E205.CA and (T0356)E205.CB only 0.000 apart, marking (T0356)E205.CB as missing WARNING: atoms too close: (T0356)C207.CA and (T0356)C207.CB only 0.000 apart, marking (T0356)C207.CB as missing WARNING: atoms too close: (T0356)H210.CA and (T0356)H210.CB only 0.000 apart, marking (T0356)H210.CB as missing WARNING: atoms too close: (T0356)S218.CA and (T0356)S218.CB only 0.000 apart, marking (T0356)S218.CB as missing WARNING: atoms too close: (T0356)V219.CA and (T0356)V219.CB only 0.000 apart, marking (T0356)V219.CB as missing WARNING: atoms too close: (T0356)A220.CA and (T0356)A220.CB only 0.000 apart, marking (T0356)A220.CB as missing WARNING: atoms too close: (T0356)K252.CA and (T0356)K252.CB only 0.000 apart, marking (T0356)K252.CB as missing WARNING: atoms too close: (T0356)D262.CA and (T0356)D262.CB only 0.000 apart, marking (T0356)D262.CB as missing WARNING: atoms too close: (T0356)L263.CA and (T0356)L263.CB only 0.000 apart, marking (T0356)L263.CB as missing WARNING: atoms too close: (T0356)V265.CA and (T0356)V265.CB only 0.000 apart, marking (T0356)V265.CB as missing WARNING: atoms too close: (T0356)P266.CA and (T0356)P266.CB only 0.000 apart, marking (T0356)P266.CB as missing WARNING: atoms too close: (T0356)L273.CA and (T0356)L273.CB only 0.000 apart, marking (T0356)L273.CB as missing WARNING: atoms too close: (T0356)E274.CA and (T0356)E274.CB only 0.000 apart, marking (T0356)E274.CB as missing WARNING: atoms too close: (T0356)Q279.CA and (T0356)Q279.CB only 0.000 apart, marking (T0356)Q279.CB as missing WARNING: atoms too close: (T0356)P287.CA and (T0356)P287.CB only 0.000 apart, marking (T0356)P287.CB as missing WARNING: atoms too close: (T0356)Y295.CA and (T0356)Y295.CB only 0.000 apart, marking (T0356)Y295.CB as missing WARNING: atoms too close: (T0356)D299.CA and (T0356)D299.CB only 0.000 apart, marking (T0356)D299.CB as missing WARNING: atoms too close: (T0356)D314.CA and (T0356)D314.CB only 0.000 apart, marking (T0356)D314.CB as missing WARNING: atoms too close: (T0356)I316.CA and (T0356)I316.CB only 0.000 apart, marking (T0356)I316.CB as missing WARNING: atoms too close: (T0356)R324.CA and (T0356)R324.CB only 0.000 apart, marking (T0356)R324.CB as missing WARNING: atoms too close: (T0356)P342.CA and (T0356)P342.CB only 0.000 apart, marking (T0356)P342.CB as missing WARNING: atoms too close: (T0356)Q345.CA and (T0356)Q345.CB only 0.000 apart, marking (T0356)Q345.CB as missing WARNING: atoms too close: (T0356)C361.CA and (T0356)C361.CB only 0.000 apart, marking (T0356)C361.CB as missing WARNING: atoms too close: (T0356)A366.CA and (T0356)A366.CB only 0.000 apart, marking (T0356)A366.CB as missing WARNING: atoms too close: (T0356)T369.CA and (T0356)T369.CB only 0.000 apart, marking (T0356)T369.CB as missing WARNING: atoms too close: (T0356)H377.CA and (T0356)H377.CB only 0.000 apart, marking (T0356)H377.CB as missing WARNING: atoms too close: (T0356)V385.CA and (T0356)V385.CB only 0.000 apart, marking (T0356)V385.CB as missing WARNING: atoms too close: (T0356)L389.CA and (T0356)L389.CB only 0.000 apart, marking (T0356)L389.CB as missing WARNING: atoms too close: (T0356)F397.CA and (T0356)F397.CB only 0.000 apart, marking (T0356)F397.CB as missing WARNING: atoms too close: (T0356)V400.CA and (T0356)V400.CB only 0.000 apart, marking (T0356)V400.CB as missing WARNING: atoms too close: (T0356)R408.CA and (T0356)R408.CB only 0.000 apart, marking (T0356)R408.CB as missing WARNING: atoms too close: (T0356)W410.CA and (T0356)W410.CB only 0.000 apart, marking (T0356)W410.CB as missing WARNING: atoms too close: (T0356)A416.CA and (T0356)A416.CB only 0.000 apart, marking (T0356)A416.CB as missing WARNING: atoms too close: (T0356)R425.CA and (T0356)R425.CB only 0.000 apart, marking (T0356)R425.CB as missing WARNING: atoms too close: (T0356)E431.CA and (T0356)E431.CB only 0.000 apart, marking (T0356)E431.CB as missing WARNING: atoms too close: (T0356)N432.CA and (T0356)N432.CB only 0.000 apart, marking (T0356)N432.CB as missing WARNING: atoms too close: (T0356)I435.CA and (T0356)I435.CB only 0.000 apart, marking (T0356)I435.CB as missing WARNING: atoms too close: (T0356)T456.CA and (T0356)T456.CB only 0.000 apart, marking (T0356)T456.CB as missing WARNING: atoms too close: (T0356)W467.CA and (T0356)W467.CB only 0.000 apart, marking (T0356)W467.CB as missing WARNING: atoms too close: (T0356)K473.CA and (T0356)K473.CB only 0.000 apart, marking (T0356)K473.CB as missing WARNING: atoms too close: (T0356)D474.CA and (T0356)D474.CB only 0.000 apart, marking (T0356)D474.CB as missing WARNING: atoms too close: (T0356)V478.CA and (T0356)V478.CB only 0.000 apart, marking (T0356)V478.CB as missing WARNING: atoms too close: (T0356)A479.CA and (T0356)A479.CB only 0.000 apart, marking (T0356)A479.CB as missing WARNING: atoms too close: (T0356)I481.CA and (T0356)I481.CB only 0.000 apart, marking (T0356)I481.CB as missing WARNING: atoms too close: (T0356)N493.CA and (T0356)N493.CB only 0.000 apart, marking (T0356)N493.CB as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)D11.CA and (T0356)D11.CB only 0.000 apart, marking (T0356)D11.CB as missing WARNING: atoms too close: (T0356)F12.CA and (T0356)F12.CB only 0.000 apart, marking (T0356)F12.CB as missing WARNING: atoms too close: (T0356)E17.CA and (T0356)E17.CB only 0.000 apart, marking (T0356)E17.CB as missing WARNING: atoms too close: (T0356)L51.CA and (T0356)L51.CB only 0.000 apart, marking (T0356)L51.CB as missing WARNING: atoms too close: (T0356)N54.CA and (T0356)N54.CB only 0.000 apart, marking (T0356)N54.CB as missing WARNING: atoms too close: (T0356)P70.CA and (T0356)P70.CB only 0.000 apart, marking (T0356)P70.CB as missing WARNING: atoms too close: (T0356)K96.CA and (T0356)K96.CB only 0.000 apart, marking (T0356)K96.CB as missing WARNING: atoms too close: (T0356)E99.CA and (T0356)E99.CB only 0.000 apart, marking (T0356)E99.CB as missing WARNING: atoms too close: (T0356)D109.CA and (T0356)D109.CB only 0.000 apart, marking (T0356)D109.CB as missing WARNING: atoms too close: (T0356)K110.CA and (T0356)K110.CB only 0.000 apart, marking (T0356)K110.CB as missing WARNING: atoms too close: (T0356)L111.CA and (T0356)L111.CB only 0.000 apart, marking (T0356)L111.CB as missing WARNING: atoms too close: (T0356)Q113.CA and (T0356)Q113.CB only 0.000 apart, marking (T0356)Q113.CB as missing WARNING: atoms too close: (T0356)F114.CA and (T0356)F114.CB only 0.000 apart, marking (T0356)F114.CB as missing WARNING: atoms too close: (T0356)R126.CA and (T0356)R126.CB only 0.000 apart, marking (T0356)R126.CB as missing WARNING: atoms too close: (T0356)A128.CA and (T0356)A128.CB only 0.000 apart, marking (T0356)A128.CB as missing WARNING: atoms too close: (T0356)P146.CA and (T0356)P146.CB only 0.000 apart, marking (T0356)P146.CB as missing WARNING: atoms too close: (T0356)T149.CA and (T0356)T149.CB only 0.000 apart, marking (T0356)T149.CB as missing WARNING: atoms too close: (T0356)L158.CA and (T0356)L158.CB only 0.000 apart, marking (T0356)L158.CB as missing WARNING: atoms too close: (T0356)T166.CA and (T0356)T166.CB only 0.000 apart, marking (T0356)T166.CB as missing WARNING: atoms too close: (T0356)P169.CA and (T0356)P169.CB only 0.000 apart, marking (T0356)P169.CB as missing WARNING: atoms too close: (T0356)H170.CA and (T0356)H170.CB only 0.000 apart, marking (T0356)H170.CB as missing WARNING: atoms too close: (T0356)Q174.CA and (T0356)Q174.CB only 0.000 apart, marking (T0356)Q174.CB as missing WARNING: atoms too close: (T0356)Q182.CA and (T0356)Q182.CB only 0.000 apart, marking (T0356)Q182.CB as missing WARNING: atoms too close: (T0356)I184.CA and (T0356)I184.CB only 0.000 apart, marking (T0356)I184.CB as missing WARNING: atoms too close: (T0356)K188.CA and (T0356)K188.CB only 0.000 apart, marking (T0356)K188.CB as missing WARNING: atoms too close: (T0356)L201.CA and (T0356)L201.CB only 0.000 apart, marking (T0356)L201.CB as missing WARNING: atoms too close: (T0356)Y203.CA and (T0356)Y203.CB only 0.000 apart, marking (T0356)Y203.CB as missing WARNING: atoms too close: (T0356)Q204.CA and (T0356)Q204.CB only 0.000 apart, marking (T0356)Q204.CB as missing WARNING: atoms too close: (T0356)C207.CA and (T0356)C207.CB only 0.000 apart, marking (T0356)C207.CB as missing WARNING: atoms too close: (T0356)P216.CA and (T0356)P216.CB only 0.000 apart, marking (T0356)P216.CB as missing WARNING: atoms too close: (T0356)S218.CA and (T0356)S218.CB only 0.000 apart, marking (T0356)S218.CB as missing WARNING: atoms too close: (T0356)V219.CA and (T0356)V219.CB only 0.000 apart, marking (T0356)V219.CB as missing WARNING: atoms too close: (T0356)L221.CA and (T0356)L221.CB only 0.000 apart, marking (T0356)L221.CB as missing WARNING: atoms too close: (T0356)A223.CA and (T0356)A223.CB only 0.000 apart, marking (T0356)A223.CB as missing WARNING: atoms too close: (T0356)I228.CA and (T0356)I228.CB only 0.000 apart, marking (T0356)I228.CB as missing WARNING: atoms too close: (T0356)A231.CA and (T0356)A231.CB only 0.000 apart, marking (T0356)A231.CB as missing WARNING: atoms too close: (T0356)V235.CA and (T0356)V235.CB only 0.000 apart, marking (T0356)V235.CB as missing WARNING: atoms too close: (T0356)F244.CA and (T0356)F244.CB only 0.000 apart, marking (T0356)F244.CB as missing WARNING: atoms too close: (T0356)A245.CA and (T0356)A245.CB only 0.000 apart, marking (T0356)A245.CB as missing WARNING: atoms too close: (T0356)R249.CA and (T0356)R249.CB only 0.000 apart, marking (T0356)R249.CB as missing WARNING: atoms too close: (T0356)E254.CA and (T0356)E254.CB only 0.000 apart, marking (T0356)E254.CB as missing WARNING: atoms too close: (T0356)V255.CA and (T0356)V255.CB only 0.000 apart, marking (T0356)V255.CB as missing WARNING: atoms too close: (T0356)I259.CA and (T0356)I259.CB only 0.000 apart, marking (T0356)I259.CB as missing WARNING: atoms too close: (T0356)D262.CA and (T0356)D262.CB only 0.000 apart, marking (T0356)D262.CB as missing WARNING: atoms too close: (T0356)V265.CA and (T0356)V265.CB only 0.000 apart, marking (T0356)V265.CB as missing WARNING: atoms too close: (T0356)I271.CA and (T0356)I271.CB only 0.000 apart, marking (T0356)I271.CB as missing WARNING: atoms too close: (T0356)E274.CA and (T0356)E274.CB only 0.000 apart, marking (T0356)E274.CB as missing WARNING: atoms too close: (T0356)T282.CA and (T0356)T282.CB only 0.000 apart, marking (T0356)T282.CB as missing WARNING: atoms too close: (T0356)T292.CA and (T0356)T292.CB only 0.000 apart, marking (T0356)T292.CB as missing WARNING: atoms too close: (T0356)Y295.CA and (T0356)Y295.CB only 0.000 apart, marking (T0356)Y295.CB as missing WARNING: atoms too close: (T0356)F304.CA and (T0356)F304.CB only 0.000 apart, marking (T0356)F304.CB as missing WARNING: atoms too close: (T0356)Q311.CA and (T0356)Q311.CB only 0.000 apart, marking (T0356)Q311.CB as missing WARNING: atoms too close: (T0356)R312.CA and (T0356)R312.CB only 0.000 apart, marking (T0356)R312.CB as missing WARNING: atoms too close: (T0356)Y317.CA and (T0356)Y317.CB only 0.000 apart, marking (T0356)Y317.CB as missing WARNING: atoms too close: (T0356)S319.CA and (T0356)S319.CB only 0.000 apart, marking (T0356)S319.CB as missing WARNING: atoms too close: (T0356)R324.CA and (T0356)R324.CB only 0.000 apart, marking (T0356)R324.CB as missing WARNING: atoms too close: (T0356)N337.CA and (T0356)N337.CB only 0.000 apart, marking (T0356)N337.CB as missing WARNING: atoms too close: (T0356)F340.CA and (T0356)F340.CB only 0.000 apart, marking (T0356)F340.CB as missing WARNING: atoms too close: (T0356)F348.CA and (T0356)F348.CB only 0.000 apart, marking (T0356)F348.CB as missing WARNING: atoms too close: (T0356)P358.CA and (T0356)P358.CB only 0.000 apart, marking (T0356)P358.CB as missing WARNING: atoms too close: (T0356)Y363.CA and (T0356)Y363.CB only 0.000 apart, marking (T0356)Y363.CB as missing WARNING: atoms too close: (T0356)H377.CA and (T0356)H377.CB only 0.000 apart, marking (T0356)H377.CB as missing WARNING: atoms too close: (T0356)R390.CA and (T0356)R390.CB only 0.000 apart, marking (T0356)R390.CB as missing WARNING: atoms too close: (T0356)R408.CA and (T0356)R408.CB only 0.000 apart, marking (T0356)R408.CB as missing WARNING: atoms too close: (T0356)D409.CA and (T0356)D409.CB only 0.000 apart, marking (T0356)D409.CB as missing WARNING: atoms too close: (T0356)V413.CA and (T0356)V413.CB only 0.000 apart, marking (T0356)V413.CB as missing WARNING: atoms too close: (T0356)D422.CA and (T0356)D422.CB only 0.000 apart, marking (T0356)D422.CB as missing WARNING: atoms too close: (T0356)T433.CA and (T0356)T433.CB only 0.000 apart, marking (T0356)T433.CB as missing WARNING: atoms too close: (T0356)P434.CA and (T0356)P434.CB only 0.000 apart, marking (T0356)P434.CB as missing WARNING: atoms too close: (T0356)I435.CA and (T0356)I435.CB only 0.000 apart, marking (T0356)I435.CB as missing WARNING: atoms too close: (T0356)T463.CA and (T0356)T463.CB only 0.000 apart, marking (T0356)T463.CB as missing WARNING: atoms too close: (T0356)W467.CA and (T0356)W467.CB only 0.000 apart, marking (T0356)W467.CB as missing WARNING: atoms too close: (T0356)P470.CA and (T0356)P470.CB only 0.000 apart, marking (T0356)P470.CB as missing WARNING: atoms too close: (T0356)P475.CA and (T0356)P475.CB only 0.000 apart, marking (T0356)P475.CB as missing WARNING: atoms too close: (T0356)W485.CA and (T0356)W485.CB only 0.000 apart, marking (T0356)W485.CB as missing WARNING: atoms too close: (T0356)N493.CA and (T0356)N493.CB only 0.000 apart, marking (T0356)N493.CB as missing WARNING: atoms too close: (T0356)S496.CA and (T0356)S496.CB only 0.000 apart, marking (T0356)S496.CB as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 Skipped atom 186, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 188, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 190, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 192, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 491 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 418 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 319 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 470 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 427 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 466 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 488 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 420 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 487 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 471 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 489 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 301 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 326 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 478 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 473 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 434 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)D314.CA and (T0356)V352.CA only 0.000 apart, marking (T0356)V352.CA as missing WARNING: atoms too close: (T0356)A315.CA and (T0356)D353.CA only 0.000 apart, marking (T0356)D353.CA as missing WARNING: atoms too close: (T0356)I316.CA and (T0356)F354.CA only 0.000 apart, marking (T0356)F354.CA as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 475 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 496 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 