# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0344/ # command:# Making conformation for sequence T0344 numbered 1 through 229 Created new target T0344 from T0344.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0344/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0344/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0344//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0344/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0344/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0344/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gvoA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gvoA expands to /projects/compbio/data/pdb/1gvo.pdb.gz 1gvoA:# T0344 read from 1gvoA/merged-good-all-a2m # 1gvoA read from 1gvoA/merged-good-all-a2m # adding 1gvoA to template set # found chain 1gvoA in template set T0344 44 :YANPYDYDLTGR 1gvoA 237 :IGTFQNVDNGPN # choosing archetypes in rotamer library T0344 58 :IRDEVLLAIELARKVKPDVIHLDSTLG 1gvoA 249 :EEADALYLIEELAKRGIAYLHMSETDL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2 Number of alignments=1 # 1gvoA read from 1gvoA/merged-good-all-a2m # found chain 1gvoA in template set T0344 48 :YDYD 1gvoA 241 :QNVD T0344 54 :GRQAIRDEVLLAIELARKVKPDVIHLDSTLG 1gvoA 245 :NGPNEEADALYLIEELAKRGIAYLHMSETDL Number of specific fragments extracted= 2 number of extra gaps= 0 total=4 Number of alignments=2 # 1gvoA read from 1gvoA/merged-good-all-a2m # found chain 1gvoA in template set T0344 12 :VLDET 1gvoA 133 :LRDEN T0344 37 :AKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLG 1gvoA 138 :GNAIRVDTTTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHG T0344 100 :GISDKGKEVWKELSKDLQPLARKFWEETN 1gvoA 198 :QRTDQYGGSVENRARLVLEVVDAVCNEWS T0344 129 :IEIVAIGKSSV 1gvoA 230 :IGIRVSPIGTF T0344 148 :AGIYSAKWGIENVEKEG 1gvoA 248 :NEEADALYLIEELAKRG T0344 165 :HLIIGLP 1gvoA 266 :AYLHMSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=10 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u0sY/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1u0sY expands to /projects/compbio/data/pdb/1u0s.pdb.gz 1u0sY:Skipped atom 825, because occupancy 0.5 <= existing 0.500 in 1u0sY Skipped atom 827, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 829, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 1u0sY Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 1u0sY # T0344 read from 1u0sY/merged-good-all-a2m # 1u0sY read from 1u0sY/merged-good-all-a2m # adding 1u0sY to template set # found chain 1u0sY in template set T0344 55 :RQAIRDEVLL 1u0sY 15 :RMMLKDIITK T0344 65 :AIELARKVKPDVIHLDSTLGG 1u0sY 39 :AVEKYKELKPDIVTMDITMPE T0344 96 :ID 1u0sY 60 :MN T0344 116 :LQPLARKFWE 1u0sY 62 :GIDAIKEIMK T0344 126 :ETNIEIVAIGKSSVP 1u0sY 73 :DPNAKIIVCSAMGQQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=15 Number of alignments=4 # 1u0sY read from 1u0sY/merged-good-all-a2m # found chain 1u0sY in template set T0344 2 :RIVAADTGGA 1u0sY 4 :RVLIVDDAAF T0344 54 :GRQAIRDEVLL 1u0sY 14 :MRMMLKDIITK T0344 65 :AIELARKVKPDVIHLDSTLGGIE 1u0sY 39 :AVEKYKELKPDIVTMDITMPEMN T0344 116 :LQPLARKFWEE 1u0sY 62 :GIDAIKEIMKI T0344 127 :TNIEIVAIGKSSVPVRIAEIYA 1u0sY 74 :PNAKIIVCSAMGQQAMVIEAIK Number of specific fragments extracted= 5 number of extra gaps= 0 total=20 Number of alignments=5 # 1u0sY read from 1u0sY/merged-good-all-a2m # found chain 1u0sY in template set T0344 55 :RQAIRDEVLL 1u0sY 15 :RMMLKDIITK T0344 65 :AIELARKVKPDVIHLDSTLGGI 1u0sY 39 :AVEKYKELKPDIVTMDITMPEM T0344 115 :DLQPLARKFWE 1u0sY 61 :NGIDAIKEIMK T0344 126 :ETNIEIVAIGKSSVPV 1u0sY 73 :DPNAKIIVCSAMGQQA T0344 156 :GIENVEKEG 1u0sY 89 :MVIEAIKAG T0344 165 :HLIIGLP 1u0sY 99 :KDFIVKP Number of specific fragments extracted= 6 number of extra gaps= 0 total=26 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tmy/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tmy expands to /projects/compbio/data/pdb/1tmy.pdb.gz 1tmy:Warning: there is no chain 1tmy will retry with 1tmyA # T0344 read from 1tmy/merged-good-all-a2m # 1tmy read from 1tmy/merged-good-all-a2m # adding 1tmy to template set # found chain 1tmy in template set T0344 55 :RQAIRDEVLL 1tmy 15 :RMMLKDIITK T0344 65 :AIELARKVKPDVIHLDSTLGGIE 1tmy 39 :AVEKYKELKPDIVTMDITMPEMN T0344 116 :LQPLARKFWE 1tmy 62 :GIDAIKEIMK T0344 126 :ETNIEIVAIGKSSVPVRIAE 1tmy 73 :DPNAKIIVCSAMGQQAMVIE Number of specific fragments extracted= 4 number of extra gaps= 0 total=30 Number of alignments=7 # 1tmy read from 1tmy/merged-good-all-a2m # found chain 1tmy in template set T0344 55 :RQAIRDEVLL 1tmy 15 :RMMLKDIITK T0344 65 :AIELARKVKPDVIHLDSTLGGIE 1tmy 39 :AVEKYKELKPDIVTMDITMPEMN T0344 116 :LQPLARKFWEE 1tmy 62 :GIDAIKEIMKI T0344 127 :TNIEIVAIGKSSVPVRIAEIYAG 1tmy 74 :PNAKIIVCSAMGQQAMVIEAIKA Number of specific fragments extracted= 4 number of extra gaps= 0 total=34 Number of alignments=8 # 1tmy read from 1tmy/merged-good-all-a2m # found chain 1tmy in template set Warning: unaligning (T0344)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1tmy)I102 Warning: unaligning (T0344)I168 because of BadResidue code BAD_PEPTIDE at template residue (1tmy)I102 T0344 55 :RQAIRDEVLL 1tmy 15 :RMMLKDIITK T0344 65 :AIELARKVKPDVIHLDSTLGGI 1tmy 39 :AVEKYKELKPDIVTMDITMPEM T0344 115 :DLQPLARKFWE 1tmy 61 :NGIDAIKEIMK T0344 126 :ETNIEIVAIGKSSVPV 1tmy 73 :DPNAKIIVCSAMGQQA T0344 156 :GIENVEKEG 1tmy 89 :MVIEAIKAG T0344 165 :HL 1tmy 99 :KD T0344 169 :GLP 1tmy 103 :VKP Number of specific fragments extracted= 7 number of extra gaps= 1 total=41 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1atr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1atr expands to /projects/compbio/data/pdb/1atr.pdb.gz 1atr:Warning: there is no chain 1atr will retry with 1atrA # T0344 read from 1atr/merged-good-all-a2m # 1atr read from 1atr/merged-good-all-a2m # adding 1atr to template set # found chain 1atr in template set T0344 2 :RIVAADTGGAVL 1atr 194 :NVLIFDLGGGVF T0344 25 :TVAVLVEKPYR 1atr 206 :DVSILTIEDGI T0344 39 :EVMVKYANPY 1atr 218 :EVKSTAGDTH T0344 49 :DYDLTGRQAIRDEVLLAIELARKV 1atr 250 :KKDISENKRAVRRLRTACERAKRT T0344 79 :LDSTLGGIELRKLDEP 1atr 275 :SSSTQASIEIDSLYEG T0344 96 :IDALGISDKGK 1atr 291 :IDFYTSITRAR T0344 107 :EVWKELSKDLQPLARKFWEETNI 1atr 304 :ELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGKSS 1atr 333 :DIVLVGGST T0344 152 :SAKWGIENVEK 1atr 342 :RIPKIQKLLQD T0344 163 :EGH 1atr 355 :NGK Number of specific fragments extracted= 10 number of extra gaps= 0 total=51 Number of alignments=10 # 1atr read from 1atr/merged-good-all-a2m # found chain 1atr in template set T0344 37 :AKEVMVKYANPYD 1atr 98 :AGRPKVQVEYKGE T0344 50 :YDLTGRQAIRDEVLLAIELARK 1atr 112 :KSFYPEEVSSMVLTKMKEIAEA T0344 73 :KPDVIHLDSTLG 1atr 138 :TVTNAVVTVPAY T0344 91 :L 1atr 150 :F T0344 113 :SKDLQPLARKFWEETNIEIVAIGK 1atr 151 :NDSQRQATKDAGTIAGLNVLRIIN T0344 149 :GIYSAKWGIENVEKEGH 1atr 175 :EPTAAAIAYGLDKKVGA T0344 166 :LIIGL 1atr 196 :LIFDL T0344 171 :PRYMEV 1atr 202 :GGVFDV T0344 177 :NIKDGKIIGRSL 1atr 211 :TIEDGIFEVKST Number of specific fragments extracted= 9 number of extra gaps= 0 total=60 Number of alignments=11 # 1atr read from 1atr/merged-good-all-a2m # found chain 1atr in template set T0344 3 :IVAADTGGAVLD 1atr 195 :VLIFDLGGGVFD T0344 25 :TVAVLVEKPYRSAKEVMVKYANP 1atr 207 :VSILTIEDGIFEVKSTAGDTHLG T0344 49 :DYDLTGRQAIRDEVLLAIELARKVKPD 1atr 250 :KKDISENKRAVRRLRTACERAKRTLSS T0344 81 :STLGGIELRKLDEP 1atr 277 :STQASIEIDSLYEG T0344 95 :TIDA 1atr 298 :TRAR T0344 105 :GKEVWKELSKDLQPLARKFWEETNI 1atr 302 :FEELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGK 1atr 333 :DIVLVGG T0344 150 :IYSAKWGIENVEK 1atr 340 :STRIPKIQKLLQD T0344 163 :EGH 1atr 355 :NGK Number of specific fragments extracted= 9 number of extra gaps= 0 total=69 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ats/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ats expands to /projects/compbio/data/pdb/1ats.pdb.gz 1ats:Warning: there is no chain 1ats will retry with 1atsA # T0344 read from 1ats/merged-good-all-a2m # 1ats read from 1ats/merged-good-all-a2m # adding 1ats to template set # found chain 1ats in template set T0344 3 :IVAADTGGAV 1ats 195 :VLIFDLGGGE T0344 23 :I 1ats 205 :F T0344 25 :TVAVLVEKP 1ats 206 :DVSILTIED T0344 38 :KEVMVKYA 1ats 215 :GIFEVKST T0344 46 :NPY 1ats 225 :DTH T0344 49 :DYDLTGRQAIRDEVLLAIELARKV 1ats 250 :KKDISENKRAVRRLRTACERAKRT T0344 80 :DSTLGGIELRKLDEP 1ats 276 :SSTQASIEIDSLYEG T0344 96 :IDALGISDKG 1ats 291 :IDFYTSITRA T0344 106 :KEVWKELSKDLQPLARKFWEETNI 1ats 303 :EELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGKSS 1ats 333 :DIVLVGGST T0344 152 :SAKWGIENVEK 1ats 342 :RIPKIQKLLQD T0344 163 :EGH 1ats 355 :NGK Number of specific fragments extracted= 12 number of extra gaps= 0 total=81 Number of alignments=13 # 1ats read from 1ats/merged-good-all-a2m # found chain 1ats in template set T0344 3 :IVAADTGGAVL 1ats 195 :VLIFDLGGGEF T0344 24 :ATVAVLVEKPYRSAKEVMVKYA 1ats 206 :DVSILTIEDGIFEVKSTAGDTH T0344 49 :DYDLTGRQAIRDEVLLAIELARK 1ats 250 :KKDISENKRAVRRLRTACERAKR T0344 72 :VKPDVIHLDSTLGGIEL 1ats 277 :STQASIEIDSLYEGIDF T0344 89 :RKLDEPTID 1ats 295 :TSITRARFE T0344 107 :EVWKELSKDLQPLARKFWEETNI 1ats 304 :ELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGK 1ats 333 :DIVLVGG Number of specific fragments extracted= 7 number of extra gaps= 0 total=88 Number of alignments=14 # 1ats read from 1ats/merged-good-all-a2m # found chain 1ats in template set T0344 3 :IVAADTGGAV 1ats 195 :VLIFDLGGGE T0344 23 :IATVAVLVEKPYRSAKEVMVKYANP 1ats 205 :FDVSILTIEDGIFEVKSTAGDTHLG T0344 49 :DYDLTGRQAIRDEVLLAIELARKV 1ats 250 :KKDISENKRAVRRLRTACERAKRT T0344 73 :KPDVIHLDSTLGGIE 1ats 278 :TQASIEIDSLYEGID T0344 88 :LRKLDEPTID 1ats 294 :YTSITRARFE T0344 107 :EVWKELSKDLQPLARKFWEETNI 1ats 304 :ELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGK 1ats 333 :DIVLVGG T0344 150 :IYSAKWGIENVEK 1ats 340 :STRIPKIQKLLQD T0344 163 :EGH 1ats 355 :NGK Number of specific fragments extracted= 9 number of extra gaps= 0 total=97 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l2tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l2tA expands to /projects/compbio/data/pdb/1l2t.pdb.gz 1l2tA:# T0344 read from 1l2tA/merged-good-all-a2m # 1l2tA read from 1l2tA/merged-good-all-a2m # adding 1l2tA to template set # found chain 1l2tA in template set T0344 51 :DLTGRQA 1l2tA 145 :QLSGGQQ T0344 60 :DEVLLAIELA 1l2tA 152 :QRVAIARALA T0344 72 :VKPDVIHLDSTLGGI 1l2tA 162 :NNPPIILADQPTGAL T0344 92 :DE 1l2tA 177 :DS T0344 111 :ELSKDLQPLARKFWEETNIEIVAIGKS 1l2tA 179 :KTGEKIMQLLKKLNEEDGKTVVVVTHD T0344 158 :ENVEKEGHLII 1l2tA 206 :INVARFGERII T0344 177 :NIKDGKIIGRS 1l2tA 217 :YLKDGEVEREE Number of specific fragments extracted= 7 number of extra gaps= 0 total=104 Number of alignments=16 # 1l2tA read from 1l2tA/merged-good-all-a2m # found chain 1l2tA in template set T0344 51 :DLTGRQ 1l2tA 145 :QLSGGQ T0344 59 :RDEVLLAIELA 1l2tA 151 :QQRVAIARALA T0344 72 :VKPDVIHLDSTLGG 1l2tA 162 :NNPPIILADQPTGA T0344 91 :LDEPTI 1l2tA 176 :LDSKTG T0344 114 :KDLQPLARKFWEETNIEIVAIGKS 1l2tA 182 :EKIMQLLKKLNEEDGKTVVVVTHD T0344 158 :ENVEKEGHLII 1l2tA 206 :INVARFGERII T0344 177 :NIKDGKIIGRS 1l2tA 217 :YLKDGEVEREE Number of specific fragments extracted= 7 number of extra gaps= 0 total=111 Number of alignments=17 # 1l2tA read from 1l2tA/merged-good-all-a2m # found chain 1l2tA in template set T0344 44 :YANPYDYDLTGRQA 1l2tA 138 :FANHKPNQLSGGQQ T0344 60 :DEVLLAIELA 1l2tA 152 :QRVAIARALA T0344 72 :VKPDVIHLDSTLGGIE 1l2tA 162 :NNPPIILADQPTGALD T0344 110 :KELSKDLQPLARKFWEETNIEIVAIGKS 1l2tA 178 :SKTGEKIMQLLKKLNEEDGKTVVVVTHD T0344 158 :ENVEKEGHLII 1l2tA 206 :INVARFGERII T0344 177 :NIKDGKIIGRS 1l2tA 217 :YLKDGEVEREE Number of specific fragments extracted= 6 number of extra gaps= 0 total=117 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hx1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1hx1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1hx1A/merged-good-all-a2m.gz for input Trying 1hx1A/merged-good-all-a2m Error: Couldn't open file 1hx1A/merged-good-all-a2m or 1hx1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1h61A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1h61A expands to /projects/compbio/data/pdb/1h61.pdb.gz 1h61A:# T0344 read from 1h61A/merged-good-all-a2m # 1h61A read from 1h61A/merged-good-all-a2m # adding 1h61A to template set # found chain 1h61A in template set T0344 32 :KPYRSAKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLG 1h61A 133 :LRDENGNAIRVDTTTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHG T0344 97 :DALGISDKGKEVWKELSKDLQPLARKFWEETN 1h61A 195 :SSNQRTDQYGGSVENRARLVLEVVDAVCNEWS T0344 129 :IEIVAIGKSSV 1h61A 230 :IGIRVSPIGTF T0344 148 :AGIYSAKWGIENVEKEGHLII 1h61A 248 :NEEADALYLIEELAKRGIAYL Number of specific fragments extracted= 4 number of extra gaps= 0 total=121 Number of alignments=19 # 1h61A read from 1h61A/merged-good-all-a2m # found chain 1h61A in template set T0344 7 :DTGGAVLDETFEP 1h61A 128 :NTRTSLRDENGNA T0344 40 :VMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLG 1h61A 141 :IRVDTTTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHG T0344 97 :DALGISDKGKEVWKELSKDLQPLARKFWEETN 1h61A 195 :SSNQRTDQYGGSVENRARLVLEVVDAVCNEWS T0344 129 :IEIVAIGKSSV 1h61A 230 :IGIRVSPIGTF T0344 148 :AGIYSAKWGIENVEKEG 1h61A 248 :NEEADALYLIEELAKRG Number of specific fragments extracted= 5 number of extra gaps= 0 total=126 Number of alignments=20 # 1h61A read from 1h61A/merged-good-all-a2m # found chain 1h61A in template set T0344 11 :AVLDET 1h61A 132 :SLRDEN T0344 37 :AKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLG 1h61A 138 :GNAIRVDTTTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHG T0344 100 :GISDKGKEVWKELSKDLQPLARKFWEETN 1h61A 198 :QRTDQYGGSVENRARLVLEVVDAVCNEWS T0344 129 :IEIVAIGKSSV 1h61A 230 :IGIRVSPIGTF T0344 148 :AGIYSAKWGIENVEKEG 1h61A 248 :NEEADALYLIEELAKRG T0344 165 :HLIIGL 1h61A 266 :AYLHMS Number of specific fragments extracted= 6 number of extra gaps= 0 total=132 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bupA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/2bupA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/2bupA/merged-good-all-a2m.gz for input Trying 2bupA/merged-good-all-a2m Error: Couldn't open file 2bupA/merged-good-all-a2m or 2bupA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hpm/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hpm expands to /projects/compbio/data/pdb/1hpm.pdb.gz 1hpm:Warning: there is no chain 1hpm will retry with 1hpmA # T0344 read from 1hpm/merged-good-all-a2m # 1hpm read from 1hpm/merged-good-all-a2m # adding 1hpm to template set # found chain 1hpm in template set T0344 3 :IVAADTGGAV 1hpm 195 :VLIFDLGGGT T0344 23 :IATVAVLVEKPYRSAKEVMVK 1hpm 205 :FDVSILTIEDGIFEVKSTAGD T0344 47 :PY 1hpm 226 :TH T0344 49 :DYDLTGRQAIRDEVLLAIELARKV 1hpm 250 :KKDISENKRAVRRLRTACERAKRT T0344 79 :LDSTLGGIELRKLDEP 1hpm 275 :SSSTQASIEIDSLYEG T0344 96 :IDALGISDKG 1hpm 291 :IDFYTSITRA T0344 106 :KEVWKELSKDLQPLARKFWEETNI 1hpm 303 :EELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGKSS 1hpm 333 :DIVLVGGST T0344 152 :SAKWGIENVEK 1hpm 342 :RIPKIQKLLQD T0344 163 :EGH 1hpm 355 :NGK Number of specific fragments extracted= 10 number of extra gaps= 0 total=142 Number of alignments=22 # 1hpm read from 1hpm/merged-good-all-a2m # found chain 1hpm in template set T0344 3 :IVAADTGGAVL 1hpm 195 :VLIFDLGGGTF T0344 24 :ATVA 1hpm 206 :DVSI T0344 176 :VNIKDGKIIGRS 1hpm 210 :LTIEDGIFEVKS Number of specific fragments extracted= 3 number of extra gaps= 0 total=145 Number of alignments=23 # 1hpm read from 1hpm/merged-good-all-a2m # found chain 1hpm in template set T0344 3 :IVAADTGGAV 1hpm 195 :VLIFDLGGGT T0344 23 :IATVAVLVEKPYRSAKEVMVKYANP 1hpm 205 :FDVSILTIEDGIFEVKSTAGDTHLG T0344 49 :DYDLTGRQAIRDEVLLAIELARKVKPD 1hpm 250 :KKDISENKRAVRRLRTACERAKRTLSS T0344 77 :IHLDSTLGGIE 1hpm 282 :IEIDSLYEGID T0344 88 :LRKLDEPTID 1hpm 294 :YTSITRARFE T0344 107 :EVWKELSKDLQPLARKFWEETNI 1hpm 304 :ELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGK 1hpm 333 :DIVLVGG T0344 150 :IYSAKWGIENVEK 1hpm 340 :STRIPKIQKLLQD T0344 163 :EGH 1hpm 355 :NGK Number of specific fragments extracted= 9 number of extra gaps= 0 total=154 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fobA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0344 read from 1fobA/merged-good-all-a2m # 1fobA read from 1fobA/merged-good-all-a2m # found chain 1fobA in training set T0344 44 :YANPYDYDL 1fobA 49 :WVNPSDGSY T0344 58 :IRDEVLLAIELARKVKPDVIHL 1fobA 58 :DLDYNLELAKRVKAAGMSLYLD T0344 80 :DST 1fobA 83 :SDT T0344 90 :KLDEPTIDALG 1fobA 86 :WADPSDQTTPS T0344 101 :ISDKG 1fobA 98 :WSTTD T0344 106 :KEVWKELSKDLQPLARKFWEET 1fobA 104 :GTLKWQLYNYTLEVCNTFAEND T0344 128 :NIEIVAIG 1fobA 127 :DIEIISIG T0344 139 :VPVRIAEIYAGIYSAKWGIENVEKEG 1fobA 147 :ETSSYSNIGALLHSGAWGVKDSNLAT T0344 165 :HLIIGL 1fobA 175 :KIMIHL Number of specific fragments extracted= 9 number of extra gaps= 0 total=163 Number of alignments=25 # 1fobA read from 1fobA/merged-good-all-a2m # found chain 1fobA in training set T0344 45 :ANPYDYD 1fobA 50 :VNPSDGS T0344 57 :AIRDEVLLAIELARKVKPDVIHL 1fobA 57 :YDLDYNLELAKRVKAAGMSLYLD T0344 80 :DSTLG 1fobA 81 :HLSDT T0344 90 :KLDEPTIDA 1fobA 86 :WADPSDQTT T0344 99 :LGISDKG 1fobA 96 :SGWSTTD T0344 106 :KEVWKELSKDLQPLARKFWEET 1fobA 104 :GTLKWQLYNYTLEVCNTFAEND T0344 128 :NIEIVAIG 1fobA 127 :DIEIISIG T0344 137 :SSVPVRIAEIYAGIYSAKWGIENVEKEG 1fobA 145 :LGETSSYSNIGALLHSGAWGVKDSNLAT T0344 165 :HLIIGLP 1fobA 175 :KIMIHLD Number of specific fragments extracted= 9 number of extra gaps= 0 total=172 Number of alignments=26 # 1fobA read from 1fobA/merged-good-all-a2m # found chain 1fobA in training set T0344 44 :YANPYDYDLT 1fobA 49 :WVNPSDGSYD T0344 59 :RDEVLLAIELARKVKPDV 1fobA 59 :LDYNLELAKRVKAAGMSL T0344 77 :IHLDSTLGGIE 1fobA 78 :LDLHLSDTWAD T0344 90 :KLDEPTIDALGISDKG 1fobA 89 :PSDQTTPSGWSTTDLG T0344 107 :EVWKELSKDLQPLARKFWEET 1fobA 105 :TLKWQLYNYTLEVCNTFAEND T0344 128 :NIEIVAIG 1fobA 127 :DIEIISIG T0344 147 :YAGIYS 1fobA 151 :YSNIGA T0344 153 :AKWGIENVEK 1fobA 158 :LHSGAWGVKD T0344 165 :HLIIGLPR 1fobA 175 :KIMIHLDD Number of specific fragments extracted= 9 number of extra gaps= 0 total=181 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b99A expands to /projects/compbio/data/pdb/2b99.pdb.gz 2b99A:# T0344 read from 2b99A/merged-good-all-a2m # 2b99A read from 2b99A/merged-good-all-a2m # adding 2b99A to template set # found chain 2b99A in template set T0344 3 :IVAADTGGA 2b99A 34 :IIRKTVPGI T0344 56 :QA 2b99A 43 :KD T0344 61 :EVLLAIELARKVKPDVIHLDSTLG 2b99A 45 :LPVACKKLLEEEGCDIVMALGMPG T0344 105 :GKEVWKELSKDLQPLARKFWEETNIEIVAIG 2b99A 69 :KAEKDKVCAHEASLGLMLAQLMTNKHIIEVF Number of specific fragments extracted= 4 number of extra gaps= 0 total=185 Number of alignments=28 # 2b99A read from 2b99A/merged-good-all-a2m # found chain 2b99A in template set T0344 39 :EVMVKYANPY 2b99A 33 :KIIRKTVPGI T0344 59 :RDEVLLAIELARKVKPDVIHLDSTL 2b99A 43 :KDLPVACKKLLEEEGCDIVMALGMP T0344 100 :G 2b99A 68 :G T0344 105 :GKEVWKELSKDLQPLARKFWEETNIEIVAI 2b99A 69 :KAEKDKVCAHEASLGLMLAQLMTNKHIIEV Number of specific fragments extracted= 4 number of extra gaps= 0 total=189 Number of alignments=29 # 2b99A read from 2b99A/merged-good-all-a2m # found chain 2b99A in template set T0344 1 :MRIVAADTGGA 2b99A 3 :KKVGIVDTTFA T0344 49 :DYDL 2b99A 14 :RVDM T0344 62 :VLLAIELARKVKPDVIHLDSTLGGI 2b99A 18 :ASIAIKKLKELSPNIKIIRKTVPGI T0344 114 :KDLQPLARKFWEETNIEIVAI 2b99A 43 :KDLPVACKKLLEEEGCDIVMA T0344 135 :GKSS 2b99A 68 :GKAE T0344 146 :IYAGIYSAKWGIENVEK 2b99A 73 :DKVCAHEASLGLMLAQL T0344 163 :EGHLIIGLP 2b99A 92 :NKHIIEVFV Number of specific fragments extracted= 7 number of extra gaps= 0 total=196 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kax/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1kax/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1kax/merged-good-all-a2m.gz for input Trying 1kax/merged-good-all-a2m Error: Couldn't open file 1kax/merged-good-all-a2m or 1kax/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kaz/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1kaz/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1kaz/merged-good-all-a2m.gz for input Trying 1kaz/merged-good-all-a2m Error: Couldn't open file 1kaz/merged-good-all-a2m or 1kaz/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ngc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1ngc/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1ngc/merged-good-all-a2m.gz for input Trying 1ngc/merged-good-all-a2m Error: Couldn't open file 1ngc/merged-good-all-a2m or 1ngc/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ngd/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1ngd/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1ngd/merged-good-all-a2m.gz for input Trying 1ngd/merged-good-all-a2m Error: Couldn't open file 1ngd/merged-good-all-a2m or 1ngd/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nge/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1nge/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1nge/merged-good-all-a2m.gz for input Trying 1nge/merged-good-all-a2m Error: Couldn't open file 1nge/merged-good-all-a2m or 1nge/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z47A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z47A expands to /projects/compbio/data/pdb/1z47.pdb.gz 1z47A:# T0344 read from 1z47A/merged-good-all-a2m # 1z47A read from 1z47A/merged-good-all-a2m # adding 1z47A to template set # found chain 1z47A in template set T0344 47 :PYDYDLTGRQ 1z47A 141 :RFPHELSGGQ T0344 61 :EVLLAIELARKVKPDVIHLDSTLGG 1z47A 151 :QQRVALARALAPRPQVLLFDEPFAA T0344 104 :KGKEVWKELS 1z47A 176 :IDTQIRRELR T0344 118 :PLARKFWEETNI 1z47A 186 :TFVRQVHDEMGV T0344 130 :EIVAIGKSSV 1z47A 215 :RVLVLHEGNV T0344 140 :PVRIAEIY 1z47A 227 :FGTPEEVY T0344 148 :AGIYSAKWGIENV 1z47A 238 :GTLFVASFIGESN T0344 161 :EKEGHLIIG 1z47A 256 :VQNGRIEVA T0344 173 :YMEVNIKDG 1z47A 265 :GAALPVDPA T0344 183 :IIGRSLDPREGGL 1z47A 289 :VELQPASEREAHA T0344 196 :YGSAEVSVPEGVKWEIY 1z47A 312 :YSACWIRTKDGEVWEVH Number of specific fragments extracted= 11 number of extra gaps= 0 total=207 Number of alignments=31 # 1z47A read from 1z47A/merged-good-all-a2m # found chain 1z47A in template set T0344 51 :DLTGRQ 1z47A 145 :ELSGGQ T0344 61 :EVLLAIELARKVKPDVIHLDSTLG 1z47A 151 :QQRVALARALAPRPQVLLFDEPFA T0344 103 :DKGKEVWKELS 1z47A 175 :AIDTQIRRELR T0344 118 :PLARKFWEETNI 1z47A 186 :TFVRQVHDEMGV T0344 130 :EIVAIGKSSV 1z47A 215 :RVLVLHEGNV T0344 140 :PVRIAEIYA 1z47A 227 :FGTPEEVYE T0344 149 :GIYSAKWGIE 1z47A 239 :TLFVASFIGE T0344 159 :NVEKEGHLIIG 1z47A 254 :RAVQNGRIEVA T0344 173 :YMEVNIKDG 1z47A 265 :GAALPVDPA T0344 183 :IIGRSLDPREGGL 1z47A 289 :VELQPASEREAHA T0344 196 :YGSAEVSVPEGVKWEIYPNPVA 1z47A 312 :YSACWIRTKDGEVWEVHVPSAD Number of specific fragments extracted= 11 number of extra gaps= 0 total=218 Number of alignments=32 # 1z47A read from 1z47A/merged-good-all-a2m # found chain 1z47A in template set T0344 44 :YANPYDYDLTGRQAI 1z47A 138 :YANRFPHELSGGQQQ T0344 63 :LLAIELARKVKPDVIHLDSTLGGIE 1z47A 153 :RVALARALAPRPQVLLFDEPFAAID T0344 110 :KELSKDLQPLARKFWEETNIEIVAIGK 1z47A 178 :TQIRRELRTFVRQVHDEMGVTSVFVTH T0344 152 :SAKWGIENV 1z47A 205 :DQEEALEVA T0344 164 :GHLIIGLPR 1z47A 214 :DRVLVLHEG T0344 173 :YMEVNIKDGKII 1z47A 251 :VWTRAVQNGRIE T0344 185 :G 1z47A 267 :A T0344 186 :RSLDPREG 1z47A 292 :QPASEREA T0344 194 :GLYGSAEVSVPEGVKWEIY 1z47A 310 :GSYSACWIRTKDGEVWEVH Number of specific fragments extracted= 9 number of extra gaps= 0 total=227 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ngf/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1ngf/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1ngf/merged-good-all-a2m.gz for input Trying 1ngf/merged-good-all-a2m Error: Couldn't open file 1ngf/merged-good-all-a2m or 1ngf/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ngg/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1ngg/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1ngg/merged-good-all-a2m.gz for input Trying 1ngg/merged-good-all-a2m Error: Couldn't open file 1ngg/merged-good-all-a2m or 1ngg/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ngh/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1ngh/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1ngh/merged-good-all-a2m.gz for input Trying 1ngh/merged-good-all-a2m Error: Couldn't open file 1ngh/merged-good-all-a2m or 1ngh/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mb3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0344 read from 1mb3A/merged-good-all-a2m # 1mb3A read from 1mb3A/merged-good-all-a2m # found chain 1mb3A in training set Warning: unaligning (T0344)G135 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mb3A)D90 Warning: unaligning (T0344)R142 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1mb3A)D90 T0344 57 :AIRDEVLL 1mb3A 17 :LFHDLLEA T0344 65 :AIELARKVKPDVIHLDSTLGGIE 1mb3A 38 :ALSIARENKPDLILMDIQLPEIS T0344 116 :LQPLARKFWEE 1mb3A 61 :GLEVTKWLKED T0344 127 :TNIEIVAI 1mb3A 75 :AHIPVVAV T0344 143 :IAEIYA 1mb3A 91 :EERIRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=232 Number of alignments=34 # 1mb3A read from 1mb3A/merged-good-all-a2m # found chain 1mb3A in training set Warning: unaligning (T0344)G135 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mb3A)D90 Warning: unaligning (T0344)R142 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1mb3A)D90 T0344 64 :LAIELARKVKPDVIHLDSTLGGIE 1mb3A 37 :SALSIARENKPDLILMDIQLPEIS T0344 116 :LQPLARKFWEE 1mb3A 61 :GLEVTKWLKED T0344 127 :TNIEIVAI 1mb3A 75 :AHIPVVAV T0344 143 :IAEIYAG 1mb3A 91 :EERIREG Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=35 # 1mb3A read from 1mb3A/merged-good-all-a2m # found chain 1mb3A in training set Warning: unaligning (T0344)G135 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mb3A)D90 T0344 56 :QAIRDEVLL 1mb3A 16 :KLFHDLLEA T0344 65 :AIELARKVKPDVIHLDSTLGGIE 1mb3A 38 :ALSIARENKPDLILMDIQLPEIS T0344 116 :LQPLARKFWEETN 1mb3A 61 :GLEVTKWLKEDDD T0344 129 :IEIVAI 1mb3A 77 :IPVVAV Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1srrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1srrA expands to /projects/compbio/data/pdb/1srr.pdb.gz 1srrA:# T0344 read from 1srrA/merged-good-all-a2m # 1srrA read from 1srrA/merged-good-all-a2m # adding 1srrA to template set # found chain 1srrA in template set T0344 64 :LAIELARKVKPDVIHLDSTLGGIE 1srrA 38 :QALDIVTKERPDLVLLDMKIPGMD T0344 105 :GKEVWKEL 1srrA 62 :GIEILKRM T0344 124 :WE 1srrA 70 :KV T0344 126 :ETNIEIVAIGKSS 1srrA 73 :DENIRVIIMTAYG Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=37 # 1srrA read from 1srrA/merged-good-all-a2m # found chain 1srrA in template set T0344 62 :VLLAIELARKVKPDVIHLDSTLGGIE 1srrA 36 :GLQALDIVTKERPDLVLLDMKIPGMD T0344 116 :LQPLARKFWEE 1srrA 62 :GIEILKRMKVI T0344 127 :TNIEIVAIGKSSVPVRIAEIYA 1srrA 74 :ENIRVIIMTAYGELDMIQESKE Number of specific fragments extracted= 3 number of extra gaps= 0 total=247 Number of alignments=38 # 1srrA read from 1srrA/merged-good-all-a2m # found chain 1srrA in template set T0344 64 :LAIELARKVKPDVIHLDSTLGGIE 1srrA 38 :QALDIVTKERPDLVLLDMKIPGMD T0344 116 :LQPLARKFWE 1srrA 62 :GIEILKRMKV T0344 126 :ETNIEIVAIGKSSVP 1srrA 73 :DENIRVIIMTAYGEL T0344 155 :WGIENVEK 1srrA 88 :DMIQESKE Number of specific fragments extracted= 4 number of extra gaps= 0 total=251 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ba0/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344/1ba0/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0344/1ba0/merged-good-all-a2m.gz for input Trying 1ba0/merged-good-all-a2m Error: Couldn't open file 1ba0/merged-good-all-a2m or 1ba0/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ba1/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ba1 expands to /projects/compbio/data/pdb/1ba1.pdb.gz 1ba1:Warning: there is no chain 1ba1 will retry with 1ba1A # T0344 read from 1ba1/merged-good-all-a2m # 1ba1 read from 1ba1/merged-good-all-a2m # adding 1ba1 to template set # found chain 1ba1 in template set T0344 3 :IVAADTGGAV 1ba1 195 :VLIFDLGGGT T0344 23 :IATVAVLVEKPYRSAKEVMV 1ba1 205 :FDVSILTIEDGIFEVKSTAG T0344 46 :NPY 1ba1 225 :DTH T0344 49 :DYDLTGRQAIRDEVLLAIELARKV 1ba1 250 :KKDISENKRAVRRLRTACERAKRT T0344 79 :LDSTLGGIELRKLDEP 1ba1 275 :SSSTQASIEIDSLYEG T0344 96 :IDALGISDKGK 1ba1 291 :IDFYTSITRAR T0344 107 :EVWKELSKDLQPLARKFWEETNI 1ba1 304 :ELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGKSS 1ba1 333 :DIVLVGGST T0344 149 :G 1ba1 342 :R T0344 153 :AKWGIENVEK 1ba1 343 :IPKIQKLLQD T0344 163 :EGH 1ba1 355 :NGK Number of specific fragments extracted= 11 number of extra gaps= 0 total=262 Number of alignments=40 # 1ba1 read from 1ba1/merged-good-all-a2m # found chain 1ba1 in template set T0344 3 :IVAADTGGAVL 1ba1 195 :VLIFDLGGGTF T0344 24 :ATVAV 1ba1 206 :DVSIL T0344 177 :NIKDGKIIGRSL 1ba1 211 :TIEDGIFEVKST Number of specific fragments extracted= 3 number of extra gaps= 0 total=265 Number of alignments=41 # 1ba1 read from 1ba1/merged-good-all-a2m # found chain 1ba1 in template set T0344 3 :IVAADTGGAV 1ba1 195 :VLIFDLGGGT T0344 23 :IATVAVLVEKPYRSAKEVMVKYANP 1ba1 205 :FDVSILTIEDGIFEVKSTAGDTHLG T0344 49 :DYDLTGRQAIRDEVLLAIELARKVKPD 1ba1 250 :KKDISENKRAVRRLRTACERAKRTLSS T0344 81 :STLGGIELRKLDEP 1ba1 277 :STQASIEIDSLYEG T0344 95 :TIDAL 1ba1 298 :TRARF T0344 106 :KEVWKELSKDLQPLARKFWEETNI 1ba1 303 :EELNADLFRGTLDPVEKALRDAKL T0344 130 :EIVAIGK 1ba1 333 :DIVLVGG T0344 150 :IYSAKWGIENVEK 1ba1 340 :STRIPKIQKLLQD T0344 163 :EGH 1ba1 355 :NGK Number of specific fragments extracted= 9 number of extra gaps= 0 total=274 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c9kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c9kA expands to /projects/compbio/data/pdb/1c9k.pdb.gz 1c9kA:# T0344 read from 1c9kA/merged-good-all-a2m # 1c9kA read from 1c9kA/merged-good-all-a2m # adding 1c9kA to template set # found chain 1c9kA in template set Warning: unaligning (T0344)N46 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1c9kA)D98 T0344 47 :PYDYDLTG 1c9kA 99 :PEQWDYAA T0344 55 :RQAIRDEVLLAIELARKVKPDVIHLDSTLGG 1c9kA 108 :ERAIDDEIQILIAACQRCPAKVVLVTNEVGM T0344 100 :GISD 1c9kA 139 :GIVP T0344 105 :GKEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVP 1c9kA 143 :ENRLARHFRDIAGRVNQRLAAAADEVWLVVSGIGVK Number of specific fragments extracted= 4 number of extra gaps= 0 total=278 Number of alignments=43 # 1c9kA read from 1c9kA/merged-good-all-a2m # found chain 1c9kA in template set Warning: unaligning (T0344)N46 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1c9kA)D98 T0344 47 :PYDYDLTG 1c9kA 99 :PEQWDYAA T0344 55 :RQAIRDEVLLAIELARKVKPDVIHLDSTLGG 1c9kA 108 :ERAIDDEIQILIAACQRCPAKVVLVTNEVGM T0344 89 :RKLDE 1c9kA 139 :GIVPE T0344 106 :KEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVPV 1c9kA 144 :NRLARHFRDIAGRVNQRLAAAADEVWLVVSGIGVKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=282 Number of alignments=44 # 1c9kA read from 1c9kA/merged-good-all-a2m # found chain 1c9kA in template set Warning: unaligning (T0344)N46 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1c9kA)D98 T0344 47 :PYDYDLTG 1c9kA 99 :PEQWDYAA T0344 55 :RQAIRDEVLLAIELARKVKPDVIHLDSTLGG 1c9kA 108 :ERAIDDEIQILIAACQRCPAKVVLVTNEVGM T0344 100 :GISD 1c9kA 139 :GIVP T0344 105 :GKEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVP 1c9kA 143 :ENRLARHFRDIAGRVNQRLAAAADEVWLVVSGIGVK Number of specific fragments extracted= 4 number of extra gaps= 0 total=286 Number of alignments=45 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0344//projects/compbio/experiments/protein-predict/casp7/T0344/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0344//projects/compbio/experiments/protein-predict/casp7/T0344/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0344/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0344/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)I129.CB) [> 3.5849 = 5.9749 < 7.7674] w=1.0000 to align # Constraint # added constraint: constraint((T0344)V76.CB, (T0344)I129.CB) [> 4.0476 = 6.7459 < 8.7697] w=0.9721 to align # Constraint # added constraint: constraint((T0344)H78.CB, (T0344)V132.CB) [> 3.2215 = 5.3693 < 6.9800] w=0.9095 to align # Constraint # added constraint: constraint((T0344)V76.CB, (T0344)E130.CB) [> 3.0746 = 5.1244 < 6.6617] w=0.9095 to align # Constraint # added constraint: constraint((T0344)I66.CB, (T0344)F123.CB) [> 3.5466 = 5.9109 < 7.6842] w=0.9084 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)V132.CB) [> 4.3097 = 7.1828 < 9.3377] w=0.8650 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)E130.CB) [> 4.1094 = 6.8489 < 8.9036] w=0.8647 to align # Constraint # added constraint: constraint((T0344)H78.CB, (T0344)I131.CB) [> 4.4317 = 7.3862 < 9.6020] w=0.8647 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)I134.CB) [> 4.0304 = 6.7174 < 8.7326] w=0.8647 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)A120.CB) [> 4.0292 = 6.7154 < 8.7300] w=0.8228 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)I131.CB) [> 3.4115 = 5.6859 < 7.3916] w=0.7752 to align # Constraint # added constraint: constraint((T0344)A120.CB, (T0344)V160.CB) [> 3.8808 = 6.4679 < 8.4083] w=0.7619 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)V132.CB) [> 4.1978 = 6.9963 < 9.0952] w=0.7370 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)I131.CB) [> 2.7897 = 4.6496 < 6.0444] w=0.7370 to align # Constraint # added constraint: constraint((T0344)V76.CB, (T0344)I131.CB) [> 4.4915 = 7.4858 < 9.7316] w=0.7370 to align # Constraint # added constraint: constraint((T0344)L52.CB, (T0344)V62.CB) [> 4.2669 = 7.1115 < 9.2450] w=0.7156 to align # Constraint # added constraint: constraint((T0344)S113.CB, (T0344)W155.CB) [> 3.5235 = 5.8724 < 7.6342] w=0.7102 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)A133.CB) [> 3.1743 = 5.2905 < 6.8777] w=0.6925 to align # Constraint # added constraint: constraint((T0344)A120.CB, (T0344)I131.CB) [> 3.5381 = 5.8968 < 7.6658] w=0.6878 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)L116.CB) [> 3.2124 = 5.3540 < 6.9602] w=0.6828 to align # Constraint # added constraint: constraint((T0344)D75.CB, (T0344)I129.CB) [> 4.0795 = 6.7991 < 8.8389] w=0.6654 to align # Constraint # added constraint: constraint((T0344)P74.CB, (T0344)I129.CB) [> 4.2261 = 7.0435 < 9.1566] w=0.6654 to align # Constraint # added constraint: constraint((T0344)S113.CB, (T0344)N159.CB) [> 3.7155 = 6.1925 < 8.0502] w=0.6650 to align # Constraint # added constraint: constraint((T0344)D75.CB, (T0344)E130.CB) [> 3.6130 = 6.0216 < 7.8281] w=0.6476 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)I134.CB) [> 4.0406 = 6.7343 < 8.7546] w=0.6475 to align # Constraint # added constraint: constraint((T0344)A65.CB, (T0344)I77.CB) [> 3.9164 = 6.5273 < 8.4855] w=0.6415 to align # Constraint # added constraint: constraint((T0344)D80.CB, (T0344)I134.CB) [> 3.1856 = 5.3094 < 6.9022] w=0.6027 to align # Constraint # added constraint: constraint((T0344)V76.CB, (T0344)V132.CB) [> 4.1166 = 6.8610 < 8.9193] w=0.6027 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)L116.CB) [> 3.4721 = 5.7868 < 7.5228] w=0.6017 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)A133.CB) [> 3.3863 = 5.6438 < 7.3369] w=0.5954 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)H165.CB) [> 3.5197 = 5.8661 < 7.6259] w=0.5896 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)V160.CB) [> 4.1105 = 6.8509 < 8.9061] w=0.5830 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)S152.CB) [> 4.5496 = 7.5826 < 9.8574] w=0.5755 to align # Constraint # added constraint: constraint((T0344)W109.CB, (T0344)W155.CB) [> 4.1061 = 6.8435 < 8.8966] w=0.5755 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)G135.CA) [> 4.0595 = 6.7659 < 8.7956] w=0.5545 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)F123.CB) [> 4.1031 = 6.8385 < 8.8901] w=0.5531 to align # Constraint # added constraint: constraint((T0344)V62.CB, (T0344)L119.CB) [> 2.9089 = 4.8481 < 6.3025] w=0.5265 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)G135.CA) [> 3.0059 = 5.0098 < 6.5127] w=0.5160 to align # Constraint # added constraint: constraint((T0344)D80.CB, (T0344)G135.CA) [> 4.3068 = 7.1779 < 9.3313] w=0.5160 to align # Constraint # added constraint: constraint((T0344)A120.CB, (T0344)A133.CB) [> 4.1961 = 6.9936 < 9.0917] w=0.5153 to align # Constraint # added constraint: constraint((T0344)A65.CB, (T0344)L79.CB) [> 3.7706 = 6.2844 < 8.1697] w=0.5121 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)V26.CB) [> 4.2628 = 7.1047 < 9.2362] w=0.4929 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)A27.CB) [> 3.3901 = 5.6502 < 7.3453] w=0.4929 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)T25.CB) [> 4.1637 = 6.9395 < 9.0214] w=0.4929 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)V26.CB) [> 2.8020 = 4.6700 < 6.0710] w=0.4929 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)A27.CB) [> 4.2723 = 7.1204 < 9.2565] w=0.4929 to align # Constraint # added constraint: constraint((T0344)D7.CB, (T0344)T25.CB) [> 3.9678 = 6.6130 < 8.5969] w=0.4929 to align # Constraint # added constraint: constraint((T0344)D7.CB, (T0344)V26.CB) [> 4.3437 = 7.2395 < 9.4114] w=0.4929 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)G156.CA) [> 3.7352 = 6.2253 < 8.0929] w=0.4925 to align # Constraint # added constraint: constraint((T0344)R59.CB, (T0344)L119.CB) [> 3.9077 = 6.5128 < 8.4666] w=0.4825 to align # Constraint # added constraint: constraint((T0344)I66.CB, (T0344)I77.CB) [> 3.8809 = 6.4681 < 8.4085] w=0.4822 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)L119.CB) [> 3.9489 = 6.5816 < 8.5560] w=0.4626 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)L116.CB) [> 3.7382 = 6.2303 < 8.0994] w=0.4626 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)V28.CB) [> 4.1912 = 6.9853 < 9.0809] w=0.4479 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)V28.CB) [> 3.3358 = 5.5597 < 7.2276] w=0.4479 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)E130.CB) [> 2.7534 = 4.5890 < 5.9657] w=0.4477 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)I131.CB) [> 4.2716 = 7.1194 < 9.2552] w=0.4477 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)V132.CB) [> 3.7798 = 6.2997 < 8.1897] w=0.4477 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)A120.CB) [> 4.4038 = 7.3396 < 9.5415] w=0.4477 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)F123.CB) [> 4.0004 = 6.6673 < 8.6675] w=0.4477 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)I131.CB) [> 3.2708 = 5.4513 < 7.0867] w=0.4477 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)V132.CB) [> 4.1360 = 6.8933 < 8.9613] w=0.4477 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)V132.CB) [> 3.2412 = 5.4021 < 7.0227] w=0.4477 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)A120.CB) [> 4.2067 = 7.0111 < 9.1144] w=0.4477 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)V132.CB) [> 4.1008 = 6.8347 < 8.8851] w=0.4477 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)A133.CB) [> 3.5200 = 5.8667 < 7.6267] w=0.4477 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)I134.CB) [> 4.2512 = 7.0853 < 9.2109] w=0.4477 to align # Constraint # added constraint: constraint((T0344)T8.CB, (T0344)L116.CB) [> 4.1320 = 6.8867 < 8.9528] w=0.4477 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)V42.CB) [> 3.7624 = 6.2707 < 8.1519] w=0.4431 to align # Constraint # added constraint: constraint((T0344)D75.CB, (T0344)N128.CB) [> 4.6047 = 7.6746 < 9.9769] w=0.4429 to align # Constraint # added constraint: constraint((T0344)V62.CB, (T0344)F123.CB) [> 3.6853 = 6.1422 < 7.9848] w=0.4375 to align # Constraint # added constraint: constraint((T0344)H78.CB, (T0344)I134.CB) [> 3.8487 = 6.4145 < 8.3388] w=0.4221 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)I157.CB) [> 4.3410 = 7.2350 < 9.4056] w=0.4105 to align # Constraint # added constraint: constraint((T0344)D7.CB, (T0344)I134.CB) [> 2.9289 = 4.8815 < 6.3460] w=0.4077 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)A27.CB) [> 4.4310 = 7.3851 < 9.6006] w=0.4037 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)T25.CB) [> 4.1633 = 6.9389 < 9.0206] w=0.4037 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)T25.CB) [> 3.6035 = 6.0058 < 7.8075] w=0.4037 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)S152.CB) [> 3.6678 = 6.1130 < 7.9469] w=0.4030 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)N159.CB) [> 3.7651 = 6.2752 < 8.1577] w=0.4030 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)E130.CB) [> 4.4832 = 7.4721 < 9.7137] w=0.4030 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)I134.CB) [> 4.0995 = 6.8325 < 8.8822] w=0.4030 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)I131.CB) [> 3.8903 = 6.4839 < 8.4291] w=0.4030 to align # Constraint # added constraint: constraint((T0344)D7.CB, (T0344)G135.CA) [> 3.3123 = 5.5205 < 7.1767] w=0.4030 to align # Constraint # added constraint: constraint((T0344)T8.CB, (T0344)G135.CA) [> 3.4181 = 5.6969 < 7.4060] w=0.4030 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)I134.CB) [> 4.7083 = 7.8471 < 10.2012] w=0.4030 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)G135.CA) [> 2.5656 = 4.2760 < 5.5588] w=0.4030 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)K136.CB) [> 3.3945 = 5.6575 < 7.3547] w=0.4030 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)G135.CA) [> 4.5656 = 7.6094 < 9.8922] w=0.4030 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)K136.CB) [> 3.9804 = 6.6340 < 8.6242] w=0.4030 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)F123.CB) [> 4.0172 = 6.6954 < 8.7040] w=0.4030 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)F123.CB) [> 3.3858 = 5.6430 < 7.3359] w=0.4030 to align # Constraint # added constraint: constraint((T0344)R70.CB, (T0344)E126.CB) [> 4.4940 = 7.4901 < 9.7371] w=0.4008 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)L116.CB) [> 3.9513 = 6.5856 < 8.5612] w=0.3980 to align # Constraint # added constraint: constraint((T0344)L63.CB, (T0344)L119.CB) [> 4.6096 = 7.6826 < 9.9874] w=0.3977 to align # Constraint # added constraint: constraint((T0344)L63.CB, (T0344)F123.CB) [> 4.0450 = 6.7417 < 8.7642] w=0.3961 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)I150.CB) [> 3.6908 = 6.1513 < 7.9967] w=0.3961 to align # Constraint # added constraint: constraint((T0344)I58.CB, (T0344)L119.CB) [> 4.3811 = 7.3019 < 9.4924] w=0.3933 to align # Constraint # added constraint: constraint((T0344)I66.CB, (T0344)L119.CB) [> 4.1980 = 6.9967 < 9.0958] w=0.3811 to align # Constraint # added constraint: constraint((T0344)A69.CB, (T0344)I129.CB) [> 3.7408 = 6.2346 < 8.1050] w=0.3777 to align # Constraint # added constraint: constraint((T0344)I66.CB, (T0344)K122.CB) [> 3.6217 = 6.0362 < 7.8471] w=0.3764 to align # Constraint # added constraint: constraint((T0344)I86.CB, (T0344)L116.CB) [> 3.9753 = 6.6255 < 8.6131] w=0.3755 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)A24.CB) [> 3.5650 = 5.9416 < 7.7241] w=0.3593 to align # Constraint # added constraint: constraint((T0344)D7.CB, (T0344)A24.CB) [> 2.5032 = 4.1720 < 5.4236] w=0.3593 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)A24.CB) [> 4.2731 = 7.1218 < 9.2584] w=0.3593 to align # Constraint # added constraint: constraint((T0344)R55.CB, (T0344)D92.CB) [> 4.0034 = 6.6724 < 8.6741] w=0.3588 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)V30.CB) [> 4.1072 = 6.8454 < 8.8990] w=0.3583 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)V160.CB) [> 3.7043 = 6.1738 < 8.0259] w=0.3583 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)P47.CB) [> 3.4380 = 5.7301 < 7.4491] w=0.3583 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)V40.CB) [> 4.5588 = 7.5980 < 9.8774] w=0.3583 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)K136.CB) [> 4.1287 = 6.8812 < 8.9456] w=0.3539 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)A133.CB) [> 3.2048 = 5.3414 < 6.9438] w=0.3531 to align # Constraint # added constraint: constraint((T0344)R55.CB, (T0344)D115.CB) [> 3.5664 = 5.9441 < 7.7273] w=0.3489 to align # Constraint # added constraint: constraint((T0344)A69.CB, (T0344)F123.CB) [> 3.7859 = 6.3098 < 8.2027] w=0.3347 to align # Constraint # added constraint: constraint((T0344)A65.CB, (T0344)F123.CB) [> 4.1777 = 6.9628 < 9.0517] w=0.3343 to align # Constraint # added constraint: constraint((T0344)R121.CB, (T0344)E163.CB) [> 3.8500 = 6.4167 < 8.3417] w=0.3171 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)Y151.CB) [> 3.4496 = 5.7493 < 7.4741] w=0.3141 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)I129.CB) [> 3.9171 = 6.5285 < 8.4870] w=0.3138 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)T127.CB) [> 2.6454 = 4.4090 < 5.7316] w=0.3138 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)W124.CB) [> 4.2250 = 7.0417 < 9.1542] w=0.3138 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)M41.CB) [> 4.6965 = 7.8275 < 10.1758] w=0.3138 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)V40.CB) [> 3.2350 = 5.3917 < 7.0092] w=0.3138 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)A37.CB) [> 3.8027 = 6.3379 < 8.2393] w=0.3138 to align # Constraint # added constraint: constraint((T0344)T25.CB, (T0344)F123.CB) [> 2.7827 = 4.6379 < 6.0293] w=0.3138 to align # Constraint # added constraint: constraint((T0344)T25.CB, (T0344)L119.CB) [> 2.8658 = 4.7763 < 6.2092] w=0.3138 to align # Constraint # added constraint: constraint((T0344)V42.CB, (T0344)L119.CB) [> 3.3034 = 5.5057 < 7.1574] w=0.3138 to align # Constraint # added constraint: constraint((T0344)M41.CB, (T0344)F123.CB) [> 2.4364 = 4.0606 < 5.2788] w=0.3138 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)K38.CB) [> 3.9904 = 6.6506 < 8.6458] w=0.3138 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)A37.CB) [> 3.6777 = 6.1295 < 7.9683] w=0.3138 to align # Constraint # added constraint: constraint((T0344)E61.CB, (T0344)L91.CB) [> 4.0170 = 6.6949 < 8.7034] w=0.3137 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)V28.CB) [> 4.2074 = 7.0123 < 9.1159] w=0.3136 to align # Constraint # added constraint: constraint((T0344)V62.CB, (T0344)L88.CB) [> 4.0959 = 6.8265 < 8.8745] w=0.3133 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)N46.CB) [> 4.3157 = 7.1928 < 9.3507] w=0.3133 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)L112.CB) [> 4.0385 = 6.7308 < 8.7501] w=0.3110 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)I134.CB) [> 4.2988 = 7.1647 < 9.3141] w=0.3104 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)I167.CB) [> 3.7041 = 6.1735 < 8.0255] w=0.3083 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)A153.CB) [> 3.7121 = 6.1869 < 8.0429] w=0.3072 to align # Constraint # added constraint: constraint((T0344)W109.CB, (T0344)S152.CB) [> 2.7587 = 4.5979 < 5.9773] w=0.3067 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)V132.CB) [> 4.1248 = 6.8747 < 8.9371] w=0.3036 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)I167.CB) [> 3.1639 = 5.2732 < 6.8551] w=0.2699 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)Y151.CB) [> 3.1978 = 5.3297 < 6.9286] w=0.2697 to align # Constraint # added constraint: constraint((T0344)D7.CB, (T0344)I23.CB) [> 4.0842 = 6.8071 < 8.8492] w=0.2693 to align # Constraint # added constraint: constraint((T0344)T8.CB, (T0344)I23.CB) [> 2.9066 = 4.8443 < 6.2976] w=0.2693 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)I23.CB) [> 4.1555 = 6.9258 < 9.0036] w=0.2693 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)I23.CB) [> 3.3773 = 5.6288 < 7.3175] w=0.2693 to align # Constraint # added constraint: constraint((T0344)I23.CB, (T0344)L116.CB) [> 3.9163 = 6.5272 < 8.4854] w=0.2693 to align # Constraint # added constraint: constraint((T0344)I23.CB, (T0344)L119.CB) [> 4.0367 = 6.7279 < 8.7463] w=0.2693 to align # Constraint # added constraint: constraint((T0344)A24.CB, (T0344)V40.CB) [> 4.1869 = 6.9782 < 9.0717] w=0.2693 to align # Constraint # added constraint: constraint((T0344)A24.CB, (T0344)M41.CB) [> 4.5975 = 7.6625 < 9.9612] w=0.2693 to align # Constraint # added constraint: constraint((T0344)A24.CB, (T0344)V42.CB) [> 2.8155 = 4.6924 < 6.1002] w=0.2693 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)K43.CB) [> 4.4030 = 7.3383 < 9.5398] w=0.2688 to align # Constraint # added constraint: constraint((T0344)Y50.CB, (T0344)D92.CB) [> 3.7655 = 6.2758 < 8.1586] w=0.2686 to align # Constraint # added constraint: constraint((T0344)L52.CB, (T0344)L91.CB) [> 4.0389 = 6.7316 < 8.7510] w=0.2686 to align # Constraint # added constraint: constraint((T0344)I58.CB, (T0344)L91.CB) [> 3.3315 = 5.5525 < 7.2182] w=0.2686 to align # Constraint # added constraint: constraint((T0344)I58.CB, (T0344)D92.CB) [> 3.0304 = 5.0507 < 6.5659] w=0.2686 to align # Constraint # added constraint: constraint((T0344)E61.CB, (T0344)L88.CB) [> 3.5835 = 5.9726 < 7.7644] w=0.2686 to align # Constraint # added constraint: constraint((T0344)V62.CB, (T0344)L91.CB) [> 4.0110 = 6.6850 < 8.6904] w=0.2686 to align # Constraint # added constraint: constraint((T0344)A65.CB, (T0344)E87.CB) [> 4.6537 = 7.7562 < 10.0830] w=0.2686 to align # Constraint # added constraint: constraint((T0344)A65.CB, (T0344)L88.CB) [> 3.2287 = 5.3811 < 6.9954] w=0.2686 to align # Constraint # added constraint: constraint((T0344)I66.CB, (T0344)I86.CB) [> 4.4195 = 7.3659 < 9.5757] w=0.2686 to align # Constraint # added constraint: constraint((T0344)A69.CB, (T0344)I86.CB) [> 3.3721 = 5.6202 < 7.3063] w=0.2686 to align # Constraint # added constraint: constraint((T0344)V72.CB, (T0344)S81.CB) [> 3.2602 = 5.4337 < 7.0639] w=0.2686 to align # Constraint # added constraint: constraint((T0344)V72.CB, (T0344)G84.CA) [> 3.0432 = 5.0721 < 6.5937] w=0.2686 to align # Constraint # added constraint: constraint((T0344)V72.CB, (T0344)G85.CA) [> 4.5690 = 7.6150 < 9.8995] w=0.2686 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)I168.CB) [> 4.1932 = 6.9887 < 9.0853] w=0.2683 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)A45.CB) [> 4.5034 = 7.5057 < 9.7574] w=0.2683 to align # Constraint # added constraint: constraint((T0344)G85.CA, (T0344)G100.CA) [> 3.1063 = 5.1772 < 6.7304] w=0.2665 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)G169.CA) [> 3.4530 = 5.7551 < 7.4816] w=0.2651 to align # Constraint # added constraint: constraint((T0344)I101.CB, (T0344)E111.CB) [> 4.0549 = 6.7581 < 8.7855] w=0.2620 to align # Constraint # added constraint: constraint((T0344)W109.CB, (T0344)A148.CB) [> 4.1784 = 6.9640 < 9.0532] w=0.2620 to align # Constraint # added constraint: constraint((T0344)L112.CB, (T0344)S152.CB) [> 4.0786 = 6.7977 < 8.8371] w=0.2620 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)G149.CA) [> 3.8166 = 6.3609 < 8.2692] w=0.2619 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)G149.CA) [> 4.0698 = 6.7829 < 8.8178] w=0.2619 to align # Constraint # added constraint: constraint((T0344)K73.CB, (T0344)I129.CB) [> 4.2600 = 7.1000 < 9.2300] w=0.2604 to align # Constraint # added constraint: constraint((T0344)H78.CB, (T0344)A133.CB) [> 3.9609 = 6.6014 < 8.5819] w=0.2519 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)A133.CB) [> 3.8603 = 6.4339 < 8.3640] w=0.2453 to align # Constraint # added constraint: constraint((T0344)D80.CB, (T0344)L116.CB) [> 3.7474 = 6.2456 < 8.1193] w=0.2453 to align # Constraint # added constraint: constraint((T0344)E87.CB, (T0344)L119.CB) [> 4.2543 = 7.0904 < 9.2176] w=0.2313 to align # Constraint # added constraint: constraint((T0344)E87.CB, (T0344)L116.CB) [> 3.4617 = 5.7696 < 7.5004] w=0.2313 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)I146.CB) [> 3.1270 = 5.2116 < 6.7751] w=0.2305 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)L116.CB) [> 4.3970 = 7.3283 < 9.5268] w=0.2294 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)G135.CA) [> 4.3730 = 7.2883 < 9.4747] w=0.2253 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)K136.CB) [> 4.7294 = 7.8824 < 10.2471] w=0.2251 to align # Constraint # added constraint: constraint((T0344)L68.CB, (T0344)I77.CB) [> 4.0260 = 6.7099 < 8.7229] w=0.2247 to align # Constraint # added constraint: constraint((T0344)E61.CB, (T0344)L116.CB) [> 4.2378 = 7.0630 < 9.1818] w=0.2247 to align # Constraint # added constraint: constraint((T0344)I23.CB, (T0344)V42.CB) [> 3.1806 = 5.3010 < 6.8913] w=0.2246 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)W124.CB) [> 4.6176 = 7.6961 < 10.0049] w=0.2246 to align # Constraint # added constraint: constraint((T0344)I23.CB, (T0344)N46.CB) [> 2.7434 = 4.5723 < 5.9440] w=0.2243 to align # Constraint # added constraint: constraint((T0344)I157.CB, (T0344)L166.CB) [> 3.6216 = 6.0361 < 7.8469] w=0.2242 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)I96.CB) [> 3.5954 = 5.9923 < 7.7900] w=0.2240 to align # Constraint # added constraint: constraint((T0344)Y50.CB, (T0344)E93.CB) [> 4.2996 = 7.1659 < 9.3157] w=0.2239 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)Y44.CB) [> 3.2277 = 5.3796 < 6.9934] w=0.2238 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)A45.CB) [> 4.3917 = 7.3195 < 9.5154] w=0.2238 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)I150.CB) [> 3.5814 = 5.9690 < 7.7597] w=0.2238 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)T95.CB) [> 4.2519 = 7.0865 < 9.2124] w=0.2237 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)G135.CA) [> 4.1591 = 6.9318 < 9.0113] w=0.2234 to align # Constraint # added constraint: constraint((T0344)L52.CB, (T0344)E61.CB) [> 3.3274 = 5.5456 < 7.2093] w=0.2231 to align # Constraint # added constraint: constraint((T0344)S138.CB, (T0344)I157.CB) [> 3.9719 = 6.6198 < 8.6057] w=0.2221 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)P140.CB) [> 3.6001 = 6.0001 < 7.8001] w=0.2217 to align # Constraint # added constraint: constraint((T0344)E130.CB, (T0344)P140.CB) [> 4.1686 = 6.9476 < 9.0319] w=0.2217 to align # Constraint # added constraint: constraint((T0344)Y48.CB, (T0344)L83.CB) [> 4.3631 = 7.2719 < 9.4534] w=0.2203 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)A153.CB) [> 3.8868 = 6.4779 < 8.4213] w=0.2178 to align # Constraint # added constraint: constraint((T0344)I86.CB, (T0344)L119.CB) [> 3.8238 = 6.3730 < 8.2849] w=0.2174 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)F123.CB) [> 4.1979 = 6.9966 < 9.0955] w=0.2172 to align # Constraint # added constraint: constraint((T0344)I66.CB, (T0344)I129.CB) [> 4.4187 = 7.3645 < 9.5738] w=0.2170 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)L116.CB) [> 4.3375 = 7.2291 < 9.3978] w=0.2043 to align # Constraint # added constraint: constraint((T0344)D80.CB, (T0344)A133.CB) [> 4.6536 = 7.7560 < 10.0828] w=0.2020 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)K136.CB) [> 3.3120 = 5.5200 < 7.1760] w=0.2012 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)V139.CB) [> 3.6527 = 6.0878 < 7.9141] w=0.2004 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)I134.CB) [> 1.9658 = 3.2763 < 4.2592] w=0.2004 to align # Constraint # added constraint: constraint((T0344)V132.CB, (T0344)L166.CB) [> 3.6286 = 6.0476 < 7.8619] w=0.1882 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)L166.CB) [> 4.7105 = 7.8508 < 10.2061] w=0.1882 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)G169.CA) [> 4.2165 = 7.0276 < 9.1358] w=0.1867 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)I96.CB) [> 3.5118 = 5.8530 < 7.6089] w=0.1841 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)I168.CB) [> 3.6832 = 6.1387 < 7.9804] w=0.1837 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)I167.CB) [> 4.3978 = 7.3297 < 9.5287] w=0.1837 to align # Constraint # added constraint: constraint((T0344)V132.CB, (T0344)I167.CB) [> 4.1772 = 6.9620 < 9.0506] w=0.1837 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)G135.CA) [> 4.7696 = 7.9494 < 10.3342] w=0.1806 to align # Constraint # added constraint: constraint((T0344)L52.CB, (T0344)L64.CB) [> 4.0847 = 6.8079 < 8.8503] w=0.1805 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)S152.CB) [> 4.0158 = 6.6929 < 8.7008] w=0.1805 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)W124.CB) [> 3.9782 = 6.6304 < 8.6195] w=0.1803 to align # Constraint # added constraint: constraint((T0344)R55.CB, (T0344)L119.CB) [> 4.2937 = 7.1561 < 9.3030] w=0.1803 to align # Constraint # added constraint: constraint((T0344)I23.CB, (T0344)K43.CB) [> 2.9283 = 4.8805 < 6.3447] w=0.1796 to align # Constraint # added constraint: constraint((T0344)T95.CB, (T0344)V108.CB) [> 3.9034 = 6.5056 < 8.4573] w=0.1791 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)K104.CB) [> 4.4113 = 7.3521 < 9.5577] w=0.1791 to align # Constraint # added constraint: constraint((T0344)A69.CB, (T0344)S102.CB) [> 3.5995 = 5.9991 < 7.7989] w=0.1791 to align # Constraint # added constraint: constraint((T0344)V62.CB, (T0344)A98.CB) [> 4.4332 = 7.3886 < 9.6052] w=0.1791 to align # Constraint # added constraint: constraint((T0344)P47.CB, (T0344)I150.CB) [> 3.9090 = 6.5150 < 8.4695] w=0.1791 to align # Constraint # added constraint: constraint((T0344)N46.CB, (T0344)L112.CB) [> 4.2856 = 7.1426 < 9.2854] w=0.1791 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)Y48.CB) [> 4.5697 = 7.6162 < 9.9011] w=0.1791 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)Y48.CB) [> 4.5532 = 7.5887 < 9.8653] w=0.1791 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)P47.CB) [> 2.3753 = 3.9589 < 5.1465] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)I150.CB) [> 3.6012 = 6.0020 < 7.8026] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)S137.CB) [> 3.7135 = 6.1891 < 8.0458] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)P47.CB) [> 2.2329 = 3.7214 < 4.8379] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)Y151.CB) [> 4.6136 = 7.6893 < 9.9961] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)I150.CB) [> 2.6355 = 4.3924 < 5.7102] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)S138.CB) [> 4.6212 = 7.7019 < 10.0125] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)S137.CB) [> 2.8537 = 4.7561 < 6.1830] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)P47.CB) [> 3.1471 = 5.2452 < 6.8187] w=0.1791 to align # Constraint # added constraint: constraint((T0344)T8.CB, (T0344)I150.CB) [> 2.2024 = 3.6706 < 4.7718] w=0.1791 to align # Constraint # added constraint: constraint((T0344)T8.CB, (T0344)S138.CB) [> 3.1710 = 5.2850 < 6.8705] w=0.1791 to align # Constraint # added constraint: constraint((T0344)T8.CB, (T0344)P47.CB) [> 4.1772 = 6.9620 < 9.0506] w=0.1791 to align # Constraint # added constraint: constraint((T0344)D7.CB, (T0344)Y151.CB) [> 4.5352 = 7.5587 < 9.8262] w=0.1791 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)Y151.CB) [> 3.8576 = 6.4293 < 8.3581] w=0.1791 to align # Constraint # added constraint: constraint((T0344)S138.CB, (T0344)G156.CA) [> 4.2707 = 7.1178 < 9.2532] w=0.1791 to align # Constraint # added constraint: constraint((T0344)S138.CB, (T0344)A153.CB) [> 4.1744 = 6.9573 < 9.0445] w=0.1791 to align # Constraint # added constraint: constraint((T0344)S137.CB, (T0344)A153.CB) [> 3.5891 = 5.9819 < 7.7764] w=0.1791 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)Y151.CB) [> 3.6762 = 6.1270 < 7.9651] w=0.1791 to align # Constraint # added constraint: constraint((T0344)K104.CB, (T0344)K154.CB) [> 4.4369 = 7.3948 < 9.6132] w=0.1791 to align # Constraint # added constraint: constraint((T0344)L88.CB, (T0344)L99.CB) [> 4.6502 = 7.7504 < 10.0755] w=0.1791 to align # Constraint # added constraint: constraint((T0344)L88.CB, (T0344)A98.CB) [> 2.8648 = 4.7746 < 6.2070] w=0.1791 to align # Constraint # added constraint: constraint((T0344)E87.CB, (T0344)L99.CB) [> 3.0906 = 5.1509 < 6.6962] w=0.1791 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)I101.CB) [> 3.4979 = 5.8299 < 7.5788] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)I101.CB) [> 3.1933 = 5.3221 < 6.9188] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G85.CA, (T0344)I101.CB) [> 2.5806 = 4.3010 < 5.5913] w=0.1791 to align # Constraint # added constraint: constraint((T0344)G85.CA, (T0344)S102.CB) [> 4.2198 = 7.0330 < 9.1429] w=0.1791 to align # Constraint # added constraint: constraint((T0344)I86.CB, (T0344)A98.CB) [> 4.0573 = 6.7622 < 8.7909] w=0.1791 to align # Constraint # added constraint: constraint((T0344)I86.CB, (T0344)L99.CB) [> 4.2912 = 7.1520 < 9.2976] w=0.1791 to align # Constraint # added constraint: constraint((T0344)I86.CB, (T0344)I101.CB) [> 3.8931 = 6.4884 < 8.4350] w=0.1791 to align # Constraint # added constraint: constraint((T0344)A98.CB, (T0344)V108.CB) [> 4.1066 = 6.8444 < 8.8977] w=0.1789 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)I96.CB) [> 4.3856 = 7.3094 < 9.5022] w=0.1789 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)I157.CB) [> 3.6692 = 6.1154 < 7.9500] w=0.1789 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)L119.CB) [> 4.3096 = 7.1827 < 9.3375] w=0.1762 to align # Constraint # added constraint: constraint((T0344)A69.CB, (T0344)H78.CB) [> 4.5923 = 7.6538 < 9.9499] w=0.1758 to align # Constraint # added constraint: constraint((T0344)D14.CB, (T0344)V40.CB) [> 3.2893 = 5.4822 < 7.1269] w=0.1738 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)V132.CB) [> 4.5784 = 7.6306 < 9.9198] w=0.1725 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)V132.CB) [> 3.6890 = 6.1484 < 7.9929] w=0.1725 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)I131.CB) [> 3.2443 = 5.4072 < 7.0294] w=0.1725 to align # Constraint # added constraint: constraint((T0344)D80.CB, (T0344)V132.CB) [> 3.3207 = 5.5345 < 7.1949] w=0.1725 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)E130.CB) [> 4.0568 = 6.7614 < 8.7898] w=0.1725 to align # Constraint # added constraint: constraint((T0344)H78.CB, (T0344)E130.CB) [> 2.3556 = 3.9260 < 5.1038] w=0.1725 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)I134.CB) [> 3.1839 = 5.3066 < 6.8985] w=0.1725 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)V139.CB) [> 3.1110 = 5.1850 < 6.7405] w=0.1725 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)I134.CB) [> 4.3809 = 7.3016 < 9.4921] w=0.1725 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)V139.CB) [> 3.3645 = 5.6075 < 7.2897] w=0.1725 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)I131.CB) [> 4.6689 = 7.7815 < 10.1159] w=0.1725 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)A153.CB) [> 4.5225 = 7.5375 < 9.7988] w=0.1725 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)E161.CB) [> 4.3671 = 7.2784 < 9.4619] w=0.1446 to align # Constraint # added constraint: constraint((T0344)Q117.CB, (T0344)E145.CB) [> 3.7350 = 6.2250 < 8.0925] w=0.1445 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)I146.CB) [> 3.8312 = 6.3854 < 8.3011] w=0.1428 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)L170.CB) [> 3.4378 = 5.7296 < 7.4485] w=0.1402 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)G169.CA) [> 3.9759 = 6.6265 < 8.6145] w=0.1402 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)I168.CB) [> 4.7361 = 7.8935 < 10.2616] w=0.1390 to align # Constraint # added constraint: constraint((T0344)G193.CA, (T0344)P204.CB) [> 4.3390 = 7.2317 < 9.4012] w=0.1358 to align # Constraint # added constraint: constraint((T0344)Y196.CB, (T0344)Y212.CB) [> 2.7933 = 4.6556 < 6.0522] w=0.1358 to align # Constraint # added constraint: constraint((T0344)G197.CA, (T0344)Y212.CB) [> 3.5377 = 5.8962 < 7.6651] w=0.1358 to align # Constraint # added constraint: constraint((T0344)S198.CB, (T0344)E210.CB) [> 3.8349 = 6.3915 < 8.3090] w=0.1358 to align # Constraint # added constraint: constraint((T0344)S198.CB, (T0344)I211.CB) [> 4.6460 = 7.7433 < 10.0663] w=0.1358 to align # Constraint # added constraint: constraint((T0344)S198.CB, (T0344)Y212.CB) [> 3.5503 = 5.9172 < 7.6924] w=0.1358 to align # Constraint # added constraint: constraint((T0344)A199.CB, (T0344)E210.CB) [> 4.3760 = 7.2933 < 9.4813] w=0.1358 to align # Constraint # added constraint: constraint((T0344)A199.CB, (T0344)I211.CB) [> 2.9816 = 4.9693 < 6.4601] w=0.1358 to align # Constraint # added constraint: constraint((T0344)A199.CB, (T0344)Y212.CB) [> 4.3832 = 7.3053 < 9.4969] w=0.1358 to align # Constraint # added constraint: constraint((T0344)E200.CB, (T0344)W209.CB) [> 4.3160 = 7.1934 < 9.3514] w=0.1358 to align # Constraint # added constraint: constraint((T0344)E200.CB, (T0344)E210.CB) [> 3.3669 = 5.6114 < 7.2949] w=0.1358 to align # Constraint # added constraint: constraint((T0344)E200.CB, (T0344)I211.CB) [> 4.7305 = 7.8841 < 10.2493] w=0.1358 to align # Constraint # added constraint: constraint((T0344)V201.CB, (T0344)I211.CB) [> 3.8997 = 6.4995 < 8.4494] w=0.1358 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)L166.CB) [> 4.5589 = 7.5982 < 9.8777] w=0.1357 to align # Constraint # added constraint: constraint((T0344)L68.CB, (T0344)F123.CB) [> 4.7805 = 7.9674 < 10.3577] w=0.1353 to align # Constraint # added constraint: constraint((T0344)E67.CB, (T0344)L79.CB) [> 4.0630 = 6.7717 < 8.8033] w=0.1353 to align # Constraint # added constraint: constraint((T0344)E67.CB, (T0344)H78.CB) [> 4.5979 = 7.6632 < 9.9622] w=0.1353 to align # Constraint # added constraint: constraint((T0344)L64.CB, (T0344)L116.CB) [> 3.8363 = 6.3938 < 8.3119] w=0.1353 to align # Constraint # added constraint: constraint((T0344)L64.CB, (T0344)T82.CB) [> 3.7159 = 6.1932 < 8.0512] w=0.1353 to align # Constraint # added constraint: constraint((T0344)L64.CB, (T0344)L79.CB) [> 4.2491 = 7.0819 < 9.2064] w=0.1353 to align # Constraint # added constraint: constraint((T0344)D60.CB, (T0344)G84.CA) [> 4.0900 = 6.8167 < 8.8618] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I168.CB, (T0344)R186.CB) [> 3.2045 = 5.3408 < 6.9430] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I168.CB, (T0344)G185.CA) [> 4.1730 = 6.9549 < 9.0414] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I168.CB, (T0344)I183.CB) [> 3.4721 = 5.7869 < 7.5230] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I168.CB, (T0344)I178.CB) [> 4.2971 = 7.1619 < 9.3104] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I168.CB, (T0344)N177.CB) [> 3.5374 = 5.8957 < 7.6645] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I167.CB, (T0344)S187.CB) [> 3.0271 = 5.0452 < 6.5588] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I167.CB, (T0344)R186.CB) [> 4.1876 = 6.9793 < 9.0731] w=0.1353 to align # Constraint # added constraint: constraint((T0344)I167.CB, (T0344)N177.CB) [> 3.8152 = 6.3586 < 8.2662] w=0.1353 to align # Constraint # added constraint: constraint((T0344)L166.CB, (T0344)V176.CB) [> 3.4325 = 5.7207 < 7.4370] w=0.1350 to align # Constraint # added constraint: constraint((T0344)I167.CB, (T0344)V176.CB) [> 4.5062 = 7.5103 < 9.7634] w=0.1350 to align # Constraint # added constraint: constraint((T0344)E87.CB, (T0344)A98.CB) [> 4.5160 = 7.5267 < 9.7847] w=0.1347 to align # Constraint # added constraint: constraint((T0344)I23.CB, (T0344)I150.CB) [> 4.6454 = 7.7423 < 10.0650] w=0.1347 to align # Constraint # added constraint: constraint((T0344)L13.CB, (T0344)A24.CB) [> 3.5475 = 5.9125 < 7.6863] w=0.1347 to align # Constraint # added constraint: constraint((T0344)Y50.CB, (T0344)I96.CB) [> 4.4751 = 7.4586 < 9.6961] w=0.1344 to align # Constraint # added constraint: constraint((T0344)K73.CB, (T0344)A153.CB) [> 4.6627 = 7.7712 < 10.1026] w=0.1344 to align # Constraint # added constraint: constraint((T0344)P74.CB, (T0344)S152.CB) [> 2.8003 = 4.6672 < 6.0673] w=0.1344 to align # Constraint # added constraint: constraint((T0344)P74.CB, (T0344)A153.CB) [> 3.4666 = 5.7776 < 7.5109] w=0.1344 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)A153.CB) [> 3.3702 = 5.6171 < 7.3022] w=0.1344 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)R89.CB) [> 2.6192 = 4.3654 < 5.6750] w=0.1344 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)L88.CB) [> 4.1905 = 6.9843 < 9.0795] w=0.1344 to align # Constraint # added constraint: constraint((T0344)A65.CB, (T0344)H78.CB) [> 4.6829 = 7.8048 < 10.1462] w=0.1344 to align # Constraint # added constraint: constraint((T0344)I58.CB, (T0344)L83.CB) [> 3.0442 = 5.0736 < 6.5957] w=0.1344 to align # Constraint # added constraint: constraint((T0344)I58.CB, (T0344)T82.CB) [> 3.2775 = 5.4626 < 7.1014] w=0.1344 to align # Constraint # added constraint: constraint((T0344)Y50.CB, (T0344)L83.CB) [> 3.8694 = 6.4490 < 8.3836] w=0.1344 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)L88.CB) [> 4.1220 = 6.8700 < 8.9310] w=0.1344 to align # Constraint # added constraint: constraint((T0344)H78.CB, (T0344)R89.CB) [> 4.5911 = 7.6518 < 9.9473] w=0.1344 to align # Constraint # added constraint: constraint((T0344)H78.CB, (T0344)L88.CB) [> 3.4973 = 5.8287 < 7.5774] w=0.1344 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)L91.CB) [> 4.1016 = 6.8360 < 8.8868] w=0.1344 to align # Constraint # added constraint: constraint((T0344)E130.CB, (T0344)V141.CB) [> 3.5997 = 5.9995 < 7.7993] w=0.1342 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)V141.CB) [> 4.0985 = 6.8309 < 8.8801] w=0.1342 to align # Constraint # added constraint: constraint((T0344)A45.CB, (T0344)D80.CB) [> 4.3906 = 7.3176 < 9.5129] w=0.1342 to align # Constraint # added constraint: constraint((T0344)I66.CB, (T0344)V76.CB) [> 3.2949 = 5.4916 < 7.1390] w=0.1342 to align # Constraint # added constraint: constraint((T0344)D75.CB, (T0344)I131.CB) [> 4.5185 = 7.5308 < 9.7900] w=0.1342 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)A133.CB) [> 4.5236 = 7.5394 < 9.8012] w=0.1342 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)V132.CB) [> 4.4658 = 7.4431 < 9.6760] w=0.1342 to align # Constraint # added constraint: constraint((T0344)L119.CB, (T0344)V132.CB) [> 4.7339 = 7.8899 < 10.2569] w=0.1342 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)A153.CB) [> 2.6873 = 4.4788 < 5.8225] w=0.1342 to align # Constraint # added constraint: constraint((T0344)L29.CB, (T0344)T127.CB) [> 4.7455 = 7.9092 < 10.2819] w=0.1339 to align # Constraint # added constraint: constraint((T0344)L13.CB, (T0344)L119.CB) [> 3.9602 = 6.6004 < 8.5805] w=0.1336 to align # Constraint # added constraint: constraint((T0344)L13.CB, (T0344)L116.CB) [> 4.3405 = 7.2342 < 9.4045] w=0.1336 to align # Constraint # added constraint: constraint((T0344)I129.CB, (T0344)P140.CB) [> 4.1508 = 6.9180 < 8.9935] w=0.1311 to align # Constraint # added constraint: constraint((T0344)V12.CB, (T0344)V40.CB) [> 3.0081 = 5.0135 < 6.5175] w=0.1293 to align # Constraint # added constraint: constraint((T0344)L13.CB, (T0344)V40.CB) [> 4.0197 = 6.6995 < 8.7093] w=0.1293 to align # Constraint # added constraint: constraint((T0344)V76.CB, (T0344)L166.CB) [> 4.3720 = 7.2867 < 9.4728] w=0.1293 to align # Constraint # added constraint: constraint((T0344)E130.CB, (T0344)L166.CB) [> 2.9518 = 4.9196 < 6.3955] w=0.1293 to align # Constraint # added constraint: constraint((T0344)E130.CB, (T0344)I167.CB) [> 4.0341 = 6.7235 < 8.7405] w=0.1293 to align # Constraint # added constraint: constraint((T0344)E130.CB, (T0344)I168.CB) [> 3.9902 = 6.6503 < 8.6454] w=0.1293 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)I168.CB) [> 3.8659 = 6.4432 < 8.3761] w=0.1293 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)I146.CB) [> 4.1086 = 6.8476 < 8.9019] w=0.0970 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)L170.CB) [> 3.6246 = 6.0410 < 7.8533] w=0.0910 to align # Constraint # added constraint: constraint((T0344)I157.CB, (T0344)I167.CB) [> 3.9193 = 6.5322 < 8.4919] w=0.0910 to align # Constraint # added constraint: constraint((T0344)G164.CA, (T0344)I178.CB) [> 2.9529 = 4.9215 < 6.3979] w=0.0905 to align # Constraint # added constraint: constraint((T0344)Y147.CB, (T0344)I157.CB) [> 3.5787 = 5.9646 < 7.7539] w=0.0905 to align # Constraint # added constraint: constraint((T0344)Y147.CB, (T0344)G156.CA) [> 3.8567 = 6.4278 < 8.3561] w=0.0905 to align # Constraint # added constraint: constraint((T0344)I146.CB, (T0344)G156.CA) [> 4.0559 = 6.7598 < 8.7877] w=0.0905 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)W155.CB) [> 4.0075 = 6.6793 < 8.6830] w=0.0905 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)I143.CB) [> 3.5085 = 5.8475 < 7.6018] w=0.0905 to align # Constraint # added constraint: constraint((T0344)I131.CB, (T0344)R142.CB) [> 4.5632 = 7.6053 < 9.8869] w=0.0905 to align # Constraint # added constraint: constraint((T0344)E130.CB, (T0344)R142.CB) [> 3.5970 = 5.9950 < 7.7935] w=0.0905 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)V108.CB) [> 4.5064 = 7.5107 < 9.7639] w=0.0905 to align # Constraint # added constraint: constraint((T0344)D49.CB, (T0344)L64.CB) [> 3.9948 = 6.6579 < 8.6553] w=0.0905 to align # Constraint # added constraint: constraint((T0344)L195.CB, (T0344)W209.CB) [> 4.1057 = 6.8428 < 8.8956] w=0.0905 to align # Constraint # added constraint: constraint((T0344)L195.CB, (T0344)P204.CB) [> 4.1009 = 6.8348 < 8.8852] w=0.0905 to align # Constraint # added constraint: constraint((T0344)G194.CA, (T0344)V203.CB) [> 3.6256 = 6.0426 < 7.8554] w=0.0905 to align # Constraint # added constraint: constraint((T0344)G185.CA, (T0344)I211.CB) [> 4.0580 = 6.7634 < 8.7924] w=0.0905 to align # Constraint # added constraint: constraint((T0344)I184.CB, (T0344)I211.CB) [> 4.6732 = 7.7886 < 10.1252] w=0.0905 to align # Constraint # added constraint: constraint((T0344)I183.CB, (T0344)I211.CB) [> 2.7906 = 4.6509 < 6.0462] w=0.0905 to align # Constraint # added constraint: constraint((T0344)I183.CB, (T0344)W209.CB) [> 3.9902 = 6.6504 < 8.6455] w=0.0905 to align # Constraint # added constraint: constraint((T0344)Y173.CB, (T0344)G194.CA) [> 4.2288 = 7.0480 < 9.1624] w=0.0905 to align # Constraint # added constraint: constraint((T0344)G169.CA, (T0344)V203.CB) [> 4.6914 = 7.8190 < 10.1646] w=0.0905 to align # Constraint # added constraint: constraint((T0344)G169.CA, (T0344)G194.CA) [> 3.8353 = 6.3922 < 8.3098] w=0.0905 to align # Constraint # added constraint: constraint((T0344)L166.CB, (T0344)I178.CB) [> 3.5748 = 5.9580 < 7.7455] w=0.0905 to align # Constraint # added constraint: constraint((T0344)L166.CB, (T0344)E175.CB) [> 4.3704 = 7.2840 < 9.4692] w=0.0905 to align # Constraint # added constraint: constraint((T0344)H165.CB, (T0344)I178.CB) [> 3.6632 = 6.1054 < 7.9370] w=0.0905 to align # Constraint # added constraint: constraint((T0344)H165.CB, (T0344)V176.CB) [> 3.7014 = 6.1690 < 8.0197] w=0.0905 to align # Constraint # added constraint: constraint((T0344)Y44.CB, (T0344)Q56.CB) [> 3.6704 = 6.1174 < 7.9526] w=0.0904 to align # Constraint # added constraint: constraint((T0344)G85.CA, (T0344)L99.CB) [> 4.7903 = 7.9839 < 10.3790] w=0.0900 to align # Constraint # added constraint: constraint((T0344)K71.CB, (T0344)D80.CB) [> 4.7359 = 7.8932 < 10.2611] w=0.0900 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)G185.CA) [> 4.0999 = 6.8331 < 8.8831] w=0.0900 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)N177.CB) [> 4.3901 = 7.3168 < 9.5119] w=0.0900 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)G185.CA) [> 4.0460 = 6.7433 < 8.7663] w=0.0900 to align # Constraint # added constraint: constraint((T0344)I23.CB, (T0344)Y44.CB) [> 4.7898 = 7.9830 < 10.3779] w=0.0900 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)Y44.CB) [> 4.7065 = 7.8442 < 10.1974] w=0.0900 to align # Constraint # added constraint: constraint((T0344)L99.CB, (T0344)V108.CB) [> 3.5180 = 5.8633 < 7.6223] w=0.0897 to align # Constraint # added constraint: constraint((T0344)D97.CB, (T0344)W155.CB) [> 2.8223 = 4.7038 < 6.1149] w=0.0897 to align # Constraint # added constraint: constraint((T0344)D80.CB, (T0344)K90.CB) [> 4.2767 = 7.1279 < 9.2662] w=0.0895 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)I167.CB) [> 4.7470 = 7.9117 < 10.2852] w=0.0895 to align # Constraint # added constraint: constraint((T0344)A45.CB, (T0344)L99.CB) [> 3.3628 = 5.6046 < 7.2860] w=0.0895 to align # Constraint # added constraint: constraint((T0344)Y44.CB, (T0344)T82.CB) [> 3.7642 = 6.2737 < 8.1557] w=0.0895 to align # Constraint # added constraint: constraint((T0344)I150.CB, (T0344)I168.CB) [> 4.1034 = 6.8390 < 8.8907] w=0.0895 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)K154.CB) [> 3.7193 = 6.1989 < 8.0585] w=0.0895 to align # Constraint # added constraint: constraint((T0344)I134.CB, (T0344)G149.CA) [> 4.7707 = 7.9512 < 10.3366] w=0.0895 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)K154.CB) [> 4.6866 = 7.8109 < 10.1542] w=0.0895 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)T95.CB) [> 3.2775 = 5.4624 < 7.1012] w=0.0894 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)T95.CB) [> 4.6621 = 7.7701 < 10.1011] w=0.0894 to align # Constraint # added constraint: constraint((T0344)I96.CB, (T0344)W155.CB) [> 4.7447 = 7.9078 < 10.2802] w=0.0894 to align # Constraint # added constraint: constraint((T0344)Y48.CB, (T0344)S81.CB) [> 3.6693 = 6.1154 < 7.9501] w=0.0894 to align # Constraint # added constraint: constraint((T0344)I58.CB, (T0344)G84.CA) [> 4.7178 = 7.8630 < 10.2219] w=0.0894 to align # Constraint # added constraint: constraint((T0344)P74.CB, (T0344)L91.CB) [> 3.8210 = 6.3683 < 8.2788] w=0.0894 to align # Constraint # added constraint: constraint((T0344)D75.CB, (T0344)L91.CB) [> 3.3281 = 5.5469 < 7.2110] w=0.0894 to align # Constraint # added constraint: constraint((T0344)V76.CB, (T0344)R89.CB) [> 4.0422 = 6.7370 < 8.7581] w=0.0894 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)L119.CB) [> 2.9510 = 4.9184 < 6.3939] w=0.0892 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)A45.CB) [> 3.6017 = 6.0028 < 7.8036] w=0.0892 to align # Constraint # added constraint: constraint((T0344)L13.CB, (T0344)Y44.CB) [> 4.6262 = 7.7104 < 10.0235] w=0.0892 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)L29.CB) [> 4.0183 = 6.6972 < 8.7064] w=0.0892 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)L29.CB) [> 4.7080 = 7.8467 < 10.2008] w=0.0892 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)E31.CB) [> 4.0953 = 6.8254 < 8.8731] w=0.0892 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)L29.CB) [> 3.0489 = 5.0814 < 6.6059] w=0.0892 to align # Constraint # added constraint: constraint((T0344)V30.CB, (T0344)T127.CB) [> 4.7256 = 7.8761 < 10.2389] w=0.0892 to align # Constraint # added constraint: constraint((T0344)V30.CB, (T0344)M41.CB) [> 2.9636 = 4.9393 < 6.4211] w=0.0892 to align # Constraint # added constraint: constraint((T0344)L29.CB, (T0344)M41.CB) [> 4.0046 = 6.6744 < 8.6767] w=0.0892 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)I129.CB) [> 3.9145 = 6.5242 < 8.4814] w=0.0892 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)F123.CB) [> 3.1460 = 5.2434 < 6.8164] w=0.0892 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)V42.CB) [> 3.5849 = 5.9749 < 7.7674] w=0.0892 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)V42.CB) [> 3.8465 = 6.4109 < 8.3342] w=0.0892 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)I129.CB) [> 3.4223 = 5.7038 < 7.4149] w=0.0892 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)V42.CB) [> 4.5719 = 7.6198 < 9.9058] w=0.0863 to align # Constraint # added constraint: constraint((T0344)D14.CB, (T0344)A37.CB) [> 4.3808 = 7.3014 < 9.4918] w=0.0862 to align # Constraint # added constraint: constraint((T0344)E15.CB, (T0344)A37.CB) [> 4.7619 = 7.9365 < 10.3175] w=0.0862 to align # Constraint # added constraint: constraint((T0344)T16.CB, (T0344)A37.CB) [> 3.1654 = 5.2756 < 6.8583] w=0.0862 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)L170.CB) [> 4.0001 = 6.6668 < 8.6668] w=0.0862 to align # Constraint # added constraint: constraint((T0344)V132.CB, (T0344)G169.CA) [> 3.7473 = 6.2455 < 8.1191] w=0.0862 to align # Constraint # added constraint: constraint((T0344)V132.CB, (T0344)L170.CB) [> 3.6032 = 6.0053 < 7.8069] w=0.0862 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)L170.CB) [> 4.2553 = 7.0922 < 9.2198] w=0.0862 to align # Constraint # added constraint: constraint((T0344)V139.CB, (T0344)L170.CB) [> 4.5047 = 7.5079 < 9.7602] w=0.0862 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)R142.CB) [> 3.5468 = 5.9114 < 7.6848] w=0.0568 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)I143.CB) [> 4.3978 = 7.3296 < 9.5285] w=0.0568 to align # Constraint # added constraint: constraint((T0344)V139.CB, (T0344)G156.CA) [> 3.3164 = 5.5273 < 7.1855] w=0.0523 to align # Constraint # added constraint: constraint((T0344)P140.CB, (T0344)G156.CA) [> 4.1725 = 6.9541 < 9.0403] w=0.0523 to align # Constraint # added constraint: constraint((T0344)P140.CB, (T0344)E158.CB) [> 3.7916 = 6.3193 < 8.2151] w=0.0523 