493 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 490 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 469 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 504 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # Found a chain break before 503 # copying to AlignedFragments data structure # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 500 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 453 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 457 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 420 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 420 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)E297.O and (T0356)V298.N only 0.000 apart, marking (T0356)V298.N as missing WARNING: atoms too close: (T0356)I435.O and (T0356)D436.N only 0.000 apart, marking (T0356)D436.N as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 # Found a chain break before 502 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 502 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0356)K56.O and (T0356)G57.N only 0.000 apart, marking (T0356)G57.N as missing WARNING: atoms too close: (T0356)E487.O and (T0356)L488.N only 0.000 apart, marking (T0356)L488.N as missing # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 # Found a chain break before 502 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 470 in servers/nFOLD_TS3.pdb.gz # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0356 can't currently be optimized by undertaker # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score 1.7970 model score 1.7828 model score 1.5283 model score 1.7700 model score 1.7687 model score 1.4988 model score 1.7315 model score 1.7302 model score 1.7275 model score 2.3675 model score 2.3728 model score 2.3881 model score 2.3960 model score 2.4294 model score 2.2395 model score 2.2921 model score 2.0630 model score 2.3660 model score 2.2903 model score 2.2395 model score 2.2921 model score 2.0630 model score 2.3660 model score 2.2903 model score 2.0628 model score 1.9877 model score 2.2904 model score 2.2114 model score 2.1195 model score 1.9596 model score 1.9017 model score 2.0047 model score 2.1300 model score 1.9895 model score 1.9881 model score 2.9900 model score 2.0992 model score 2.1104 model score 2.7199 model score 3.3470 model score 1.7666 model score 1.8628 model score 1.7325 model score 1.8453 model score 1.8408 model score 1.8299 model score 1.3346 model score 1.4796 model score 1.6261 model score 1.5083 model score 1.2753 model score 1.2784 model score 1.2783 model score 1.2773 model score 1.2770 model score 2.0613 model score 1.3894 model score 1.3171 model score 1.2760 model score 1.5468 model score 2.1545 model score 1.7325 model score 1.8453 model score 1.7666 model score 1.8628 model score 1.9877 model score 2.4335 model score 2.2904 model score 2.3370 model score 2.1982 model score 1.2802 model score 1.2785 model score 1.2805 model score 1.2773 model score 1.2785 model score 1.2785 model score 1.2773 model score 1.2808 model score 1.2804 model score 1.2797 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2793 model score 1.2771 model score 1.9992 model score 2.2178 model score 2.3301 model score 2.1545 model score 2.1000 model score 2.1685 model score 1.9074 model score 2.4043 model score 2.3062 model score 1.8435 model score 1.7662 model score 1.7625 model score 1.4455 model score 1.6644 model score 1.5032 model score 1.7116 model score 1.8318 model score 1.7873 model score 1.5565 model score 2.0149 model score 2.2067 model score 1.9015 model score 2.0841 model score 2.0354 model score 1.8571 model score 2.0708 model score 2.0809 model score 2.0620 model score 1.8571 model score 2.0354 model score 2.0708 model score 2.0809 model score 2.0620 model score 2.1317 model score 2.0143 model score 2.1492 model score 2.1388 model score 2.0143 model score 2.0589 model score 2.2357 model score 1.2771 model score 1.2771 model score 1.2781 model score 2.4178 model score 1.8394 model score 1.4138 model score 1.8325 model score 1.8419 model score 1.9349 model score 2.0017 model score 2.0949 model score 2.1654 model score 2.1310 model score 2.0963 model score 1.3092 model score 1.8413 model score 1.7311 model score 1.3904 model score 1.4628 model score 2.4731 model score 2.0017 model score 1.8430 model score 2.0949 model score 2.0988 model score 2.1654 model score 2.1061 model score 2.1767 model score 2.1972 model score 2.2314 model score 1.8937 model score 1.9849 model score 2.0641 model score 2.1105 model score 2.2111 model score 2.0643 model score 1.9621 model score 2.0499 model score 2.0758 model score 2.1784 model score 2.0595 model score 1.7678 model score 2.0764 model score 1.7940 model score 2.1033 model score 1.8271 model score 1.8935 model score 1.8523 model score 1.9303 model score 1.8167 model score 1.9800 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 2.0230 model score 1.1136 model score 1.0739 model score 1.3792 model score 1.0491 model score 2.0091 model score 1.8272 model score 2.1243 model score 2.1972 model score 1.8937 model score 2.0288 model score 2.2592 model score 1.8432 model score 2.1339 model score 1.8657 model score 2.0589 model score 2.1603 model score 2.4272 model score 2.3831 model score 2.1935 model score 1.2773 model score 1.2756 model score 1.2792 model score 1.2797 model score 1.2796 model score 1.1662 model score 1.2771 model score 1.2771 model score 1.2773 model score 1.2771 model score 1.2771 model score 1.7543 model score 1.9897 model score 2.0530 model score 1.8052 model score 1.8158 model score 1.9400 model score 1.9392 model score 1.2771 model score 1.2775 model score 1.2771 model score 1.2771 model score 1.2776 model score 2.4127 model score 2.5406 model score 2.8399 model score 2.6431 model score 2.3547 model score 2.5361 model score 2.6781 model score 2.4724 model score 2.5289 model score 2.4018 model score 2.1835 model score 2.2990 model score 1.9517 model score 2.0175 model score 2.2076 model score 1.9602 model score 2.0401 model score 2.0155 model score 1.7941 model score 1.3170 model score 2.1845 model score 2.3260 model score 2.1576 model score 2.2939 model score 2.1845 model score 2.2257 USE_META, weight: 0.7071 cost: 1.7970 min: 1.0491 max: 3.3470 USE_META, weight: 0.7126 cost: 1.7828 min: 1.0491 max: 3.3470 USE_META, weight: 0.8123 cost: 1.5283 min: 1.0491 max: 3.3470 USE_META, weight: 0.7177 cost: 1.7700 min: 1.0491 max: 3.3470 USE_META, weight: 0.7182 cost: 1.7687 min: 1.0491 max: 3.3470 USE_META, weight: 0.8238 cost: 1.4988 min: 1.0491 max: 3.3470 USE_META, weight: 0.7327 cost: 1.7315 min: 1.0491 max: 3.3470 USE_META, weight: 0.7332 cost: 1.7302 min: 1.0491 max: 3.3470 USE_META, weight: 0.7343 cost: 1.7275 min: 1.0491 max: 3.3470 USE_META, weight: 0.4836 cost: 2.3675 min: 1.0491 max: 3.3470 USE_META, weight: 0.4816 cost: 2.3728 min: 1.0491 max: 3.3470 USE_META, weight: 0.4756 cost: 2.3881 min: 1.0491 max: 3.3470 USE_META, weight: 0.4725 cost: 2.3960 min: 1.0491 max: 3.3470 USE_META, weight: 0.4594 cost: 2.4294 min: 1.0491 max: 3.3470 USE_META, weight: 0.5338 cost: 2.2395 min: 1.0491 max: 3.3470 USE_META, weight: 0.5132 cost: 2.2921 min: 1.0491 max: 3.3470 USE_META, weight: 0.6029 cost: 2.0630 min: 1.0491 max: 3.3470 USE_META, weight: 0.4842 cost: 2.3660 min: 1.0491 max: 3.3470 USE_META, weight: 0.5139 cost: 2.2903 min: 1.0491 max: 3.3470 USE_META, weight: 0.5338 cost: 2.2395 min: 1.0491 max: 3.3470 USE_META, weight: 0.5132 cost: 2.2921 min: 1.0491 max: 3.3470 USE_META, weight: 0.6029 cost: 2.0630 min: 1.0491 max: 3.3470 USE_META, weight: 0.4842 cost: 2.3660 min: 1.0491 max: 3.3470 USE_META, weight: 0.5139 cost: 2.2903 min: 1.0491 max: 3.3470 USE_META, weight: 0.6030 cost: 2.0628 min: 1.0491 max: 3.3470 USE_META, weight: 0.6324 cost: 1.9877 min: 1.0491 max: 3.3470 USE_META, weight: 0.5138 cost: 2.2904 min: 1.0491 max: 3.3470 USE_META, weight: 0.5448 cost: 2.2114 min: 1.0491 max: 3.3470 USE_META, weight: 0.5807 cost: 2.1195 min: 1.0491 max: 3.3470 USE_META, weight: 0.6434 cost: 1.9596 min: 1.0491 max: 3.3470 USE_META, weight: 0.6661 cost: 1.9017 min: 1.0491 max: 3.3470 USE_META, weight: 0.6257 cost: 2.0047 min: 1.0491 max: 3.3470 USE_META, weight: 0.5766 cost: 2.1300 min: 1.0491 max: 3.3470 USE_META, weight: 0.6317 cost: 1.9895 min: 1.0491 max: 3.3470 USE_META, weight: 0.6322 cost: 1.9881 min: 1.0491 max: 3.3470 USE_META, weight: 0.2398 cost: 2.9900 min: 1.0491 max: 3.3470 USE_META, weight: 0.5887 cost: 2.0992 min: 1.0491 max: 3.3470 USE_META, weight: 0.5843 cost: 2.1104 min: 1.0491 max: 3.3470 USE_META, weight: 0.3456 cost: 2.7199 min: 1.0491 max: 3.3470 USE_META, weight: 0.1000 cost: 3.3470 min: 1.0491 max: 3.3470 USE_META, weight: 0.7190 cost: 1.7666 min: 1.0491 max: 3.3470 USE_META, weight: 0.6813 cost: 1.8628 min: 1.0491 max: 3.3470 USE_META, weight: 0.7323 cost: 1.7325 min: 1.0491 max: 3.3470 USE_META, weight: 0.6882 cost: 1.8453 min: 1.0491 max: 3.3470 USE_META, weight: 0.6899 cost: 1.8408 min: 1.0491 max: 3.3470 USE_META, weight: 0.6942 cost: 1.8299 min: 1.0491 max: 3.3470 USE_META, weight: 0.8882 cost: 1.3346 min: 1.0491 max: 3.3470 USE_META, weight: 0.8314 cost: 1.4796 min: 1.0491 max: 3.3470 USE_META, weight: 0.7740 cost: 1.6261 min: 1.0491 max: 3.3470 USE_META, weight: 0.8201 cost: 1.5083 min: 1.0491 max: 3.3470 USE_META, weight: 0.9114 cost: 1.2753 min: 1.0491 max: 3.3470 USE_META, weight: 0.9102 cost: 1.2784 min: 1.0491 max: 3.3470 USE_META, weight: 0.9102 cost: 1.2783 min: 1.0491 max: 3.3470 USE_META, weight: 0.9106 cost: 1.2773 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2770 min: 1.0491 max: 3.3470 USE_META, weight: 0.6035 cost: 2.0613 min: 1.0491 max: 3.3470 USE_META, weight: 0.8667 cost: 1.3894 min: 1.0491 max: 3.3470 USE_META, weight: 0.8950 cost: 1.3171 min: 1.0491 max: 3.3470 USE_META, weight: 0.9111 cost: 1.2760 min: 1.0491 max: 3.3470 USE_META, weight: 0.8051 cost: 1.5468 min: 1.0491 max: 3.3470 USE_META, weight: 0.5671 cost: 2.1545 min: 1.0491 max: 3.3470 USE_META, weight: 0.7323 cost: 1.7325 min: 1.0491 max: 3.3470 USE_META, weight: 0.6882 cost: 1.8453 min: 1.0491 max: 3.3470 USE_META, weight: 0.7190 cost: 1.7666 min: 1.0491 max: 3.3470 USE_META, weight: 0.6813 cost: 