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)V76.CB) [> 4.3815 = 7.3025 < 9.4932] w=0.0495 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)V76.CB) [> 3.4068 = 5.6780 < 7.3814] w=0.0495 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)I77.CB) [> 4.1754 = 6.9591 < 9.0468] w=0.0495 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)L68.CB) [> 3.9252 = 6.5421 < 8.5047] w=0.0495 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)V62.CB) [> 3.3527 = 5.5878 < 7.2641] w=0.0495 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)A57.CB) [> 4.3325 = 7.2209 < 9.3871] w=0.0495 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)W155.CB) [> 4.5718 = 7.6197 < 9.9056] w=0.0453 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)W155.CB) [> 2.3899 = 3.9832 < 5.1781] w=0.0453 to align # Constraint # added constraint: constraint((T0344)Y44.CB, (T0344)L64.CB) [> 4.6262 = 7.7103 < 10.0234] w=0.0453 to align # Constraint # added constraint: constraint((T0344)A199.CB, (T0344)P213.CB) [> 3.3436 = 5.5727 < 7.2445] w=0.0453 to align # Constraint # added constraint: constraint((T0344)S198.CB, (T0344)P213.CB) [> 4.7549 = 7.9248 < 10.3022] w=0.0453 to align # Constraint # added constraint: constraint((T0344)G197.CA, (T0344)A217.CB) [> 4.4264 = 7.3773 < 9.5904] w=0.0453 to align # Constraint # added constraint: constraint((T0344)G197.CA, (T0344)P215.CB) [> 3.9235 = 6.5392 < 8.5010] w=0.0453 to align # Constraint # added constraint: constraint((T0344)G197.CA, (T0344)N214.CB) [> 4.6578 = 7.7630 < 10.0919] w=0.0453 to align # Constraint # added constraint: constraint((T0344)G197.CA, (T0344)P213.CB) [> 3.1752 = 5.2920 < 6.8795] w=0.0453 to align # Constraint # added constraint: constraint((T0344)Y196.CB, (T0344)P215.CB) [> 3.3300 = 5.5500 < 7.2149] w=0.0453 to align # Constraint # added constraint: constraint((T0344)Y196.CB, (T0344)N214.CB) [> 3.8256 = 6.3760 < 8.2889] w=0.0453 to align # Constraint # added constraint: constraint((T0344)Y196.CB, (T0344)P213.CB) [> 3.8619 = 6.4365 < 8.3675] w=0.0453 to align # Constraint # added constraint: constraint((T0344)K154.CB, (T0344)L195.CB) [> 4.7530 = 7.9216 < 10.2981] w=0.0453 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)V176.CB) [> 2.9030 = 4.8383 < 6.2897] w=0.0450 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)V176.CB) [> 4.5677 = 7.6129 < 9.8968] w=0.0450 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)V176.CB) [> 4.0485 = 6.7476 < 8.7718] w=0.0450 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)V176.CB) [> 3.6839 = 6.1398 < 7.9817] w=0.0450 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)V176.CB) [> 3.5407 = 5.9011 < 7.6715] w=0.0450 to align # Constraint # added constraint: constraint((T0344)V176.CB, (T0344)R186.CB) [> 3.9704 = 6.6173 < 8.6025] w=0.0450 to align # Constraint # added constraint: constraint((T0344)A24.CB, (T0344)L188.CB) [> 4.0915 = 6.8191 < 8.8648] w=0.0450 to align # Constraint # added constraint: constraint((T0344)T25.CB, (T0344)L188.CB) [> 4.0496 = 6.7492 < 8.7740] w=0.0450 to align # Constraint # added constraint: constraint((T0344)V26.CB, (T0344)L188.CB) [> 3.1909 = 5.3181 < 6.9136] w=0.0450 to align # Constraint # added constraint: constraint((T0344)A27.CB, (T0344)L188.CB) [> 4.6596 = 7.7659 < 10.0957] w=0.0450 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)I178.CB) [> 3.5832 = 5.9721 < 7.7637] w=0.0450 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)I183.CB) [> 3.2413 = 5.4022 < 7.0229] w=0.0450 to align # Constraint # added constraint: constraint((T0344)V28.CB, (T0344)I184.CB) [> 3.9071 = 6.5119 < 8.4655] w=0.0450 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)G149.CA) [> 4.3036 = 7.1726 < 9.3244] w=0.0450 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)G149.CA) [> 2.9951 = 4.9919 < 6.4894] w=0.0450 to align # Constraint # added constraint: constraint((T0344)A57.CB, (T0344)G84.CA) [> 4.7514 = 7.9190 < 10.2947] w=0.0447 to align # Constraint # added constraint: constraint((T0344)I77.CB, (T0344)L119.CB) [> 4.3048 = 7.1747 < 9.3271] w=0.0447 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)L99.CB) [> 3.0607 = 5.1012 < 6.6315] w=0.0447 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)P94.CB) [> 3.3377 = 5.5628 < 7.2316] w=0.0447 to align # Constraint # added constraint: constraint((T0344)P47.CB, (T0344)A57.CB) [> 3.8746 = 6.4577 < 8.3950] w=0.0447 to align # Constraint # added constraint: constraint((T0344)Y44.CB, (T0344)G85.CA) [> 4.2506 = 7.0844 < 9.2097] w=0.0447 to align # Constraint # added constraint: constraint((T0344)L112.CB, (T0344)W155.CB) [> 3.0331 = 5.0551 < 6.5716] w=0.0447 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)P94.CB) [> 4.2048 = 7.0080 < 9.1104] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)P94.CB) [> 4.3409 = 7.2348 < 9.4053] w=0.0447 to align # Constraint # added constraint: constraint((T0344)E87.CB, (T0344)P171.CB) [> 4.2625 = 7.1042 < 9.2355] w=0.0447 to align # Constraint # added constraint: constraint((T0344)K90.CB, (T0344)P171.CB) [> 3.2151 = 5.3585 < 6.9661] w=0.0447 to align # Constraint # added constraint: constraint((T0344)E93.CB, (T0344)P171.CB) [> 3.2549 = 5.4249 < 7.0524] w=0.0447 to align # Constraint # added constraint: constraint((T0344)V30.CB, (T0344)K43.CB) [> 2.9597 = 4.9328 < 6.4126] w=0.0447 to align # Constraint # added constraint: constraint((T0344)V30.CB, (T0344)V40.CB) [> 4.7012 = 7.8354 < 10.1860] w=0.0447 to align # Constraint # added constraint: constraint((T0344)L29.CB, (T0344)K43.CB) [> 4.0858 = 6.8096 < 8.8525] w=0.0447 to align # Constraint # added constraint: constraint((T0344)L29.CB, (T0344)V42.CB) [> 3.5297 = 5.8829 < 7.6477] w=0.0447 to align # Constraint # added constraint: constraint((T0344)V76.CB, (T0344)L88.CB) [> 4.4569 = 7.4282 < 9.6566] w=0.0447 to align # Constraint # added constraint: constraint((T0344)Y44.CB, (T0344)W124.CB) [> 4.6430 = 7.7384 < 10.0599] w=0.0447 to align # Constraint # added constraint: constraint((T0344)E31.CB, (T0344)M41.CB) [> 4.4518 = 7.4197 < 9.6456] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)G84.CA) [> 3.6109 = 6.0182 < 7.8237] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)A57.CB) [> 2.9151 = 4.8585 < 6.3161] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)G85.CA) [> 3.7299 = 6.2165 < 8.0814] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)G84.CA) [> 3.0519 = 5.0865 < 6.6125] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)L83.CB) [> 4.4712 = 7.4520 < 9.6875] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G9.CA, (T0344)T82.CB) [> 3.6942 = 6.1571 < 8.0042] w=0.0447 to align # Constraint # added constraint: constraint((T0344)T8.CB, (T0344)L64.CB) [> 3.0659 = 5.1099 < 6.6428] w=0.0447 to align # Constraint # added constraint: constraint((T0344)K43.CB, (T0344)L64.CB) [> 3.1961 = 5.3269 < 6.9250] w=0.0447 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)G85.CA) [> 4.5367 = 7.5612 < 9.8295] w=0.0447 to align # Constraint # added constraint: constraint((T0344)A11.CB, (T0344)L83.CB) [> 3.9459 = 6.5765 < 8.5494] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G10.CA, (T0344)I86.CB) [> 4.7688 = 7.9481 < 10.3325] w=0.0447 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)S81.CB) [> 4.4392 = 7.3987 < 9.6183] w=0.0447 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)L79.CB) [> 3.3512 = 5.5854 < 7.2610] w=0.0447 to align # Constraint # added constraint: constraint((T0344)I3.CB, (T0344)A133.CB) [> 4.0580 = 6.7633 < 8.7923] w=0.0447 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)E130.CB) [> 3.1969 = 5.3282 < 6.9267] w=0.0447 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)N128.CB) [> 3.3783 = 5.6305 < 7.3196] w=0.0447 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)L79.CB) [> 4.2509 = 7.0848 < 9.2103] w=0.0447 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)H78.CB) [> 4.7272 = 7.8787 < 10.2423] w=0.0447 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)I77.CB) [> 2.4642 = 4.1069 < 5.3390] w=0.0447 to align # Constraint # added constraint: constraint((T0344)M1.CB, (T0344)I131.CB) [> 4.6138 = 7.6897 < 9.9966] w=0.0447 to align # Constraint # added constraint: constraint((T0344)M1.CB, (T0344)E130.CB) [> 3.1699 = 5.2832 < 6.8681] w=0.0447 to align # Constraint # added constraint: constraint((T0344)M1.CB, (T0344)I77.CB) [> 3.9842 = 6.6403 < 8.6323] w=0.0447 to align # Constraint # added constraint: constraint((T0344)M1.CB, (T0344)V76.CB) [> 3.2232 = 5.3720 < 6.9835] w=0.0447 to align # Constraint # added constraint: constraint((T0344)A6.CB, (T0344)L68.CB) [> 3.8537 = 6.4229 < 8.3498] w=0.0447 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)A133.CB) [> 2.9351 = 4.8918 < 6.3593] w=0.0447 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)S81.CB) [> 4.6633 = 7.7722 < 10.1038] w=0.0447 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)L79.CB) [> 4.3744 = 7.2907 < 9.4780] w=0.0447 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)A133.CB) [> 4.2746 = 7.1243 < 9.2616] w=0.0447 to align # Constraint # added constraint: constraint((T0344)I86.CB, (T0344)L170.CB) [> 4.7561 = 7.9269 < 10.3050] w=0.0447 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)F123.CB) [> 4.0187 = 6.6978 < 8.7072] w=0.0447 to align # Constraint # added constraint: constraint((T0344)S138.CB, (T0344)Y147.CB) [> 3.0750 = 5.1250 < 6.6625] w=0.0447 to align # Constraint # added constraint: constraint((T0344)S137.CB, (T0344)Y147.CB) [> 4.4318 = 7.3863 < 9.6022] w=0.0447 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)I146.CB) [> 3.7915 = 6.3192 < 8.2149] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)Y147.CB) [> 4.7146 = 7.8577 < 10.2150] w=0.0447 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)I146.CB) [> 2.0898 = 3.4831 < 4.5280] w=0.0447 to align # Constraint # added constraint: constraint((T0344)F123.CB, (T0344)V132.CB) [> 3.2183 = 5.3638 < 6.9729] w=0.0447 to align # Constraint # added constraint: constraint((T0344)Y50.CB, (T0344)P171.CB) [> 4.3642 = 7.2737 < 9.4558] w=0.0447 to align # Constraint # added constraint: constraint((T0344)Y48.CB, (T0344)L116.CB) [> 2.4589 = 4.0982 < 5.3277] w=0.0447 to align # Constraint # added constraint: constraint((T0344)K43.CB, (T0344)L68.CB) [> 3.8537 = 6.4229 < 8.3498] w=0.0447 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)L119.CB) [> 3.3620 = 5.6033 < 7.2843] w=0.0447 to align # Constraint # added constraint: constraint((T0344)R59.CB, (T0344)L116.CB) [> 3.1070 = 5.1783 < 6.7318] w=0.0447 to align # Constraint # added constraint: constraint((T0344)D51.CB, (T0344)L63.CB) [> 3.2109 = 5.3515 < 6.9570] w=0.0447 to align # Constraint # added constraint: constraint((T0344)L52.CB, (T0344)P171.CB) [> 4.3563 = 7.2605 < 9.4386] w=0.0447 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)V28.CB) [> 3.6986 = 6.1643 < 8.0136] w=0.0445 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)L29.CB) [> 4.1128 = 6.8547 < 8.9111] w=0.0445 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)V30.CB) [> 2.9434 = 4.9057 < 6.3774] w=0.0445 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)E31.CB) [> 4.7805 = 7.9674 < 10.3577] w=0.0445 to align # Constraint # added constraint: constraint((T0344)L13.CB, (T0344)V26.CB) [> 4.3511 = 7.2518 < 9.4273] w=0.0445 to align # Constraint # added constraint: constraint((T0344)L29.CB, (T0344)E39.CB) [> 4.0324 = 6.7207 < 8.7369] w=0.0445 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)I183.CB) [> 4.5289 = 7.5482 < 9.8126] w=0.0445 to align # Constraint # added constraint: constraint((T0344)V160.CB, (T0344)G181.CA) [> 3.7724 = 6.2873 < 8.1735] w=0.0445 to align # Constraint # added constraint: constraint((T0344)H165.CB, (T0344)K179.CB) [> 4.7245 = 7.8741 < 10.2363] w=0.0445 to align # Constraint # added constraint: constraint((T0344)E175.CB, (T0344)L188.CB) [> 4.0911 = 6.8185 < 8.8640] w=0.0445 to align # Constraint # added constraint: constraint((T0344)L63.CB, (T0344)N128.CB) [> 4.6580 = 7.7634 < 10.0924] w=0.0445 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)E175.CB) [> 4.6227 = 7.7045 < 10.0158] w=0.0445 to align # Constraint # added constraint: constraint((T0344)L83.CB, (T0344)K136.CB) [> 2.6825 = 4.4708 < 5.8120] w=0.0445 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)E175.CB) [> 3.8107 = 6.3511 < 8.2565] w=0.0445 to align # Constraint # added constraint: constraint((T0344)T82.CB, (T0344)Y173.CB) [> 4.7804 = 7.9674 < 10.3576] w=0.0445 to align # Constraint # added constraint: constraint((T0344)V132.CB, (T0344)V141.CB) [> 3.1228 = 5.2046 < 6.7660] w=0.0437 to align # Constraint # added constraint: constraint((T0344)P19.CB, (T0344)M41.CB) [> 4.6913 = 7.8188 < 10.1644] w=0.0431 to align # Constraint # added constraint: constraint((T0344)K32.CB, (T0344)V42.CB) [> 2.8480 = 4.7467 < 6.1707] w=0.0431 to align # Constraint # added constraint: constraint((T0344)I129.CB, (T0344)L166.CB) [> 3.3425 = 5.5708 < 7.2420] w=0.0431 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)P171.CB) [> 3.9123 = 6.5205 < 8.4767] w=0.0431 to align # Constraint # added constraint: constraint((T0344)P140.CB, (T0344)W155.CB) [> 3.1377 = 5.2295 < 6.7983] w=0.0430 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)R142.CB) [> 4.3808 = 7.3014 < 9.4918] w=0.0430 to align # Constraint # added constraint: constraint((T0344)L116.CB, (T0344)R142.CB) [> 4.2702 = 7.1170 < 9.2521] w=0.0430 to align # Constraint # added constraint: constraint((T0344)E87.CB, (T0344)V108.CB) [> 4.1984 = 6.9973 < 9.0965] w=0.0430 to align # Constraint # added constraint: constraint((T0344)S81.CB, (T0344)I143.CB) [> 4.4485 = 7.4142 < 9.6385] w=0.0138 to align # Constraint # added constraint: constraint((T0344)G84.CA, (T0344)R142.CB) [> 4.2672 = 7.1120 < 9.2456] w=0.0138 to align # Constraint # added constraint: constraint((T0344)L79.CB, (T0344)I146.CB) [> 4.6486 = 7.7477 < 10.0720] w=0.0093 to align # Constraint # added constraint: constraint((T0344)A133.CB, (T0344)Y147.CB) [> 4.5582 = 7.5971 < 9.8762] w=0.0093 to align # Constraint # added constraint: constraint((T0344)G135.CA, (T0344)L170.CB) [> 4.1833 = 6.9722 < 9.0638] w=0.0093 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)G169.CA) [> 4.0513 = 6.7522 < 8.7778] w=0.0093 to align # Constraint # added constraint: constraint((T0344)K136.CB, (T0344)L170.CB) [> 4.1026 = 6.8376 < 8.8889] w=0.0093 to align # Constraint # added constraint: constraint((T0344)S137.CB, (T0344)G169.CA) [> 4.3564 = 7.2606 < 9.4388] w=0.0093 to align # Constraint # added constraint: constraint((T0344)V141.CB, (T0344)G156.CA) [> 2.7469 = 4.5781 < 5.9515] w=0.0093 to align # Constraint # added constraint: constraint((T0344)V141.CB, (T0344)I157.CB) [> 4.4685 = 7.4475 < 9.6818] w=0.0093 to align # Constraint # added constraint: constraint((T0344)V141.CB, (T0344)E158.CB) [> 3.3701 = 5.6169 < 7.3020] w=0.0093 to align # Constraint # added constraint: constraint((T0344)V4.CB, (T0344)I77.CB) [> 2.6325 = 4.3875 < 5.7037] w=0.0048 to align # Constraint # added constraint: constraint((T0344)A5.CB, (T0344)I77.CB) [> 4.6762 = 7.7937 < 10.1318] w=0.0048 to align # Constraint # added constraint: constraint((T0344)R2.CB, (T0344)D75.CB) [> 2.9981 = 4.9968 < 6.4958] w=0.0048 to align # Constraint # added constraint: constraint((T0344)V139.CB, (T0344)G169.CA) [> 4.7893 = 7.9822 < 10.3768] w=0.0048 to align # Constraint # added constraint: constraint((T0344)S137.CB, (T0344)L170.CB) [> 4.7176 = 7.8627 < 10.2215] w=0.0045 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0344/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0344/decoys/ # ReadConformPDB reading from PDB file T0344.chimera.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file T0344.model1_renum.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file T0344.model2.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file T0344.sub-chimera.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file robetta-model1.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file robetta-model10.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file robetta-model2.pdb.gz looking for model 1 # Found a chain break before 131 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file robetta-model3.pdb.gz looking for model 1 # Found a chain break before 140 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file robetta-model4.pdb.gz looking for model 1 # ReadConformPDB reading from PDB file robetta-model5.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file robetta-model6.pdb.gz looking for model 1 # ReadConformPDB reading from PDB file robetta-model7.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file robetta-model8.pdb.gz looking for model 1 # ReadConformPDB reading from PDB file robetta-model9.pdb.gz looking for model 1 # Found a chain break before 192 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 191 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 225 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 225 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 120 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 187 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)G185.C and (T0344)R186.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.CA only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.CA only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.CB only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.CB only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.CB only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.CG only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.CG only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.CG only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.CG only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R186.CD only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.CD only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.CD only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.CD only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.CD only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R186.NE only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R186.NE only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.NE only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.NE only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.NE only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.NE only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R186.CZ only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R186.CZ only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R186.CZ only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.CZ only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.CZ only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.CZ only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.CZ only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.NH1 only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.NH2 only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.O only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R186.C only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S187.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S187.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S187.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S187.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S187.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S187.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S187.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S187.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S187.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S187.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S187.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S187.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S187.CA only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S187.OG only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S187.O only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S187.C only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.CG only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.CD1 only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.CD2 only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.O only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L188.C only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)D189.N and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.CA only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.CB only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.CG only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.OD1 only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.OD2 only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.O only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)D189.C only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)P190.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)P190.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)P190.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)P190.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)P190.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)P190.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)P190.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)P190.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)P190.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)P190.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)P190.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)P190.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)P190.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)P190.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)P190.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)P190.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)P190.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)P190.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)P190.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)P190.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)P190.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)P190.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)P190.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)P190.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)P190.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)P190.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)P190.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)P190.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)P190.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)P190.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)P190.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)P190.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)P190.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)P190.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)P190.N and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)P190.CA only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.N and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.C and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.O and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)P190.CG only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.N and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.C and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.O and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)D189.N and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.C and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.O and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)L188.N and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)S187.C and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)S187.O and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)S187.N and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.C and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.O and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)R186.N and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)G185.C and (T0344)P190.CD only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)P190.O only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)P190.C only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.CA only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.CG only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.CD only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.NE only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.CZ only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.NH1 only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.NH2 only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.O only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)R191.C only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.CA only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.CG only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.CD only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.OE1 only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.OE2 only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.O only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E192.C only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G193.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G193.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G193.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G193.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G193.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G193.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G193.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G193.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G193.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G193.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G193.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G193.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G193.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G193.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G193.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G193.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G193.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G193.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G193.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G193.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G193.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G193.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G193.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G193.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G193.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G193.