1.8628 min: 1.0491 max: 3.3470 USE_META, weight: 0.6324 cost: 1.9877 min: 1.0491 max: 3.3470 USE_META, weight: 0.4578 cost: 2.4335 min: 1.0491 max: 3.3470 USE_META, weight: 0.5138 cost: 2.2904 min: 1.0491 max: 3.3470 USE_META, weight: 0.4956 cost: 2.3370 min: 1.0491 max: 3.3470 USE_META, weight: 0.5499 cost: 2.1982 min: 1.0491 max: 3.3470 USE_META, weight: 0.9095 cost: 1.2802 min: 1.0491 max: 3.3470 USE_META, weight: 0.9101 cost: 1.2785 min: 1.0491 max: 3.3470 USE_META, weight: 0.9094 cost: 1.2805 min: 1.0491 max: 3.3470 USE_META, weight: 0.9106 cost: 1.2773 min: 1.0491 max: 3.3470 USE_META, weight: 0.9101 cost: 1.2785 min: 1.0491 max: 3.3470 USE_META, weight: 0.9101 cost: 1.2785 min: 1.0491 max: 3.3470 USE_META, weight: 0.9106 cost: 1.2773 min: 1.0491 max: 3.3470 USE_META, weight: 0.9092 cost: 1.2808 min: 1.0491 max: 3.3470 USE_META, weight: 0.9094 cost: 1.2804 min: 1.0491 max: 3.3470 USE_META, weight: 0.9097 cost: 1.2797 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9098 cost: 1.2793 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.6279 cost: 1.9992 min: 1.0491 max: 3.3470 USE_META, weight: 0.5423 cost: 2.2178 min: 1.0491 max: 3.3470 USE_META, weight: 0.4983 cost: 2.3301 min: 1.0491 max: 3.3470 USE_META, weight: 0.5671 cost: 2.1545 min: 1.0491 max: 3.3470 USE_META, weight: 0.5884 cost: 2.1000 min: 1.0491 max: 3.3470 USE_META, weight: 0.5616 cost: 2.1685 min: 1.0491 max: 3.3470 USE_META, weight: 0.6638 cost: 1.9074 min: 1.0491 max: 3.3470 USE_META, weight: 0.4692 cost: 2.4043 min: 1.0491 max: 3.3470 USE_META, weight: 0.5076 cost: 2.3062 min: 1.0491 max: 3.3470 USE_META, weight: 0.6889 cost: 1.8435 min: 1.0491 max: 3.3470 USE_META, weight: 0.7191 cost: 1.7662 min: 1.0491 max: 3.3470 USE_META, weight: 0.7206 cost: 1.7625 min: 1.0491 max: 3.3470 USE_META, weight: 0.8447 cost: 1.4455 min: 1.0491 max: 3.3470 USE_META, weight: 0.7590 cost: 1.6644 min: 1.0491 max: 3.3470 USE_META, weight: 0.8221 cost: 1.5032 min: 1.0491 max: 3.3470 USE_META, weight: 0.7405 cost: 1.7116 min: 1.0491 max: 3.3470 USE_META, weight: 0.6934 cost: 1.8318 min: 1.0491 max: 3.3470 USE_META, weight: 0.7109 cost: 1.7873 min: 1.0491 max: 3.3470 USE_META, weight: 0.8013 cost: 1.5565 min: 1.0491 max: 3.3470 USE_META, weight: 0.6217 cost: 2.0149 min: 1.0491 max: 3.3470 USE_META, weight: 0.5466 cost: 2.2067 min: 1.0491 max: 3.3470 USE_META, weight: 0.6662 cost: 1.9015 min: 1.0491 max: 3.3470 USE_META, weight: 0.5946 cost: 2.0841 min: 1.0491 max: 3.3470 USE_META, weight: 0.6137 cost: 2.0354 min: 1.0491 max: 3.3470 USE_META, weight: 0.6835 cost: 1.8571 min: 1.0491 max: 3.3470 USE_META, weight: 0.5998 cost: 2.0708 min: 1.0491 max: 3.3470 USE_META, weight: 0.5959 cost: 2.0809 min: 1.0491 max: 3.3470 USE_META, weight: 0.6033 cost: 2.0620 min: 1.0491 max: 3.3470 USE_META, weight: 0.6835 cost: 1.8571 min: 1.0491 max: 3.3470 USE_META, weight: 0.6137 cost: 2.0354 min: 1.0491 max: 3.3470 USE_META, weight: 0.5998 cost: 2.0708 min: 1.0491 max: 3.3470 USE_META, weight: 0.5959 cost: 2.0809 min: 1.0491 max: 3.3470 USE_META, weight: 0.6033 cost: 2.0620 min: 1.0491 max: 3.3470 USE_META, weight: 0.5760 cost: 2.1317 min: 1.0491 max: 3.3470 USE_META, weight: 0.6220 cost: 2.0143 min: 1.0491 max: 3.3470 USE_META, weight: 0.5691 cost: 2.1492 min: 1.0491 max: 3.3470 USE_META, weight: 0.5732 cost: 2.1388 min: 1.0491 max: 3.3470 USE_META, weight: 0.6220 cost: 2.0143 min: 1.0491 max: 3.3470 USE_META, weight: 0.6045 cost: 2.0589 min: 1.0491 max: 3.3470 USE_META, weight: 0.5352 cost: 2.2357 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9103 cost: 1.2781 min: 1.0491 max: 3.3470 USE_META, weight: 0.4639 cost: 2.4178 min: 1.0491 max: 3.3470 USE_META, weight: 0.6905 cost: 1.8394 min: 1.0491 max: 3.3470 USE_META, weight: 0.8572 cost: 1.4138 min: 1.0491 max: 3.3470 USE_META, weight: 0.6932 cost: 1.8325 min: 1.0491 max: 3.3470 USE_META, weight: 0.6895 cost: 1.8419 min: 1.0491 max: 3.3470 USE_META, weight: 0.6531 cost: 1.9349 min: 1.0491 max: 3.3470 USE_META, weight: 0.6269 cost: 2.0017 min: 1.0491 max: 3.3470 USE_META, weight: 0.5904 cost: 2.0949 min: 1.0491 max: 3.3470 USE_META, weight: 0.5628 cost: 2.1654 min: 1.0491 max: 3.3470 USE_META, weight: 0.5762 cost: 2.1310 min: 1.0491 max: 3.3470 USE_META, weight: 0.5899 cost: 2.0963 min: 1.0491 max: 3.3470 USE_META, weight: 0.8981 cost: 1.3092 min: 1.0491 max: 3.3470 USE_META, weight: 0.6897 cost: 1.8413 min: 1.0491 max: 3.3470 USE_META, weight: 0.7329 cost: 1.7311 min: 1.0491 max: 3.3470 USE_META, weight: 0.8663 cost: 1.3904 min: 1.0491 max: 3.3470 USE_META, weight: 0.8380 cost: 1.4628 min: 1.0491 max: 3.3470 USE_META, weight: 0.4423 cost: 2.4731 min: 1.0491 max: 3.3470 USE_META, weight: 0.6269 cost: 2.0017 min: 1.0491 max: 3.3470 USE_META, weight: 0.6891 cost: 1.8430 min: 1.0491 max: 3.3470 USE_META, weight: 0.5904 cost: 2.0949 min: 1.0491 max: 3.3470 USE_META, weight: 0.5889 cost: 2.0988 min: 1.0491 max: 3.3470 USE_META, weight: 0.5628 cost: 2.1654 min: 1.0491 max: 3.3470 USE_META, weight: 0.5860 cost: 2.1061 min: 1.0491 max: 3.3470 USE_META, weight: 0.5584 cost: 2.1767 min: 1.0491 max: 3.3470 USE_META, weight: 0.5503 cost: 2.1972 min: 1.0491 max: 3.3470 USE_META, weight: 0.5369 cost: 2.2314 min: 1.0491 max: 3.3470 USE_META, weight: 0.6692 cost: 1.8937 min: 1.0491 max: 3.3470 USE_META, weight: 0.6335 cost: 1.9849 min: 1.0491 max: 3.3470 USE_META, weight: 0.6025 cost: 2.0641 min: 1.0491 max: 3.3470 USE_META, weight: 0.5843 cost: 2.1105 min: 1.0491 max: 3.3470 USE_META, weight: 0.5449 cost: 2.2111 min: 1.0491 max: 3.3470 USE_META, weight: 0.6024 cost: 2.0643 min: 1.0491 max: 3.3470 USE_META, weight: 0.6424 cost: 1.9621 min: 1.0491 max: 3.3470 USE_META, weight: 0.6080 cost: 2.0499 min: 1.0491 max: 3.3470 USE_META, weight: 0.5979 cost: 2.0758 min: 1.0491 max: 3.3470 USE_META, weight: 0.5577 cost: 2.1784 min: 1.0491 max: 3.3470 USE_META, weight: 0.6043 cost: 2.0595 min: 1.0491 max: 3.3470 USE_META, weight: 0.7185 cost: 1.7678 min: 1.0491 max: 3.3470 USE_META, weight: 0.5976 cost: 2.0764 min: 1.0491 max: 3.3470 USE_META, weight: 0.7082 cost: 1.7940 min: 1.0491 max: 3.3470 USE_META, weight: 0.5871 cost: 2.1033 min: 1.0491 max: 3.3470 USE_META, weight: 0.6953 cost: 1.8271 min: 1.0491 max: 3.3470 USE_META, weight: 0.6693 cost: 1.8935 min: 1.0491 max: 3.3470 USE_META, weight: 0.6854 cost: 1.8523 min: 1.0491 max: 3.3470 USE_META, weight: 0.6549 cost: 1.9303 min: 1.0491 max: 3.3470 USE_META, weight: 0.6994 cost: 1.8167 min: 1.0491 max: 3.3470 USE_META, weight: 0.6354 cost: 1.9800 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.6185 cost: 2.0230 min: 1.0491 max: 3.3470 USE_META, weight: 0.9747 cost: 1.1136 min: 1.0491 max: 3.3470 USE_META, weight: 0.9903 cost: 1.0739 min: 1.0491 max: 3.3470 USE_META, weight: 0.8707 cost: 1.3792 min: 1.0491 max: 3.3470 USE_META, weight: 1.0000 cost: 1.0491 min: 1.0491 max: 3.3470 USE_META, weight: 0.6240 cost: 2.0091 min: 1.0491 max: 3.3470 USE_META, weight: 0.6952 cost: 1.8272 min: 1.0491 max: 3.3470 USE_META, weight: 0.5789 cost: 2.1243 min: 1.0491 max: 3.3470 USE_META, weight: 0.5503 cost: 2.1972 min: 1.0491 max: 3.3470 USE_META, weight: 0.6692 cost: 1.8937 min: 1.0491 max: 3.3470 USE_META, weight: 0.6163 cost: 2.0288 min: 1.0491 max: 3.3470 USE_META, weight: 0.5260 cost: 2.2592 min: 1.0491 max: 3.3470 USE_META, weight: 0.6890 cost: 1.8432 min: 1.0491 max: 3.3470 USE_META, weight: 0.5751 cost: 2.1339 min: 1.0491 max: 3.3470 USE_META, weight: 0.6802 cost: 1.8657 min: 1.0491 max: 3.3470 USE_META, weight: 0.6045 cost: 2.0589 min: 1.0491 max: 3.3470 USE_META, weight: 0.5648 cost: 2.1603 min: 1.0491 max: 3.3470 USE_META, weight: 0.4602 cost: 2.4272 min: 1.0491 max: 3.3470 USE_META, weight: 0.4775 cost: 2.3831 min: 1.0491 max: 3.3470 USE_META, weight: 0.5518 cost: 2.1935 min: 1.0491 max: 3.3470 USE_META, weight: 0.9106 cost: 1.2773 min: 1.0491 max: 3.3470 USE_META, weight: 0.9113 cost: 1.2756 min: 1.0491 max: 3.3470 USE_META, weight: 0.9099 cost: 1.2792 min: 1.0491 max: 3.3470 USE_META, weight: 0.9097 cost: 1.2797 min: 1.0491 max: 3.3470 USE_META, weight: 0.9097 cost: 1.2796 min: 1.0491 max: 3.3470 USE_META, weight: 0.9541 cost: 1.1662 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9106 cost: 1.2773 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.7238 cost: 1.7543 min: 1.0491 max: 3.3470 USE_META, weight: 0.6316 cost: 1.9897 min: 1.0491 max: 3.3470 USE_META, weight: 0.6068 cost: 2.0530 min: 1.0491 max: 3.3470 USE_META, weight: 0.7038 cost: 1.8052 min: 1.0491 max: 3.3470 USE_META, weight: 0.6997 cost: 1.8158 min: 1.0491 max: 3.3470 USE_META, weight: 0.6511 cost: 1.9400 min: 1.0491 max: 3.3470 USE_META, weight: 0.6514 cost: 1.9392 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9105 cost: 1.2775 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9107 cost: 1.2771 min: 1.0491 max: 3.3470 USE_META, weight: 0.9105 cost: 1.2776 min: 1.0491 max: 3.3470 USE_META, weight: 0.4659 cost: 2.4127 min: 1.0491 max: 3.3470 USE_META, weight: 0.4158 cost: 2.5406 min: 1.0491 max: 3.3470 USE_META, weight: 0.2986 cost: 2.8399 min: 1.0491 max: 3.3470 USE_META, weight: 0.3757 cost: 2.6431 min: 1.0491 max: 3.3470 USE_META, weight: 0.4886 cost: 2.3547 min: 1.0491 max: 3.3470 USE_META, weight: 0.4176 cost: 2.5361 min: 1.0491 max: 3.3470 USE_META, weight: 0.3620 cost: 2.6781 min: 1.0491 max: 3.3470 USE_META, weight: 0.4426 cost: 2.4724 min: 1.0491 max: 3.3470 USE_META, weight: 0.4204 cost: 2.5289 min: 1.0491 max: 3.3470 USE_META, weight: 0.4702 cost: 2.4018 min: 1.0491 max: 3.3470 USE_META, weight: 0.5557 cost: 2.1835 min: 1.0491 max: 3.3470 USE_META, weight: 0.5105 cost: 2.2990 min: 1.0491 max: 3.3470 USE_META, weight: 0.6465 cost: 1.9517 min: 1.0491 max: 3.3470 USE_META, weight: 0.6207 cost: 2.0175 min: 1.0491 max: 3.3470 USE_META, weight: 0.5463 cost: 2.2076 min: 1.0491 max: 3.3470 USE_META, weight: 0.6431 cost: 1.9602 min: 1.0491 max: 3.3470 USE_META, weight: 0.6118 cost: 2.0401 min: 1.0491 max: 3.3470 USE_META, weight: 0.6215 cost: 2.0155 min: 1.0491 max: 3.3470 USE_META, weight: 0.7082 cost: 1.7941 min: 1.0491 max: 3.3470 USE_META, weight: 0.8951 cost: 1.3170 min: 1.0491 max: 3.3470 USE_META, weight: 0.5553 cost: 2.1845 min: 1.0491 max: 3.3470 USE_META, weight: 0.4999 cost: 2.3260 min: 