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G193.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G193.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G193.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G193.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G193.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G193.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G193.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G193.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G193.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G193.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G193.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G193.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G193.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G193.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G193.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G193.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G193.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G193.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G193.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G193.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G193.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G193.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G193.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G193.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G193.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G193.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G193.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G193.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G193.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G193.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G193.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G193.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G193.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G193.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G193.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G193.CA only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G193.O only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G193.C only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G194.N only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G194.N only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G194.N only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G194.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G194.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G194.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G194.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G194.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G194.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G194.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G194.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G194.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G194.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G194.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G194.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G194.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G194.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G194.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G194.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G194.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G194.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G194.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G194.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G194.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G194.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G194.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G194.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G194.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G194.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G194.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G194.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G194.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G194.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G194.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G194.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G194.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G194.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G194.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G194.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G194.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G194.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G194.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G194.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G194.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G194.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G194.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G194.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G194.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G194.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G194.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G194.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G194.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G194.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G194.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G194.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G194.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G194.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G194.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G194.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G194.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G194.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G194.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G194.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G194.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G194.N only 0.000 apart, marking (T0344)G194.N as missing WARNING: atoms too close: (T0344)G194.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G194.CA only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G194.O only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G194.C only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.N only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.N only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.N only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.N only 0.000 apart, marking (T0344)G194.N as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.N only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.N only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.N only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.N only 0.000 apart, marking (T0344)L195.N as missing WARNING: atoms too close: (T0344)L195.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.CA only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L195.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.CG only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.CD1 only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.CD2 only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.O only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G194.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G194.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)L195.C only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.N only 0.000 apart, marking (T0344)L195.N as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.N only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.N only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.N only 0.000 apart, marking (T0344)G194.N as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.N only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.N only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.N only 0.000 apart, marking (T0344)Y196.N as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CA only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CB only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CG only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CD1 only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CD2 only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CE1 only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CE2 only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.CZ only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.OH only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.O only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L195.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G194.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G194.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)Y196.C only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)G197.N only 0.000 apart, marking (T0344)Y196.N as missing WARNING: atoms too close: (T0344)L195.C and (T0344)G197.N only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)G197.N only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)G197.N only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)G197.N only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)G197.N only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)G197.N only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)G197.N only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)G197.N only 0.000 apart, marking (T0344)L195.N as missing WARNING: atoms too close: (T0344)G194.C and (T0344)G197.N only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)G197.N only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)G197.N only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)G197.N only 0.000 apart, marking (T0344)G194.N as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G197.N only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G197.N only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G197.N only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G197.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G197.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G197.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G197.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G197.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G197.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G197.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G197.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G197.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G197.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G197.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G197.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G197.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G197.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G197.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G197.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G197.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G197.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G197.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G197.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G197.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G197.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G197.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G197.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G197.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G197.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G197.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G197.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G197.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G197.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G197.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G197.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G197.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G197.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G197.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G197.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G197.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G197.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G197.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G197.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G197.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G197.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G197.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G197.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G197.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G197.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G197.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G197.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G197.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G197.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G197.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G197.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G197.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G197.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G197.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G197.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G197.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G197.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G197.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G197.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G197.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G197.N only 0.000 apart, marking (T0344)G197.N as missing WARNING: atoms too close: (T0344)G197.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G194.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G194.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G197.CA only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G197.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L195.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G194.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G194.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G194.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G197.O only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G197.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G197.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L195.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G194.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G194.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)G197.C only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G197.C and (T0344)S198.N only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G197.O and (T0344)S198.N only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)S198.N only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G197.N and (T0344)S198.N only 0.000 apart, marking (T0344)G197.N as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)S198.N only 0.000 apart, marking (T0344)Y196.N as missing WARNING: atoms too close: (T0344)L195.C and (T0344)S198.N only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)S198.N only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)S198.N only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)S198.N only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)S198.N only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)S198.N only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)S198.N only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)S198.N only 0.000 apart, marking (T0344)L195.N as missing WARNING: atoms too close: (T0344)G194.C and (T0344)S198.N only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)S198.N only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)S198.N only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)S198.N only 0.000 apart, marking (T0344)G194.N as missing WARNING: atoms too close: (T0344)G193.C and (T0344)S198.N only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)S198.N only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)S198.N only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)S198.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)E192.C and (T0344)S198.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)S198.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)S198.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)S198.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)S198.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)S198.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)S198.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)S198.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)S198.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)S198.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)S198.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)S198.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)S198.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)S198.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)S198.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)S198.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)S198.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)S198.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)S198.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)S198.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)S198.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)S198.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)S198.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)S198.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)S198.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)S198.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)S198.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)S198.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)S198.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)S198.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)S198.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)S198.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)S198.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)S198.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)S198.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)S198.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)S198.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)S198.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)S198.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)S198.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)S198.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)S198.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)S198.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)S198.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)S198.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S198.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S198.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S198.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S198.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S198.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S198.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S198.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S198.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S198.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S198.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S198.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S198.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S198.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S198.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S198.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S198.N only 0.000 apart, marking (T0344)S198.N as missing WARNING: atoms too close: (T0344)S198.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G197.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G197.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G197.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G194.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G194.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G193.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G193.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S198.CA only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S198.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G197.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G197.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G197.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L195.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G194.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G194.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G194.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G193.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G193.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G193.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)E192.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R191.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)P190.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S198.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G197.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G197.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G197.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L195.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G194.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G194.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G194.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G193.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G193.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G193.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)E192.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R191.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)P190.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)P190.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)P190.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S198.OG only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S198.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G197.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G197.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G197.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L195.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G194.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G194.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G194.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G193.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S198.O only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S198.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S198.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G197.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G197.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G197.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L195.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G194.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G194.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)S198.C only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S198.C and (T0344)A199.N only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S198.O and (T0344)A199.N only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)A199.N only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)A199.N only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)A199.N only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S198.N and (T0344)A199.N only 0.000 apart, marking (T0344)S198.N as missing WARNING: atoms too close: (T0344)G197.C and (T0344)A199.N only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G197.O and (T0344)A199.N only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)A199.N only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G197.N and (T0344)A199.N only 0.000 apart, marking (T0344)G197.N as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)A199.N only 0.000 apart, marking (T0344)Y196.N as missing WARNING: atoms too close: (T0344)L195.C and (T0344)A199.N only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)A199.N only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)A199.N only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)A199.N only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)A199.N only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)A199.N only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)A199.N only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)A199.N only 0.000 apart, marking (T0344)L195.N as missing WARNING: atoms too close: (T0344)G194.C and (T0344)A199.N only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)A199.N only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)A199.N only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)A199.N only 0.000 apart, marking (T0344)G194.N as missing WARNING: atoms too close: (T0344)G193.C and (T0344)A199.N only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)A199.N only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)A199.N only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)A199.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)E192.C and (T0344)A199.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)A199.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)A199.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)A199.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)A199.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)A199.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)A199.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)A199.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)A199.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)A199.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)A199.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)A199.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)A199.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)A199.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)A199.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)A199.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)A199.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)A199.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)A199.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)A199.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)A199.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)A199.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)A199.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)A199.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)A199.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)A199.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)A199.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)A199.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)A199.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)A199.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)A199.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)A199.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)A199.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)A199.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)A199.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)A199.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)A199.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)A199.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)A199.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)A199.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)A199.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)A199.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)A199.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)A199.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)A199.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)A199.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)A199.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)A199.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)A199.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)A199.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)A199.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)A199.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)A199.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)A199.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)A199.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)A199.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)A199.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)A199.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)A199.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)A199.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)A199.N only 0.000 apart, marking (T0344)A199.N as missing WARNING: atoms too close: (T0344)A199.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S198.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S198.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S198.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G197.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G197.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G197.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G194.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G194.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G193.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G193.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)A199.CA only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)A199.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S198.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S198.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S198.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G197.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G197.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G197.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L195.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G194.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G194.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G194.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G193.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G193.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G193.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)E192.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R191.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)P190.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)A199.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S198.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S198.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S198.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G197.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G197.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G197.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L195.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G194.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G194.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G194.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G193.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)A199.O only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)A199.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)A199.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S198.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S198.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S198.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G197.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G197.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G197.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L195.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G194.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G194.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)A199.C only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.N only 0.000 apart, marking (T0344)A199.C as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.N only 0.000 apart, marking (T0344)A199.O as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.N only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.N only 0.000 apart, marking (T0344)A199.CA as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.N only 0.000 apart, marking (T0344)A199.N as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.N only 0.000 apart, marking (T0344)S198.C as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.N only 0.000 apart, marking (T0344)S198.O as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.N only 0.000 apart, marking (T0344)S198.OG as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.N only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.N only 0.000 apart, marking (T0344)S198.CA as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.N only 0.000 apart, marking (T0344)S198.N as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.N only 0.000 apart, marking (T0344)G197.C as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.N only 0.000 apart, marking (T0344)G197.O as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.N only 0.000 apart, marking (T0344)G197.CA as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.N only 0.000 apart, marking (T0344)G197.N as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.OH as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CZ as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CE2 as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CE1 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CD2 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CD1 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CG as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CB as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.N only 0.000 apart, marking (T0344)Y196.N as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.N only 0.000 apart, marking (T0344)L195.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.N only 0.000 apart, marking (T0344)L195.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.N only 0.000 apart, marking (T0344)L195.CD2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.N only 0.000 apart, marking (T0344)L195.CD1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.N only 0.000 apart, marking (T0344)L195.CG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.N only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.N only 0.000 apart, marking (T0344)L195.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.N only 0.000 apart, marking (T0344)L195.N as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.N only 0.000 apart, marking (T0344)G194.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.N only 0.000 apart, marking (T0344)G194.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.N only 0.000 apart, marking (T0344)G194.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.N only 0.000 apart, marking (T0344)G194.N as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.N only 0.000 apart, marking (T0344)G193.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.N only 0.000 apart, marking (T0344)G193.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.N only 0.000 apart, marking (T0344)G193.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.N only 0.000 apart, marking (T0344)G193.N as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.N only 0.000 apart, marking (T0344)E192.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.N only 0.000 apart, marking (T0344)E192.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.N only 0.000 apart, marking (T0344)E192.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.N only 0.000 apart, marking (T0344)E192.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.N only 0.000 apart, marking (T0344)E192.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.N only 0.000 apart, marking (T0344)E192.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.N only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.N only 0.000 apart, marking (T0344)E192.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.N only 0.000 apart, marking (T0344)E192.N as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.N only 0.000 apart, marking (T0344)R191.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.N only 0.000 apart, marking (T0344)R191.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.N only 0.000 apart, marking (T0344)R191.NH2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.N only 0.000 apart, marking (T0344)R191.NH1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.N only 0.000 apart, marking (T0344)R191.CZ as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.N only 0.000 apart, marking (T0344)R191.NE as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.N only 0.000 apart, marking (T0344)R191.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.N only 0.000 apart, marking (T0344)R191.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.N only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.N only 0.000 apart, marking (T0344)R191.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.N only 0.000 apart, marking (T0344)R191.N as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.N only 0.000 apart, marking (T0344)P190.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.N only 0.000 apart, marking (T0344)P190.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.N only 0.000 apart, marking (T0344)P190.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.N only 0.000 apart, marking (T0344)P190.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.N only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.N only 0.000 apart, marking (T0344)P190.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.N only 0.000 apart, marking (T0344)P190.N as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.N only 0.000 apart, marking (T0344)D189.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.N only 0.000 apart, marking (T0344)D189.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.N only 0.000 apart, marking (T0344)D189.OD2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.N only 0.000 apart, marking (T0344)D189.OD1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.N only 0.000 apart, marking (T0344)D189.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.N only 0.000 apart, marking (T0344)D189.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.N only 0.000 apart, marking (T0344)D189.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.N only 0.000 apart, marking (T0344)D189.N as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.N only 0.000 apart, marking (T0344)L188.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.N only 0.000 apart, marking (T0344)L188.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.N only 0.000 apart, marking (T0344)L188.CD2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.N only 0.000 apart, marking (T0344)L188.CD1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.N only 0.000 apart, marking (T0344)L188.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.N only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.N only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.N only 0.000 apart, marking (T0344)L188.N as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.N only 0.000 apart, marking (T0344)S187.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.N only 0.000 apart, marking (T0344)S187.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.N only 0.000 apart, marking (T0344)S187.OG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.N only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.N only 0.000 apart, marking (T0344)S187.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.N only 0.000 apart, marking (T0344)S187.N as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.N only 0.000 apart, marking (T0344)R186.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.N only 0.000 apart, marking (T0344)R186.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.N only 0.000 apart, marking (T0344)R186.NH2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.N only 0.000 apart, marking (T0344)R186.NH1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.N only 0.000 apart, marking (T0344)R186.CZ as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.N only 0.000 apart, marking (T0344)R186.NE as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.N only 0.000 apart, marking (T0344)R186.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.N only 0.000 apart, marking (T0344)R186.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.N only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.N only 0.000 apart, marking (T0344)R186.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.N only 0.000 apart, marking (T0344)R186.N as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.N only 0.000 apart, marking (T0344)E200.N as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)E200.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)E200.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E200.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.CG only 0.000 apart, marking (T0344)E200.CG as missing WARNING: atoms too close: (T0344)E200.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E200.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E200.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.CD only 0.000 apart, marking (T0344)E200.CD as missing WARNING: atoms too close: (T0344)E200.CD and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E200.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E200.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E200.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.OE1 only 0.000 apart, marking (T0344)E200.OE1 as missing WARNING: atoms too close: (T0344)E200.OE1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E200.CD and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E200.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E200.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E200.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.OE2 only 0.000 apart, marking (T0344)E200.OE2 as missing WARNING: atoms too close: (T0344)E200.OE2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E200.OE1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E200.CD and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E200.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E200.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E200.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)E200.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E200.OE2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E200.OE1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E200.CD and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E200.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E200.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E200.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E200.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)A199.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)A199.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)A199.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)A199.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S198.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S198.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S198.OG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S198.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S198.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G197.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G197.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G197.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.OH and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CZ and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CE2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CE1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CD2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CD1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.CD2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.CD1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L195.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G194.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G194.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G194.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G193.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G193.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G193.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.OE2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.OE1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.CD and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)E192.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.NH2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.NH1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.CZ and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.NE and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.CD and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R191.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.CD and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.OD2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.OD1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.CD2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.CD1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)L188.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S187.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S187.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S187.OG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S187.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)S187.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.O and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.NH2 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.NH1 and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.CZ and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.NE and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.CD and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.CG and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.CB and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)R186.N and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)G185.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 210 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 96 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 225 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 Skipped atom 238, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 240, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 242, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 244, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 338, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 340, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 342, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 344, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 Skipped atom 422, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 424, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 426, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 428, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 430, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 484, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 648, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 650, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 652, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 654, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 656, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 Skipped atom 238, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 240, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 242, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 244, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 338, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 340, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 342, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 344, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 Skipped atom 422, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 424, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 426, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 428, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 430, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 484, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 648, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 650, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 652, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 654, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 656, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 195 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 180 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 206 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 181 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 207 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 208 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # Found a chain break before 167 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 149 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 WARNING: atom 1 has residue number 12 < previous residue 227 in servers/HHpred1_TS1.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 150 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # Found a chain break before 150 # copying to AlignedFragments data structure # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS1.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS2.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS3.pdb.gz looking for model 1 # Found a chain break before 156 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS4.pdb.gz looking for model 1 # Found a chain break before 168 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS5.pdb.gz looking for model 1 # Found a chain break before 183 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 171 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 175 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 220 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS1.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS2.pdb.gz looking for model 1 WARNING: atom 1 has residue number 83 < previous residue 229 in servers/POMYSL_TS2.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation POMYSL_TS2 # ReadConformPDB reading from PDB file servers/POMYSL_TS3.pdb.gz looking for model 1 # Found a chain break before 180 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS3 # ReadConformPDB reading from PDB file servers/POMYSL_TS4.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS4 # ReadConformPDB reading from PDB file servers/POMYSL_TS5.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # Found a chain break before 130 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # Found a chain break before 131 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 218 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 172 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 201 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 210 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 216 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 227 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 81 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 98 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 208 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 131 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 140 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)A6.CA and (T0344)A6.CB only 0.000 apart, marking (T0344)A6.CB as missing WARNING: atoms too close: (T0344)T16.CA and (T0344)T16.CB only 0.000 apart, marking (T0344)T16.CB as missing WARNING: atoms too close: (T0344)E18.CA and (T0344)E18.CB only 0.000 apart, marking (T0344)E18.CB as missing WARNING: atoms too close: (T0344)Y34.CA and (T0344)Y34.CB only 0.000 apart, marking (T0344)Y34.CB as missing WARNING: atoms too close: (T0344)A37.CA and (T0344)A37.CB only 0.000 apart, marking (T0344)A37.CB as missing WARNING: atoms too close: (T0344)R55.CA and (T0344)R55.CB only 0.000 apart, marking (T0344)R55.CB as missing WARNING: atoms too close: (T0344)E67.CA and (T0344)E67.CB only 0.000 apart, marking (T0344)E67.CB as missing WARNING: atoms too close: (T0344)P74.CA and (T0344)P74.CB only 0.000 apart, marking (T0344)P74.CB as missing WARNING: atoms too close: (T0344)D75.CA and (T0344)D75.CB only 0.000 apart, marking (T0344)D75.CB as missing WARNING: atoms too close: (T0344)V76.CA and (T0344)V76.CB only 0.000 apart, marking (T0344)V76.CB as missing WARNING: atoms too close: (T0344)L88.CA and (T0344)L88.CB only 0.000 apart, marking (T0344)L88.CB as missing WARNING: atoms too close: (T0344)R89.CA and (T0344)R89.CB only 0.000 apart, marking (T0344)R89.CB as missing WARNING: atoms too close: (T0344)L99.CA and (T0344)L99.CB only 0.000 apart, marking (T0344)L99.CB as missing WARNING: atoms too close: (T0344)V108.CA and (T0344)V108.CB only 0.000 apart, marking (T0344)V108.CB as missing WARNING: atoms too close: (T0344)W109.CA and (T0344)W109.CB only 0.000 apart, marking (T0344)W109.CB as missing WARNING: atoms too close: (T0344)L119.CA and (T0344)L119.CB only 0.000 apart, marking (T0344)L119.CB as missing WARNING: atoms too close: (T0344)K136.CA and (T0344)K136.CB only 0.000 apart, marking (T0344)K136.CB as missing WARNING: atoms too close: (T0344)S138.CA and (T0344)S138.CB only 0.000 apart, marking (T0344)S138.CB as missing WARNING: atoms too close: (T0344)V139.CA and (T0344)V139.CB only 0.000 apart, marking (T0344)V139.CB as missing WARNING: atoms too close: (T0344)A153.CA and (T0344)A153.CB only 0.000 apart, marking (T0344)A153.CB as missing WARNING: atoms too close: (T0344)W155.CA and (T0344)W155.CB only 0.000 apart, marking (T0344)W155.CB as missing WARNING: atoms too close: (T0344)V160.CA and (T0344)V160.CB only 0.000 apart, marking (T0344)V160.CB as missing WARNING: atoms too close: (T0344)H165.CA and (T0344)H165.CB only 0.000 apart, marking (T0344)H165.CB as missing WARNING: atoms too close: (T0344)L170.CA and (T0344)L170.CB only 0.000 apart, marking (T0344)L170.CB as missing WARNING: atoms too close: (T0344)I183.CA and (T0344)I183.CB only 0.000 apart, marking (T0344)I183.CB as missing WARNING: atoms too close: (T0344)S187.CA and (T0344)S187.CB only 0.000 apart, marking (T0344)S187.CB as missing WARNING: atoms too close: (T0344)P204.CA and (T0344)P204.CB only 0.000 apart, marking (T0344)P204.CB as missing WARNING: atoms too close: (T0344)F226.CA and (T0344)F226.CB only 0.000 apart, marking (T0344)F226.CB as missing WARNING: atoms too close: (T0344)K228.CA and (T0344)K228.CB only 0.000 apart, marking (T0344)K228.CB as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)M1.CA and (T0344)M1.CB only 0.000 apart, marking (T0344)M1.CB as missing WARNING: atoms too close: (T0344)V4.CA and (T0344)V4.CB only 0.000 apart, marking (T0344)V4.CB as missing WARNING: atoms too close: (T0344)A5.CA and (T0344)A5.CB only 0.000 apart, marking (T0344)A5.CB as missing WARNING: atoms too close: (T0344)A6.CA and (T0344)A6.CB only 0.000 apart, marking (T0344)A6.CB as missing WARNING: atoms too close: (T0344)T8.CA and (T0344)T8.CB only 0.000 apart, marking (T0344)T8.CB as missing WARNING: atoms too close: (T0344)V12.CA and (T0344)V12.CB only 0.000 apart, marking (T0344)V12.CB as missing WARNING: atoms too close: (T0344)L13.CA and (T0344)L13.CB only 0.000 apart, marking (T0344)L13.CB as missing WARNING: atoms too close: (T0344)D14.CA and (T0344)D14.CB only 0.000 apart, marking (T0344)D14.CB as missing WARNING: atoms too close: (T0344)E15.CA and (T0344)E15.CB only 0.000 apart, marking (T0344)E15.CB as missing WARNING: atoms too close: (T0344)T16.CA and (T0344)T16.CB only 0.000 apart, marking (T0344)T16.CB as missing WARNING: atoms too close: (T0344)F17.CA and (T0344)F17.CB only 0.000 apart, marking (T0344)F17.CB as missing WARNING: atoms too close: (T0344)E18.CA and (T0344)E18.CB only 0.000 apart, marking (T0344)E18.CB as missing WARNING: atoms too close: (T0344)P19.CA and (T0344)P19.CB only 0.000 apart, marking (T0344)P19.CB as missing WARNING: atoms too close: (T0344)I20.CA and (T0344)I20.CB only 0.000 apart, marking (T0344)I20.CB as missing WARNING: atoms too close: (T0344)L22.CA and (T0344)L22.CB only 0.000 apart, marking (T0344)L22.CB as missing WARNING: atoms too close: (T0344)I23.CA and (T0344)I23.CB only 0.000 apart, marking (T0344)I23.CB as missing WARNING: atoms too close: (T0344)T25.CA and (T0344)T25.CB only 0.000 apart, marking (T0344)T25.CB as missing WARNING: atoms too close: (T0344)V26.CA and (T0344)V26.CB only 0.000 apart, marking (T0344)V26.CB as missing WARNING: atoms too close: (T0344)L29.CA and (T0344)L29.CB only 0.000 apart, marking (T0344)L29.CB as missing WARNING: atoms too close: (T0344)K32.CA and (T0344)K32.CB only 0.000 apart, marking (T0344)K32.CB as missing WARNING: atoms too close: (T0344)Y34.CA and (T0344)Y34.CB only 0.000 apart, marking (T0344)Y34.CB as missing WARNING: atoms too close: (T0344)R35.CA and (T0344)R35.CB only 0.000 apart, marking (T0344)R35.CB as missing WARNING: atoms too close: (T0344)S36.CA and (T0344)S36.CB only 0.000 apart, marking (T0344)S36.CB as missing WARNING: atoms too close: (T0344)A37.CA and (T0344)A37.CB only 0.000 apart, marking (T0344)A37.CB as missing WARNING: atoms too close: (T0344)K43.CA and (T0344)K43.CB only 0.000 apart, marking (T0344)K43.CB as missing WARNING: atoms too close: (T0344)A45.CA and (T0344)A45.CB only 0.000 apart, marking (T0344)A45.CB as missing WARNING: atoms too close: (T0344)P47.CA and (T0344)P47.CB only 0.000 apart, marking (T0344)P47.CB as missing WARNING: atoms too close: (T0344)D51.CA and (T0344)D51.CB only 0.000 apart, marking (T0344)D51.CB as missing WARNING: atoms too close: (T0344)L52.CA and (T0344)L52.CB only 0.000 apart, marking (T0344)L52.CB as missing WARNING: atoms too close: (T0344)Q56.CA and (T0344)Q56.CB only 0.000 apart, marking (T0344)Q56.CB as missing WARNING: atoms too close: (T0344)A57.CA and (T0344)A57.CB only 0.000 apart, marking (T0344)A57.CB as missing WARNING: atoms too close: (T0344)R59.CA and (T0344)R59.CB only 0.000 apart, marking (T0344)R59.CB as missing WARNING: atoms too close: (T0344)V62.CA and (T0344)V62.CB only 0.000 apart, marking (T0344)V62.CB as missing WARNING: atoms too close: (T0344)I66.CA and (T0344)I66.CB only 0.000 apart, marking (T0344)I66.CB as missing WARNING: atoms too close: (T0344)L68.CA and (T0344)L68.CB only 0.000 apart, marking (T0344)L68.CB as missing WARNING: atoms too close: (T0344)A69.CA and (T0344)A69.CB only 0.000 apart, marking (T0344)A69.CB as missing WARNING: atoms too close: (T0344)R70.CA and (T0344)R70.CB only 0.000 apart, marking (T0344)R70.CB as missing WARNING: atoms too close: (T0344)P74.CA and (T0344)P74.CB only 0.000 apart, marking (T0344)P74.CB as missing WARNING: atoms too close: (T0344)D75.CA and (T0344)D75.CB only 0.000 apart, marking (T0344)D75.CB as missing WARNING: atoms too close: (T0344)V76.CA and (T0344)V76.CB only 0.000 apart, marking (T0344)V76.CB as missing WARNING: atoms too close: (T0344)I77.CA and (T0344)I77.CB only 0.000 apart, marking (T0344)I77.CB as missing WARNING: atoms too close: (T0344)H78.CA and (T0344)H78.CB only 0.000 apart, marking (T0344)H78.CB as missing WARNING: atoms too close: (T0344)L79.CA and (T0344)L79.CB only 0.000 apart, marking (T0344)L79.CB as missing WARNING: atoms too close: (T0344)D80.CA and (T0344)D80.CB only 0.000 apart, marking (T0344)D80.CB as missing WARNING: atoms too close: (T0344)E87.CA and (T0344)E87.CB only 0.000 apart, marking (T0344)E87.CB as missing WARNING: atoms too close: (T0344)L88.CA and (T0344)L88.CB only 0.000 apart, marking (T0344)L88.CB as missing WARNING: atoms too close: (T0344)K90.CA and (T0344)K90.CB only 0.000 apart, marking (T0344)K90.CB as missing WARNING: atoms too close: (T0344)D92.CA and (T0344)D92.CB only 0.000 apart, marking (T0344)D92.CB as missing WARNING: atoms too close: (T0344)L99.CA and (T0344)L99.CB only 0.000 apart, marking (T0344)L99.CB as missing WARNING: atoms too close: (T0344)E107.CA and (T0344)E107.CB only 0.000 apart, marking (T0344)E107.CB as missing WARNING: atoms too close: (T0344)V108.CA and (T0344)V108.CB only 0.000 apart, marking (T0344)V108.CB as missing WARNING: atoms too close: (T0344)W109.CA and (T0344)W109.CB only 0.000 apart, marking (T0344)W109.CB as missing WARNING: atoms too close: (T0344)E111.CA and (T0344)E111.CB only 0.000 apart, marking (T0344)E111.CB as missing WARNING: atoms too close: (T0344)L112.CA and (T0344)L112.CB only 0.000 apart, marking (T0344)L112.CB as missing WARNING: atoms too close: (T0344)S113.CA and (T0344)S113.CB only 0.000 apart, marking (T0344)S113.CB as missing WARNING: atoms too close: (T0344)K114.CA and (T0344)K114.CB only 0.000 apart, marking (T0344)K114.CB as missing WARNING: atoms too close: (T0344)L116.CA and (T0344)L116.CB only 0.000 apart, marking (T0344)L116.CB as missing WARNING: atoms too close: (T0344)Q117.CA and (T0344)Q117.CB only 0.000 apart, marking (T0344)Q117.CB as missing WARNING: atoms too close: (T0344)P118.CA and (T0344)P118.CB only 0.000 apart, marking (T0344)P118.CB as missing WARNING: atoms too close: (T0344)W124.CA and (T0344)W124.CB only 0.000 apart, marking (T0344)W124.CB as missing WARNING: atoms too close: (T0344)T127.CA and (T0344)T127.CB only 0.000 apart, marking (T0344)T127.CB as missing WARNING: atoms too close: (T0344)N128.CA and (T0344)N128.CB only 0.000 apart, marking (T0344)N128.CB as missing WARNING: atoms too close: (T0344)I129.CA and (T0344)I129.CB only 0.000 apart, marking (T0344)I129.CB as missing WARNING: atoms too close: (T0344)I131.CA and (T0344)I131.CB only 0.000 apart, marking (T0344)I131.CB as missing WARNING: atoms too close: (T0344)V132.CA and (T0344)V132.CB only 0.000 apart, marking (T0344)V132.CB as missing WARNING: atoms too close: (T0344)A133.CA and (T0344)A133.CB only 0.000 apart, marking (T0344)A133.CB as missing WARNING: atoms too close: (T0344)I134.CA and (T0344)I134.CB only 0.000 apart, marking (T0344)I134.CB as missing WARNING: atoms too close: (T0344)K136.CA and (T0344)K136.CB only 0.000 apart, marking (T0344)K136.CB as missing WARNING: atoms too close: (T0344)S138.CA and (T0344)S138.CB only 0.000 apart, marking (T0344)S138.CB as missing WARNING: atoms too close: (T0344)V139.CA and (T0344)V139.CB only 0.000 apart, marking (T0344)V139.CB as missing WARNING: atoms too close: (T0344)P140.CA and (T0344)P140.CB only 0.000 apart, marking (T0344)P140.CB as missing WARNING: atoms too close: (T0344)I143.CA and (T0344)I143.CB only 0.000 apart, marking (T0344)I143.CB as missing WARNING: atoms too close: (T0344)E145.CA and (T0344)E145.CB only 0.000 apart, marking (T0344)E145.CB as missing WARNING: atoms too close: (T0344)I146.CA and (T0344)I146.CB only 0.000 apart, marking (T0344)I146.CB as missing WARNING: atoms too close: (T0344)Y147.CA and (T0344)Y147.CB only 0.000 apart, marking (T0344)Y147.CB as missing WARNING: atoms too close: (T0344)A148.CA and (T0344)A148.CB only 0.000 apart, marking (T0344)A148.CB as missing WARNING: atoms too close: (T0344)I150.CA and (T0344)I150.CB only 0.000 apart, marking (T0344)I150.CB as missing WARNING: atoms too close: (T0344)Y151.CA and (T0344)Y151.CB only 0.000 apart, marking (T0344)Y151.CB as missing WARNING: atoms too close: (T0344)S152.CA and (T0344)S152.CB only 0.000 apart, marking (T0344)S152.CB as missing WARNING: atoms too close: (T0344)A153.CA and (T0344)A153.CB only 0.000 apart, marking (T0344)A153.CB as missing WARNING: atoms too close: (T0344)E158.CA and (T0344)E158.CB only 0.000 apart, marking (T0344)E158.CB as missing WARNING: atoms too close: (T0344)V160.CA and (T0344)V160.CB only 0.000 apart, marking (T0344)V160.CB as missing WARNING: atoms too close: (T0344)E161.CA and (T0344)E161.CB only 0.000 apart, marking (T0344)E161.CB as missing WARNING: atoms too close: (T0344)K162.CA and (T0344)K162.CB only 0.000 apart, marking (T0344)K162.CB as missing WARNING: atoms too close: (T0344)E163.CA and (T0344)E163.CB only 0.000 apart, marking (T0344)E163.CB as missing WARNING: atoms too close: (T0344)H165.CA and (T0344)H165.CB only 0.000 apart, marking (T0344)H165.CB as missing WARNING: atoms too close: (T0344)L170.CA and (T0344)L170.CB only 0.000 apart, marking (T0344)L170.CB as missing WARNING: atoms too close: (T0344)P171.CA and (T0344)P171.CB only 0.000 apart, marking (T0344)P171.CB as missing WARNING: atoms too close: (T0344)R172.CA and (T0344)R172.CB only 0.000 apart, marking (T0344)R172.CB as missing WARNING: atoms too close: (T0344)E175.CA and (T0344)E175.CB only 0.000 apart, marking (T0344)E175.CB as missing WARNING: atoms too close: (T0344)V176.CA and (T0344)V176.CB only 0.000 apart, marking (T0344)V176.CB as missing WARNING: atoms too close: (T0344)I178.CA and (T0344)I178.CB only 0.000 apart, marking (T0344)I178.CB as missing WARNING: atoms too close: (T0344)K182.CA and (T0344)K182.CB only 0.000 apart, marking (T0344)K182.CB as missing WARNING: atoms too close: (T0344)I184.CA and (T0344)I184.CB only 0.000 apart, marking (T0344)I184.CB as missing WARNING: atoms too close: (T0344)R186.CA and (T0344)R186.CB only 0.000 apart, marking (T0344)R186.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)P190.CB only 0.000 apart, marking (T0344)P190.CB as missing WARNING: atoms too close: (T0344)R191.CA and (T0344)R191.CB only 0.000 apart, marking (T0344)R191.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)V203.CA and (T0344)V203.CB only 0.000 apart, marking (T0344)V203.CB as missing WARNING: atoms too close: (T0344)K208.CA and (T0344)K208.CB only 0.000 apart, marking (T0344)K208.CB as missing WARNING: atoms too close: (T0344)E210.CA and (T0344)E210.CB only 0.000 apart, marking (T0344)E210.CB as missing WARNING: atoms too close: (T0344)Y212.CA and (T0344)Y212.CB only 0.000 apart, marking (T0344)Y212.CB as missing WARNING: atoms too close: (T0344)N214.CA and (T0344)N214.CB only 0.000 apart, marking (T0344)N214.CB as missing WARNING: atoms too close: (T0344)P215.CA and (T0344)P215.CB only 0.000 apart, marking (T0344)P215.CB as missing WARNING: atoms too close: (T0344)V216.CA and (T0344)V216.CB only 0.000 apart, marking (T0344)V216.CB as missing WARNING: atoms too close: (T0344)A217.CA and (T0344)A217.CB only 0.000 apart, marking (T0344)A217.CB as missing WARNING: atoms too close: (T0344)R218.CA and (T0344)R218.CB only 0.000 apart, marking (T0344)R218.CB as missing WARNING: atoms too close: (T0344)F220.CA and (T0344)F220.CB only 0.000 apart, marking (T0344)F220.CB as missing WARNING: atoms too close: (T0344)M221.CA and (T0344)M221.CB only 0.000 apart, marking (T0344)M221.CB as missing WARNING: atoms too close: (T0344)F223.CA and (T0344)F223.CB only 0.000 apart, marking (T0344)F223.CB as missing WARNING: atoms too close: (T0344)E224.CA and (T0344)E224.CB only 0.000 apart, marking (T0344)E224.CB as missing WARNING: atoms too close: (T0344)I225.CA and (T0344)I225.CB only 0.000 apart, marking (T0344)I225.CB as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)D7.CA and (T0344)D7.CB only 0.000 apart, marking (T0344)D7.CB as missing WARNING: atoms too close: (T0344)V12.CA and (T0344)V12.CB only 0.000 apart, marking (T0344)V12.CB as missing WARNING: atoms too close: (T0344)T16.CA and (T0344)T16.CB only 0.000 apart, marking (T0344)T16.CB as missing WARNING: atoms too close: (T0344)I20.CA and (T0344)I20.CB only 0.000 apart, marking (T0344)I20.CB as missing WARNING: atoms too close: (T0344)E31.CA and (T0344)E31.CB only 0.000 apart, marking (T0344)E31.CB as missing WARNING: atoms too close: (T0344)Y44.CA and (T0344)Y44.CB only 0.000 apart, marking (T0344)Y44.CB as missing WARNING: atoms too close: (T0344)A45.CA and (T0344)A45.CB only 0.000 apart, marking (T0344)A45.CB as missing WARNING: atoms too close: (T0344)Y50.CA and (T0344)Y50.CB only 0.000 apart, marking (T0344)Y50.CB as missing WARNING: atoms too close: (T0344)E61.CA and (T0344)E61.CB only 0.000 apart, marking (T0344)E61.CB as missing WARNING: atoms too close: (T0344)E67.CA and (T0344)E67.CB only 0.000 apart, marking (T0344)E67.CB as missing WARNING: atoms too close: (T0344)P74.CA and (T0344)P74.CB only 0.000 apart, marking (T0344)P74.CB as missing WARNING: atoms too close: (T0344)H78.CA and (T0344)H78.CB only 0.000 apart, marking (T0344)H78.CB as missing WARNING: atoms too close: (T0344)D92.CA and (T0344)D92.CB only 0.000 apart, marking (T0344)D92.CB as missing WARNING: atoms too close: (T0344)K106.CA and (T0344)K106.CB only 0.000 apart, marking (T0344)K106.CB as missing WARNING: atoms too close: (T0344)V108.CA and (T0344)V108.CB only 0.000 apart, marking (T0344)V108.CB as missing WARNING: atoms too close: (T0344)W109.CA and (T0344)W109.CB only 0.000 apart, marking (T0344)W109.CB as missing WARNING: atoms too close: (T0344)E111.CA and (T0344)E111.CB only 0.000 apart, marking (T0344)E111.CB as missing WARNING: atoms too close: (T0344)Q117.CA and (T0344)Q117.CB only 0.000 apart, marking (T0344)Q117.CB as missing WARNING: atoms too close: (T0344)L119.CA and (T0344)L119.CB only 0.000 apart, marking (T0344)L119.CB as missing WARNING: atoms too close: (T0344)W124.CA and (T0344)W124.CB only 0.000 apart, marking (T0344)W124.CB as missing WARNING: atoms too close: (T0344)V132.CA and (T0344)V132.CB only 0.000 apart, marking (T0344)V132.CB as missing WARNING: atoms too close: (T0344)S138.CA and (T0344)S138.CB only 0.000 apart, marking (T0344)S138.CB as missing WARNING: atoms too close: (T0344)V139.CA and (T0344)V139.CB only 0.000 apart, marking (T0344)V139.CB as missing WARNING: atoms too close: (T0344)V141.CA and (T0344)V141.CB only 0.000 apart, marking (T0344)V141.CB as missing WARNING: atoms too close: (T0344)I143.CA and (T0344)I143.CB only 0.000 apart, marking (T0344)I143.CB as missing WARNING: atoms too close: (T0344)W155.CA and (T0344)W155.CB only 0.000 apart, marking (T0344)W155.CB as missing WARNING: atoms too close: (T0344)V160.CA and (T0344)V160.CB only 0.000 apart, marking (T0344)V160.CB as missing WARNING: atoms too close: (T0344)H165.CA and (T0344)H165.CB only 0.000 apart, marking (T0344)H165.CB as missing WARNING: atoms too close: (T0344)L166.CA and (T0344)L166.CB only 0.000 apart, marking (T0344)L166.CB as missing WARNING: atoms too close: (T0344)L170.CA and (T0344)L170.CB only 0.000 apart, marking (T0344)L170.CB as missing WARNING: atoms too close: (T0344)I183.CA and (T0344)I183.CB only 0.000 apart, marking (T0344)I183.CB as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)L188.CB only 0.000 apart, marking (T0344)L188.CB as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)L195.CB only 0.000 apart, marking (T0344)L195.CB as missing WARNING: atoms too close: (T0344)P204.CA and (T0344)P204.CB only 0.000 apart, marking (T0344)P204.CB as missing WARNING: atoms too close: (T0344)W209.CA and (T0344)W209.CB only 0.000 apart, marking (T0344)W209.CB as missing WARNING: atoms too close: (T0344)P213.CA and (T0344)P213.CB only 0.000 apart, marking (T0344)P213.CB as missing WARNING: atoms too close: (T0344)F220.CA and (T0344)F220.CB only 0.000 apart, marking (T0344)F220.CB as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)R2.CA and (T0344)R2.CB only 0.000 apart, marking (T0344)R2.CB as missing WARNING: atoms too close: (T0344)A5.CA and (T0344)A5.CB only 0.000 apart, marking (T0344)A5.CB as missing WARNING: atoms too close: (T0344)A11.CA and (T0344)A11.CB only 0.000 apart, marking (T0344)A11.CB as missing WARNING: atoms too close: (T0344)L13.CA and (T0344)L13.CB only 0.000 apart, marking (T0344)L13.CB as missing WARNING: atoms too close: (T0344)D14.CA and (T0344)D14.CB only 0.000 apart, marking (T0344)D14.CB as missing WARNING: atoms too close: (T0344)P19.CA and (T0344)P19.CB only 0.000 apart, marking (T0344)P19.CB as missing WARNING: atoms too close: (T0344)T25.CA and (T0344)T25.CB only 0.000 apart, marking (T0344)T25.CB as missing WARNING: atoms too close: (T0344)A27.CA and (T0344)A27.CB only 0.000 apart, marking (T0344)A27.CB as missing WARNING: atoms too close: (T0344)V30.CA and (T0344)V30.CB only 0.000 apart, marking (T0344)V30.CB as missing WARNING: atoms too close: (T0344)E31.CA and (T0344)E31.CB only 0.000 apart, marking (T0344)E31.CB as missing WARNING: atoms too close: (T0344)P47.CA and (T0344)P47.CB only 0.000 apart, marking (T0344)P47.CB as missing WARNING: atoms too close: (T0344)Y50.CA and (T0344)Y50.CB only 0.000 apart, marking (T0344)Y50.CB as missing WARNING: atoms too close: (T0344)D51.CA and (T0344)D51.CB only 0.000 apart, marking (T0344)D51.CB as missing WARNING: atoms too close: (T0344)A57.CA and (T0344)A57.CB only 0.000 apart, marking (T0344)A57.CB as missing WARNING: atoms too close: (T0344)L63.CA and (T0344)L63.CB only 0.000 apart, marking (T0344)L63.CB as missing WARNING: atoms too close: (T0344)L79.CA and (T0344)L79.CB only 0.000 apart, marking (T0344)L79.CB as missing WARNING: atoms too close: (T0344)D80.CA and (T0344)D80.CB only 0.000 apart, marking (T0344)D80.CB as missing WARNING: atoms too close: (T0344)L88.CA and (T0344)L88.CB only 0.000 apart, marking (T0344)L88.CB as missing WARNING: atoms too close: (T0344)D103.CA and (T0344)D103.CB only 0.000 apart, marking (T0344)D103.CB as missing WARNING: atoms too close: (T0344)V108.CA and (T0344)V108.CB only 0.000 apart, marking (T0344)V108.CB as missing WARNING: atoms too close: (T0344)T127.CA and (T0344)T127.CB only 0.000 apart, marking (T0344)T127.CB as missing WARNING: atoms too close: (T0344)P140.CA and (T0344)P140.CB only 0.000 apart, marking (T0344)P140.CB as missing WARNING: atoms too close: (T0344)V141.CA and (T0344)V141.CB only 0.000 apart, marking (T0344)V141.CB as missing WARNING: atoms too close: (T0344)E145.CA and (T0344)E145.CB only 0.000 apart, marking (T0344)E145.CB as missing WARNING: atoms too close: (T0344)Y147.CA and (T0344)Y147.CB only 0.000 apart, marking (T0344)Y147.CB as missing WARNING: atoms too close: (T0344)I150.CA and (T0344)I150.CB only 0.000 apart, marking (T0344)I150.CB as missing WARNING: atoms too close: (T0344)K154.CA and (T0344)K154.CB only 0.000 apart, marking (T0344)K154.CB as missing WARNING: atoms too close: (T0344)W155.CA and (T0344)W155.CB only 0.000 apart, marking (T0344)W155.CB as missing WARNING: atoms too close: (T0344)I157.CA and (T0344)I157.CB only 0.000 apart, marking (T0344)I157.CB as missing WARNING: atoms too close: (T0344)E161.CA and (T0344)E161.CB only 0.000 apart, marking (T0344)E161.CB as missing WARNING: atoms too close: (T0344)L166.CA and (T0344)L166.CB only 0.000 apart, marking (T0344)L166.CB as missing WARNING: atoms too close: (T0344)L170.CA and (T0344)L170.CB only 0.000 apart, marking (T0344)L170.CB as missing WARNING: atoms too close: (T0344)V176.CA and (T0344)V176.CB only 0.000 apart, marking (T0344)V176.CB as missing WARNING: atoms too close: (T0344)N177.CA and (T0344)N177.CB only 0.000 apart, marking (T0344)N177.CB as missing WARNING: atoms too close: (T0344)D180.CA and (T0344)D180.CB only 0.000 apart, marking (T0344)D180.CB as missing WARNING: atoms too close: (T0344)K228.CA and (T0344)K228.CB only 0.000 apart, marking (T0344)K228.CB as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)A11.CA and (T0344)A11.CB only 0.000 apart, marking (T0344)A11.CB as missing WARNING: atoms too close: (T0344)D14.CA and (T0344)D14.CB only 0.000 apart, marking (T0344)D14.CB as missing WARNING: atoms too close: (T0344)T16.CA and (T0344)T16.CB only 0.000 apart, marking (T0344)T16.CB as missing WARNING: atoms too close: (T0344)F17.CA and (T0344)F17.CB only 0.000 apart, marking (T0344)F17.CB as missing WARNING: atoms too close: (T0344)I20.CA and (T0344)I20.CB only 0.000 apart, marking (T0344)I20.CB as missing WARNING: atoms too close: (T0344)A24.CA and (T0344)A24.CB only 0.000 apart, marking (T0344)A24.CB as missing WARNING: atoms too close: (T0344)V42.CA and (T0344)V42.CB only 0.000 apart, marking (T0344)V42.CB as missing WARNING: atoms too close: (T0344)Y50.CA and (T0344)Y50.CB only 0.000 apart, marking (T0344)Y50.CB as missing WARNING: atoms too close: (T0344)P74.CA and (T0344)P74.CB only 0.000 apart, marking (T0344)P74.CB as missing WARNING: atoms too close: (T0344)D75.CA and (T0344)D75.CB only 0.000 apart, marking (T0344)D75.CB as missing WARNING: atoms too close: (T0344)H78.CA and (T0344)H78.CB only 0.000 apart, marking (T0344)H78.CB as missing WARNING: atoms too close: (T0344)D97.CA and (T0344)D97.CB only 0.000 apart, marking (T0344)D97.CB as missing WARNING: atoms too close: (T0344)L99.CA and (T0344)L99.CB only 0.000 apart, marking (T0344)L99.CB as missing WARNING: atoms too close: (T0344)W109.CA and (T0344)W109.CB only 0.000 apart, marking (T0344)W109.CB as missing WARNING: atoms too close: (T0344)L112.CA and (T0344)L112.CB only 0.000 apart, marking (T0344)L112.CB as missing WARNING: atoms too close: (T0344)Q117.CA and (T0344)Q117.CB only 0.000 apart, marking (T0344)Q117.CB as missing WARNING: atoms too close: (T0344)W124.CA and (T0344)W124.CB only 0.000 apart, marking (T0344)W124.CB as missing WARNING: atoms too close: (T0344)I134.CA and (T0344)I134.CB only 0.000 apart, marking (T0344)I134.CB as missing WARNING: atoms too close: (T0344)S138.CA and (T0344)S138.CB only 0.000 apart, marking (T0344)S138.CB as missing WARNING: atoms too close: (T0344)V139.CA and (T0344)V139.CB only 0.000 apart, marking (T0344)V139.CB as missing WARNING: atoms too close: (T0344)P140.CA and (T0344)P140.CB only 0.000 apart, marking (T0344)P140.CB as missing WARNING: atoms too close: (T0344)V141.CA and (T0344)V141.CB only 0.000 apart, marking (T0344)V141.CB as missing WARNING: atoms too close: (T0344)I143.CA and (T0344)I143.CB only 0.000 apart, marking (T0344)I143.CB as missing WARNING: atoms too close: (T0344)L166.CA and (T0344)L166.CB only 0.000 apart, marking (T0344)L166.CB as missing WARNING: atoms too close: (T0344)L170.CA and (T0344)L170.CB only 0.000 apart, marking (T0344)L170.CB as missing WARNING: atoms too close: (T0344)K179.CA and (T0344)K179.CB only 0.000 apart, marking (T0344)K179.CB as missing WARNING: atoms too close: (T0344)I183.CA and (T0344)I183.CB only 0.000 apart, marking (T0344)I183.CB as missing WARNING: atoms too close: (T0344)E192.CA and (T0344)E192.CB only 0.000 apart, marking (T0344)E192.CB as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)S198.CB only 0.000 apart, marking (T0344)S198.CB as missing WARNING: atoms too close: (T0344)A199.CA and (T0344)A199.CB only 0.000 apart, marking (T0344)A199.CB as missing WARNING: atoms too close: (T0344)F226.CA and (T0344)F226.CB only 0.000 apart, marking (T0344)F226.CB as missing WARNING: atoms too close: (T0344)R229.CA and (T0344)R229.CB only 0.000 apart, marking (T0344)R229.CB as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 Skipped atom 158, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL2.pdb.gz Skipped atom 160, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL2.pdb.gz Skipped atom 162, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL2.pdb.gz Skipped atom 164, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL2.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 Skipped atom 66, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 68, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 70, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 72, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 146, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 148, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 150, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 152, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 172 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 218 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 145 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 181 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 137 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 183 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 203 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 169 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 171 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 130 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 177 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 182 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)I129.CA and (T0344)V139.CA only 0.000 apart, marking (T0344)V139.CA as missing WARNING: atoms too close: (T0344)V176.CA and (T0344)K182.CA only 0.000 apart, marking (T0344)K182.CA as missing WARNING: atoms too close: (T0344)L188.CA and (T0344)A199.CA only 0.000 apart, marking (T0344)L188.CA as missing WARNING: atoms too close: (T0344)D189.N and (T0344)E200.N only 0.000 apart, marking (T0344)E200.N as missing WARNING: atoms too close: (T0344)D189.CA and (T0344)E200.CA only 0.000 apart, marking (T0344)E200.CA as missing WARNING: atoms too close: (T0344)D189.CB and (T0344)E200.CB only 0.000 apart, marking (T0344)E200.CB as missing WARNING: atoms too close: (T0344)D189.O and (T0344)E200.O only 0.000 apart, marking (T0344)E200.O as missing WARNING: atoms too close: (T0344)D189.C and (T0344)E200.C only 0.000 apart, marking (T0344)E200.C as missing WARNING: atoms too close: (T0344)P190.N and (T0344)P204.N only 0.000 apart, marking (T0344)P204.N as missing WARNING: atoms too close: (T0344)P190.CA and (T0344)P204.CA only 0.000 apart, marking (T0344)P204.CA as missing WARNING: atoms too close: (T0344)P190.CB and (T0344)P204.CB only 0.000 apart, marking (T0344)P204.CB as missing WARNING: atoms too close: (T0344)P190.C and (T0344)P204.C only 0.000 apart, marking (T0344)P204.C as missing WARNING: atoms too close: (T0344)G193.CA and (T0344)E205.CA only 0.000 apart, marking (T0344)E205.CA as missing WARNING: atoms too close: (T0344)G194.CA and (T0344)G206.CA only 0.000 apart, marking (T0344)G206.CA as missing WARNING: atoms too close: (T0344)L195.CA and (T0344)K208.CA only 0.000 apart, marking (T0344)K208.CA as missing WARNING: atoms too close: (T0344)Y196.N and (T0344)W209.N only 0.000 apart, marking (T0344)W209.N as missing WARNING: atoms too close: (T0344)Y196.CA and (T0344)W209.CA only 0.000 apart, marking (T0344)W209.CA as missing WARNING: atoms too close: (T0344)Y196.CB and (T0344)W209.CB only 0.000 apart, marking (T0344)W209.CB as missing WARNING: atoms too close: (T0344)Y196.C and (T0344)W209.C only 0.000 apart, marking (T0344)W209.C as missing WARNING: atoms too close: (T0344)G197.CA and (T0344)E210.CA only 0.000 apart, marking (T0344)E210.CA as missing WARNING: atoms too close: (T0344)S198.CA and (T0344)I211.CA only 0.000 apart, marking (T0344)I211.CA as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 Skipped atom 286, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 288, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 290, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 292, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 294, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 296, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 298, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 300, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 302, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 304, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 306, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 308, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 586, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 588, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 590, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 592, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 598, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 600, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 602, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 604, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 638, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 640, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 642, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 644, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 670, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 672, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 674, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz Skipped atom 676, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL3.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 227 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 172 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 156 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)P140.O and (T0344)V141.N only 0.000 apart, marking (T0344)V141.N as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)Y44.O and (T0344)A45.N only 0.000 apart, marking (T0344)A45.N as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)Q117.O and (T0344)P118.N only 0.000 apart, marking (T0344)P118.N as missing WARNING: atoms too close: (T0344)K136.O and (T0344)S137.N only 0.000 apart, marking (T0344)S137.N as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # Found a chain break before 43 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 WARNING: atom 563 has residue number 19 < previous residue 120 in servers/mGen-3D_TS1.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 229 in servers/nFOLD_TS4.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 WARNING: atom 1 has residue number 21 < previous residue 229 in servers/nFOLD_TS5.pdb.gz # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/panther2_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0344)N128.N and (T0344)I129.N only 0.000 apart, marking (T0344)I129.N as missing WARNING: atoms too close: (T0344)N128.CA and (T0344)I129.CA only 0.000 apart, marking (T0344)I129.CA as missing WARNING: atoms too close: (T0344)N128.CB and (T0344)I129.CB only 0.000 apart, marking (T0344)I129.CB as missing WARNING: atoms too close: (T0344)N128.CG and (T0344)I129.CG1 only 0.000 apart, marking (T0344)I129.CG1 as missing WARNING: atoms too close: (T0344)N128.O and (T0344)I129.O only 0.000 apart, marking (T0344)I129.O as missing WARNING: atoms too close: (T0344)N128.C and (T0344)I129.C only 0.000 apart, marking (T0344)I129.C as missing # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation panther2_TS1 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0344 can't currently be optimized by undertaker # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score 2.3811 model score 2.2785 model score 1.5248 model score 1.3808 model score 1.2085 model score 1.9165 model score 1.8187 model score 1.1313 model score 1.9103 model score 1.5492 model score 2.0482 model score 1.0195 model score 1.8285 model score 1.6844 model score 1.9638 model score 2.1114 model score 1.9744 model score 1.9666 model score 2.0602 model score 1.5140 model score 1.8720 model score 1.8698 model score 1.3669 model score 1.5003 model score 2.0867 model score 1.3398 model score 2.3798 model score 1.1208 model score 1.3146 model score 1.7130 model score 1.8531 model score 1.8175 model score 1.6511 model score 2.6881 model score 1.8175 model score 1.6511 model score 1.8210 model score 1.8943 model score 1.9001 model score 1.2242 model score 1.7522 model score 1.9093 model score 2.0261 model score 0.9202 model score 1.4685 model score 1.0979 model score 1.0152 model score 1.4364 model score 2.3814 model score 1.4585 model score 1.1566 model score 1.5895 model score 1.3628 model score 1.2797 model score 1.2864 model score 1.2817 model score 1.2859 model score 1.2861 model score 1.2482 model score 0.9746 model score 0.9997 model score 0.9789 model score 1.9053 model score 1.4685 model score 1.0152 model score 0.9202 model score 0.9997 model score 0.9746 model score 1.7005 model score 1.7726 model score 2.2551 model score 1.8673 model score 2.6161 model score 1.2894 model score 1.2949 model score 1.2979 model score 1.2813 model score 1.3019 model score 1.2894 model score 1.2949 model score 1.2813 model score 1.3019 model score 1.2979 model score 2.2946 model score 1.9799 model score 2.2698 model score 2.3179 model score 1.8799 model score 1.9334 model score 1.5607 model score 2.0501 model score 2.1782 model score 1.2507 model score 1.2926 model score 1.2771 model score 1.2741 model score 1.2757 model score 1.2771 model score 1.6301 model score 1.7796 model score 1.8399 model score 2.1711 model score 2.2528 model score 1.1311 model score 1.9551 model score 1.7984 model score 0.8501 model score 1.7581 model score 1.4082 model score 1.4111 model score 1.4111 model score 1.4455 model score 2.1332 model score 1.3566 model score 1.5623 model score 2.3100 model score 1.9368 model score 1.3458 model score 1.1004 model score 2.1846 model score 1.1310 model score 1.2852 model score 1.5300 model score 1.4792 model score 2.0960 model score 1.4813 model score 1.2719 model score 2.2708 model score 1.2434 model score 1.0497 model score 1.1800 model score 0.7014 model score 0.7882 model score 0.7424 model score 0.7945 model score 0.8251 model score 1.7311 model score 1.5129 model score 1.3398 model score 2.0621 model score 1.4057 model score 1.9542 model score 2.1017 model score 2.1074 model score 2.0913 model score 2.0759 model score 2.1017 model score 1.9637 model score 1.9464 model score 1.9280 model score 2.1093 model score 2.1033 model score 1.1649 model score 1.1489 model score 2.0482 model score 2.0144 model score 2.0211 model score 1.9552 model score 2.1745 model score 2.0831 model score 2.1173 model score 2.0707 model score 2.1513 model score 1.5492 model score 1.8285 model score 1.9165 model score 1.8187 model score 2.0482 model score 1.4587 model score 1.4192 model score 1.4054 model score 1.5563 model score 1.2863 model score 1.0413 model score 1.3541 model score 1.7136 model score 1.7072 model score 2.1133 model score 1.0006 model score 1.3941 model score 1.6543 model score 1.6152 model score 2.1820 model score 1.2085 model score 1.8187 model score 1.1313 model score 1.9103 model score 1.5492 model score 1.8682 model score 1.4492 model score 1.8685 model score 1.7944 model score 1.7701 model score 1.2766 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2938 model score 1.8705 model score 0.7780 model score 1.2242 model score 0.9655 model score 0.8901 model score 1.4192 model score 1.4054 model score 1.4587 model score 1.9281 model score 1.4452 model score 0.9881 model score 1.2668 model score 1.4563 model score 2.3843 model score 1.2657 model score 2.2515 model score 1.2352 model score 1.9860 model score 2.0587 model score 2.5226 model score 1.2803 model score 1.2780 model score 1.2856 model score 1.3030 model score 1.2741 model score 1.6575 model score 1.2855 model score 1.2798 model score 1.2872 model score 1.2963 model score 1.2744 model score 0.9827 model score 1.1334 model score 1.0475 model score 1.2962 model score 2.0306 model score 1.3702 model score 1.0680 model score 1.2779 model score 1.2771 model score 1.2823 model score 1.2771 model score 1.2810 model score 0.8965 model score 0.9749 model score 1.7433 model score 1.9676 model score 2.0127 model score 2.3140 model score 2.3099 model score 2.3507 model score 2.4722 model score 2.5234 model score 2.1272 model score 1.6206 model score 2.1179 model score 1.7822 model score 0.8388 model score 2.1165 model score 2.0504 model score 1.7918 model score 2.0026 model score 1.9317 model score 2.3720 model score 1.7311 model score 1.8950 model score 1.6552 model score 1.5277 model score 2.4020 model score 1.4374 model score 0.8941 USE_META, weight: 0.2391 cost: 2.3811 min: 0.7014 max: 2.6881 USE_META, weight: 0.2856 cost: 2.2785 min: 0.7014 max: 2.6881 USE_META, weight: 0.6270 cost: 1.5248 min: 0.7014 max: 2.6881 USE_META, weight: 0.6922 cost: 1.3808 min: 0.7014 max: 2.6881 USE_META, weight: 0.7703 cost: 1.2085 min: 0.7014 max: 2.6881 USE_META, weight: 0.4496 cost: 1.9165 min: 0.7014 max: 2.6881 USE_META, weight: 0.4938 cost: 1.8187 min: 0.7014 max: 2.6881 USE_META, weight: 0.8053 cost: 1.1313 min: 0.7014 max: 2.6881 USE_META, weight: 0.4524 cost: 1.9103 min: 0.7014 max: 2.6881 USE_META, weight: 0.6159 cost: 1.5492 min: 0.7014 max: 2.6881 USE_META, weight: 0.3899 cost: 2.0482 min: 0.7014 max: 2.6881 USE_META, weight: 0.8559 cost: 1.0195 min: 0.7014 max: 2.6881 USE_META, weight: 0.4894 cost: 1.8285 min: 0.7014 max: 2.6881 USE_META, weight: 0.5547 cost: 1.6844 min: 0.7014 max: 2.6881 USE_META, weight: 0.4281 cost: 1.9638 min: 0.7014 max: 2.6881 USE_META, weight: 0.3613 cost: 2.1114 min: 0.7014 max: 2.6881 USE_META, weight: 0.4233 cost: 1.9744 min: 0.7014 max: 2.6881 USE_META, weight: 0.4269 cost: 1.9666 min: 0.7014 max: 2.6881 USE_META, weight: 0.3844 cost: 2.0602 min: 0.7014 max: 2.6881 USE_META, weight: 0.6319 cost: 1.5140 min: 0.7014 max: 2.6881 USE_META, weight: 0.4697 cost: 1.8720 min: 0.7014 max: 2.6881 USE_META, weight: 0.4707 cost: 1.8698 min: 0.7014 max: 2.6881 USE_META, weight: 0.6985 cost: 1.3669 min: 0.7014 max: 2.6881 USE_META, weight: 0.6381 cost: 1.5003 min: 0.7014 max: 2.6881 USE_META, weight: 0.3724 cost: 2.0867 min: 0.7014 max: 2.6881 USE_META, weight: 0.7108 cost: 1.3398 min: 0.7014 max: 2.6881 USE_META, weight: 0.2397 cost: 2.3798 min: 0.7014 max: 2.6881 USE_META, weight: 0.8100 cost: 1.1208 min: 0.7014 max: 2.6881 USE_META, weight: 0.7222 cost: 1.3146 min: 0.7014 max: 2.6881 USE_META, weight: 0.5417 cost: 1.7130 min: 0.7014 max: 2.6881 USE_META, weight: 0.4783 cost: 1.8531 min: 0.7014 max: 2.6881 USE_META, weight: 0.4944 cost: 1.8175 min: 0.7014 max: 2.6881 USE_META, weight: 0.5698 cost: 1.6511 min: 0.7014 max: 2.6881 USE_META, weight: 0.1000 cost: 2.6881 min: 0.7014 max: 2.6881 USE_META, weight: 0.4944 cost: 1.8175 min: 0.7014 max: 2.6881 USE_META, weight: 0.5698 cost: 1.6511 min: 0.7014 max: 2.6881 USE_META, weight: 0.4928 cost: 1.8210 min: 0.7014 max: 2.6881 USE_META, weight: 0.4596 cost: 1.8943 min: 0.7014 max: 2.6881 USE_META, weight: 0.4570 cost: 1.9001 min: 0.7014 max: 2.6881 USE_META, weight: 0.7631 cost: 1.2242 min: 0.7014 max: 2.6881 USE_META, weight: 0.5240 cost: 1.7522 min: 0.7014 max: 2.6881 USE_META, weight: 0.4528 cost: 1.9093 min: 0.7014 max: 2.6881 USE_META, weight: 0.3999 cost: 2.0261 min: 0.7014 max: 2.6881 USE_META, weight: 0.9009 cost: 0.9202 min: 0.7014 max: 2.6881 USE_META, weight: 0.6525 cost: 1.4685 min: 0.7014 max: 2.6881 USE_META, weight: 0.8204 cost: 1.0979 min: 0.7014 max: 2.6881 USE_META, weight: 0.8579 cost: 1.0152 min: 0.7014 max: 2.6881 USE_META, weight: 0.6670 cost: 1.4364 min: 0.7014 max: 2.6881 USE_META, weight: 0.2389 cost: 2.3814 min: 0.7014 max: 2.6881 USE_META, weight: 0.6570 cost: 1.4585 min: 0.7014 max: 2.6881 USE_META, weight: 0.7938 cost: 1.1566 min: 0.7014 max: 2.6881 USE_META, weight: 0.5977 cost: 1.5895 min: 0.7014 max: 2.6881 USE_META, weight: 0.7004 cost: 1.3628 min: 0.7014 max: 2.6881 USE_META, weight: 0.7380 cost: 1.2797 min: 0.7014 max: 2.6881 USE_META, weight: 0.7350 cost: 1.2864 min: 0.7014 max: 2.6881 USE_META, weight: 0.7371 cost: 1.2817 min: 0.7014 max: 2.6881 USE_META, weight: 0.7352 cost: 1.2859 min: 0.7014 max: 2.6881 USE_META, weight: 0.7351 cost: 1.2861 min: 0.7014 max: 2.6881 USE_META, weight: 0.7523 cost: 1.2482 min: 0.7014 max: 2.6881 USE_META, weight: 0.8762 cost: 0.9746 min: 0.7014 max: 2.6881 USE_META, weight: 0.8649 cost: 0.9997 min: 0.7014 max: 2.6881 USE_META, weight: 0.8743 cost: 0.9789 min: 0.7014 max: 2.6881 USE_META, weight: 0.4546 cost: 1.9053 min: 0.7014 max: 2.6881 USE_META, weight: 0.6525 cost: 1.4685 min: 0.7014 max: 2.6881 USE_META, weight: 0.8579 cost: 1.0152 min: 0.7014 max: 2.6881 USE_META, weight: 0.9009 cost: 0.9202 min: 0.7014 max: 2.6881 USE_META, weight: 0.8649 cost: 0.9997 min: 0.7014 max: 2.6881 USE_META, weight: 0.8762 cost: 0.9746 min: 0.7014 max: 2.6881 USE_META, weight: 0.5474 cost: 1.7005 min: 0.7014 max: 2.6881 USE_META, weight: 0.5147 cost: 1.7726 min: 0.7014 max: 2.6881 USE_META, weight: 0.2962 cost: 2.2551 min: 0.7014 max: 2.6881 USE_META, weight: 0.4718 cost: 1.8673 min: 0.7014 max: 2.6881 USE_META, weight: 0.1326 cost: 2.6161 min: 0.7014 max: 2.6881 USE_META, weight: 0.7336 cost: 1.2894 min: 0.7014 max: 2.6881 USE_META, weight: 0.7311 cost: 1.2949 min: 0.7014 max: 2.6881 USE_META, weight: 0.7298 cost: 1.2979 min: 0.7014 max: 2.6881 USE_META, weight: 0.7373 cost: 1.2813 min: 0.7014 max: 2.6881 USE_META, weight: 0.7280 cost: 1.3019 min: 0.7014 max: 2.6881 USE_META, weight: 0.7336 cost: 1.2894 min: 0.7014 max: 2.6881 USE_META, weight: 0.7311 cost: 1.2949 min: 0.7014 max: 2.6881 USE_META, weight: 0.7373 cost: 1.2813 min: 0.7014 max: 2.6881 USE_META, weight: 0.7280 cost: 1.3019 min: 0.7014 max: 2.6881 USE_META, weight: 0.7298 cost: 1.2979 min: 0.7014 max: 2.6881 USE_META, weight: 0.2783 cost: 2.2946 min: 0.7014 max: 2.6881 USE_META, weight: 0.4208 cost: 1.9799 min: 0.7014 max: 2.6881 USE_META, weight: 0.2895 cost: 2.2698 min: 0.7014 max: 2.6881 USE_META, weight: 0.2677 cost: 2.3179 min: 0.7014 max: 2.6881 USE_META, weight: 0.4661 cost: 1.8799 min: 0.7014 max: 2.6881 USE_META, weight: 0.4419 cost: 1.9334 min: 0.7014 max: 2.6881 USE_META, weight: 0.6107 cost: 1.5607 min: 0.7014 max: 2.6881 USE_META, weight: 0.3890 cost: 2.0501 min: 0.7014 max: 2.6881 USE_META, weight: 0.3310 cost: 2.1782 min: 0.7014 max: 2.6881 USE_META, weight: 0.7512 cost: 1.2507 min: 0.7014 max: 2.6881 USE_META, weight: 0.7322 cost: 1.2926 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.7405 cost: 1.2741 min: 0.7014 max: 2.6881 USE_META, weight: 0.7398 cost: 1.2757 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.5793 cost: 1.6301 min: 0.7014 max: 2.6881 USE_META, weight: 0.5116 cost: 1.7796 min: 0.7014 max: 2.6881 USE_META, weight: 0.4843 cost: 1.8399 min: 0.7014 max: 2.6881 USE_META, weight: 0.3342 cost: 2.1711 min: 0.7014 max: 2.6881 USE_META, weight: 0.2972 cost: 2.2528 min: 0.7014 max: 2.6881 USE_META, weight: 0.8053 cost: 1.1311 min: 0.7014 max: 2.6881 USE_META, weight: 0.4321 cost: 1.9551 min: 0.7014 max: 2.6881 USE_META, weight: 0.5030 cost: 1.7984 min: 0.7014 max: 2.6881 USE_META, weight: 0.9327 cost: 0.8501 min: 0.7014 max: 2.6881 USE_META, weight: 0.5213 cost: 1.7581 min: 0.7014 max: 2.6881 USE_META, weight: 0.6798 cost: 1.4082 min: 0.7014 max: 2.6881 USE_META, weight: 0.6785 cost: 1.4111 min: 0.7014 max: 2.6881 USE_META, weight: 0.6785 cost: 1.4111 min: 0.7014 max: 2.6881 USE_META, weight: 0.6629 cost: 1.4455 min: 0.7014 max: 2.6881 USE_META, weight: 0.3514 cost: 2.1332 min: 0.7014 max: 2.6881 USE_META, weight: 0.7032 cost: 1.3566 min: 0.7014 max: 2.6881 USE_META, weight: 0.6100 cost: 1.5623 min: 0.7014 max: 2.6881 USE_META, weight: 0.2713 cost: 2.3100 min: 0.7014 max: 2.6881 USE_META, weight: 0.4403 cost: 1.9368 min: 0.7014 max: 2.6881 USE_META, weight: 0.7081 cost: 1.3458 min: 0.7014 max: 2.6881 USE_META, weight: 0.8193 cost: 1.1004 min: 0.7014 max: 2.6881 USE_META, weight: 0.3281 cost: 2.1846 min: 0.7014 max: 2.6881 USE_META, weight: 0.8054 cost: 1.1310 min: 0.7014 max: 2.6881 USE_META, weight: 0.7355 cost: 1.2852 min: 0.7014 max: 2.6881 USE_META, weight: 0.6246 cost: 1.5300 min: 0.7014 max: 2.6881 USE_META, weight: 0.6476 cost: 1.4792 min: 0.7014 max: 2.6881 USE_META, weight: 0.3682 cost: 2.0960 min: 0.7014 max: 2.6881 USE_META, weight: 0.6467 cost: 1.4813 min: 0.7014 max: 2.6881 USE_META, weight: 0.7415 cost: 1.2719 min: 0.7014 max: 2.6881 USE_META, weight: 0.2890 cost: 2.2708 min: 0.7014 max: 2.6881 USE_META, weight: 0.7545 cost: 1.2434 min: 0.7014 max: 2.6881 USE_META, weight: 0.8422 cost: 1.0497 min: 0.7014 max: 2.6881 USE_META, weight: 0.7832 cost: 1.1800 min: 0.7014 max: 2.6881 USE_META, weight: 1.0000 cost: 0.7014 min: 0.7014 max: 2.6881 USE_META, weight: 0.9607 cost: 0.7882 min: 0.7014 max: 2.6881 USE_META, weight: 0.9814 cost: 0.7424 min: 0.7014 max: 2.6881 USE_META, weight: 0.9578 cost: 0.7945 min: 0.7014 max: 2.6881 USE_META, weight: 0.9439 cost: 0.8251 min: 0.7014 max: 2.6881 USE_META, weight: 0.5335 cost: 1.7311 min: 0.7014 max: 2.6881 USE_META, weight: 0.6324 cost: 1.5129 min: 0.7014 max: 2.6881 USE_META, weight: 0.7108 cost: 1.3398 min: 0.7014 max: 2.6881 USE_META, weight: 0.3836 cost: 2.0621 min: 0.7014 max: 2.6881 USE_META, weight: 0.6809 cost: 1.4057 min: 0.7014 max: 2.6881 USE_META, weight: 0.4325 cost: 1.9542 min: 0.7014 max: 2.6881 USE_META, weight: 0.3656 cost: 2.1017 min: 0.7014 max: 2.6881 USE_META, weight: 0.3630 cost: 2.1074 min: 0.7014 max: 2.6881 USE_META, weight: 0.3704 cost: 2.0913 min: 0.7014 max: 2.6881 USE_META, weight: 0.3773 cost: 2.0759 min: 0.7014 max: 2.6881 USE_META, weight: 0.3656 cost: 2.1017 min: 0.7014 max: 2.6881 USE_META, weight: 0.4281 cost: 1.9637 min: 0.7014 max: 2.6881 USE_META, weight: 0.4360 cost: 1.9464 min: 0.7014 max: 2.6881 USE_META, weight: 0.4443 cost: 1.9280 min: 0.7014 max: 2.6881 USE_META, weight: 0.3622 cost: 2.1093 min: 0.7014 max: 2.6881 USE_META, weight: 0.3649 cost: 2.1033 min: 0.7014 max: 2.6881 USE_META, weight: 0.7900 cost: 1.1649 min: 0.7014 max: 2.6881 USE_META, weight: 0.7973 cost: 1.1489 min: 0.7014 max: 2.6881 USE_META, weight: 0.3899 cost: 2.0482 min: 0.7014 max: 2.6881 USE_META, weight: 0.4052 cost: 2.0144 min: 0.7014 max: 2.6881 USE_META, weight: 0.4021 cost: 2.0211 min: 0.7014 max: 2.6881 USE_META, weight: 0.4320 cost: 1.9552 min: 0.7014 max: 2.6881 USE_META, weight: 0.3327 cost: 2.1745 min: 0.7014 max: 2.6881 USE_META, weight: 0.3741 cost: 2.0831 min: 0.7014 max: 2.6881 USE_META, weight: 0.3586 cost: 2.1173 min: 0.7014 max: 2.6881 USE_META, weight: 0.3797 cost: 2.0707 min: 0.7014 max: 2.6881 USE_META, weight: 0.3432 cost: 2.1513 min: 0.7014 max: 2.6881 USE_META, weight: 0.6159 cost: 1.5492 min: 0.7014 max: 2.6881 USE_META, weight: 0.4894 cost: 1.8285 min: 0.7014 max: 2.6881 USE_META, weight: 0.4496 cost: 1.9165 min: 0.7014 max: 2.6881 USE_META, weight: 0.4938 cost: 1.8187 min: 0.7014 max: 2.6881 USE_META, weight: 0.3899 cost: 2.0482 min: 0.7014 max: 2.6881 USE_META, weight: 0.6569 cost: 1.4587 min: 0.7014 max: 2.6881 USE_META, weight: 0.6748 cost: 1.4192 min: 0.7014 max: 2.6881 USE_META, weight: 0.6811 cost: 1.4054 min: 0.7014 max: 2.6881 USE_META, weight: 0.6127 cost: 1.5563 min: 0.7014 max: 2.6881 USE_META, weight: 0.7350 cost: 1.2863 min: 0.7014 max: 2.6881 USE_META, weight: 0.8460 cost: 1.0413 min: 0.7014 max: 2.6881 USE_META, weight: 0.7043 cost: 1.3541 min: 0.7014 max: 2.6881 USE_META, weight: 0.5415 cost: 1.7136 min: 0.7014 max: 2.6881 USE_META, weight: 0.5444 cost: 1.7072 min: 0.7014 max: 2.6881 USE_META, weight: 0.3604 cost: 2.1133 min: 0.7014 max: 2.6881 USE_META, weight: 0.8645 cost: 1.0006 min: 0.7014 max: 2.6881 USE_META, weight: 0.6862 cost: 1.3941 min: 0.7014 max: 2.6881 USE_META, weight: 0.5683 cost: 1.6543 min: 0.7014 max: 2.6881 USE_META, weight: 0.5860 cost: 1.6152 min: 0.7014 max: 2.6881 USE_META, weight: 0.3293 cost: 2.1820 min: 0.7014 max: 2.6881 USE_META, weight: 0.7703 cost: 1.2085 min: 0.7014 max: 2.6881 USE_META, weight: 0.4938 cost: 1.8187 min: 0.7014 max: 2.6881 USE_META, weight: 0.8053 cost: 1.1313 min: 0.7014 max: 2.6881 USE_META, weight: 0.4524 cost: 1.9103 min: 0.7014 max: 2.6881 USE_META, weight: 0.6159 cost: 1.5492 min: 0.7014 max: 2.6881 USE_META, weight: 0.4714 cost: 1.8682 min: 0.7014 max: 2.6881 USE_META, weight: 0.6612 cost: 1.4492 min: 0.7014 max: 2.6881 USE_META, weight: 0.4713 cost: 1.8685 min: 0.7014 max: 2.6881 USE_META, weight: 0.5048 cost: 1.7944 min: 0.7014 max: 2.6881 USE_META, weight: 0.5158 cost: 1.7701 min: 0.7014 max: 2.6881 USE_META, weight: 0.7394 cost: 1.2766 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.7316 cost: 1.2938 min: 0.7014 max: 2.6881 USE_META, weight: 0.4704 cost: 1.8705 min: 0.7014 max: 2.6881 USE_META, weight: 0.9653 cost: 0.7780 min: 0.7014 max: 2.6881 USE_META, weight: 0.7632 cost: 1.2242 min: 0.7014 max: 2.6881 USE_META, weight: 0.8804 cost: 0.9655 min: 0.7014 max: 2.6881 USE_META, weight: 0.9145 cost: 0.8901 min: 0.7014 max: 2.6881 USE_META, weight: 0.6748 cost: 1.4192 min: 0.7014 max: 2.6881 USE_META, weight: 0.6811 cost: 1.4054 min: 0.7014 max: 2.6881 USE_META, weight: 0.6569 cost: 1.4587 min: 0.7014 max: 2.6881 USE_META, weight: 0.4443 cost: 1.9281 min: 0.7014 max: 2.6881 USE_META, weight: 0.6630 cost: 1.4452 min: 0.7014 max: 2.6881 USE_META, weight: 0.8701 cost: 0.9881 min: 0.7014 max: 2.6881 USE_META, weight: 0.7439 cost: 1.2668 min: 0.7014 max: 2.6881 USE_META, weight: 0.6580 cost: 1.4563 min: 0.7014 max: 2.6881 USE_META, weight: 0.2376 cost: 2.3843 min: 0.7014 max: 2.6881 USE_META, weight: 0.7444 cost: 1.2657 min: 0.7014 max: 2.6881 USE_META, weight: 0.2978 cost: 2.2515 min: 0.7014 max: 2.6881 USE_META, weight: 0.7582 cost: 1.2352 min: 0.7014 max: 2.6881 USE_META, weight: 0.4181 cost: 1.9860 min: 0.7014 max: 2.6881 USE_META, weight: 0.3851 cost: 2.0587 min: 0.7014 max: 2.6881 USE_META, weight: 0.1750 cost: 2.5226 min: 0.7014 max: 2.6881 USE_META, weight: 0.7378 cost: 1.2803 min: 0.7014 max: 2.6881 USE_META, weight: 0.7388 cost: 1.2780 min: 0.7014 max: 2.6881 USE_META, weight: 0.7353 cost: 1.2856 min: 0.7014 max: 2.6881 USE_META, weight: 0.7275 cost: 1.3030 min: 0.7014 max: 2.6881 USE_META, weight: 0.7406 cost: 1.2741 min: 0.7014 max: 2.6881 USE_META, weight: 0.5669 cost: 1.6575 min: 0.7014 max: 2.6881 USE_META, weight: 0.7354 cost: 1.2855 min: 0.7014 max: 2.6881 USE_META, weight: 0.7380 cost: 1.2798 min: 0.7014 max: 2.6881 USE_META, weight: 0.7346 cost: 1.2872 min: 0.7014 max: 2.6881 USE_META, weight: 0.7305 cost: 1.2963 min: 0.7014 max: 2.6881 USE_META, weight: 0.7404 cost: 1.2744 min: 0.7014 max: 2.6881 USE_META, weight: 0.8726 cost: 0.9827 min: 0.7014 max: 2.6881 USE_META, weight: 0.8043 cost: 1.1334 min: 0.7014 max: 2.6881 USE_META, weight: 0.8432 cost: 1.0475 min: 0.7014 max: 2.6881 USE_META, weight: 0.7305 cost: 1.2962 min: 0.7014 max: 2.6881 USE_META, weight: 0.3979 cost: 2.0306 min: 0.7014 max: 2.6881 USE_META, weight: 0.6970 cost: 1.3702 min: 0.7014 max: 2.6881 USE_META, weight: 0.8339 cost: 1.0680 min: 0.7014 max: 2.6881 USE_META, weight: 0.7388 cost: 1.2779 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.7368 cost: 1.2823 min: 0.7014 max: 2.6881 USE_META, weight: 0.7392 cost: 1.2771 min: 0.7014 max: 2.6881 USE_META, weight: 0.7374 cost: 1.2810 min: 0.7014 max: 2.6881 USE_META, weight: 0.9116 cost: 0.8965 min: 0.7014 max: 2.6881 USE_META, weight: 0.8761 cost: 0.9749 min: 0.7014 max: 2.6881 USE_META, weight: 0.5280 cost: 1.7433 min: 0.7014 max: 2.6881 USE_META, weight: 0.4264 cost: 1.9676 min: 0.7014 max: 2.6881 USE