1.0491 max: 3.3470 USE_META, weight: 0.5658 cost: 2.1576 min: 1.0491 max: 3.3470 USE_META, weight: 0.5125 cost: 2.2939 min: 1.0491 max: 3.3470 USE_META, weight: 0.5553 cost: 2.1845 min: 1.0491 max: 3.3470 USE_META, weight: 0.5392 cost: 2.2257 min: 1.0491 max: 3.3470 USE_EVALUE, weight: 0.8317 eval: 7.1497 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.8317 eval: 7.1497 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.8317 eval: 7.1497 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5658 eval: 15.7240 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5658 eval: 15.7240 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5658 eval: 15.7240 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6143 eval: 14.1610 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6143 eval: 14.1610 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6143 eval: 14.1610 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7973 eval: 8.2583 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7973 eval: 8.2583 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7973 eval: 8.2583 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6241 eval: 13.8440 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6241 eval: 13.8440 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6241 eval: 13.8440 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7714 eval: 9.0942 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7714 eval: 9.0942 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7714 eval: 9.0942 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5766 eval: 15.3760 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5766 eval: 15.3760 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5766 eval: 15.3760 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.1000 eval: 30.7430 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.1000 eval: 30.7430 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.1000 eval: 30.7430 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6172 eval: 14.0650 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6172 eval: 14.0650 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6172 eval: 14.0650 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 1.0000 eval: 1.7237 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 1.0000 eval: 1.7237 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 1.0000 eval: 1.7237 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7313 eval: 10.3890 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7313 eval: 10.3890 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7313 eval: 10.3890 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7226 eval: 10.6680 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7226 eval: 10.6680 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7226 eval: 10.6680 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7126 eval: 10.9900 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7126 eval: 10.9900 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7126 eval: 10.9900 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6008 eval: 14.5960 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6008 eval: 14.5960 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6008 eval: 14.5960 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.9401 eval: 3.6541 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.9401 eval: 3.6541 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.9401 eval: 3.6541 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.8581 eval: 6.2999 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.8581 eval: 6.2999 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.8581 eval: 6.2999 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7437 eval: 9.9890 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7437 eval: 9.9890 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.7437 eval: 9.9890 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5615 eval: 15.8620 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5615 eval: 15.8620 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5615 eval: 15.8620 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6627 eval: 12.6000 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6627 eval: 12.6000 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.6627 eval: 12.6000 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5471 eval: 16.3280 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5471 eval: 16.3280 min: 1.7237 max: 30.7430 USE_EVALUE, weight: 0.5471 eval: 16.3280 min: 1.7237 max: 30.7430 Number of contacts in models: 248 Number of contacts in alignments: 60 NUMB_ALIGNS: 60 Adding 62426 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -926.1858, CN propb: -926.1858 weights: 0.1727 constraints: 3735 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 3735 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 3735 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 58691 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 58691 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 62426 # command: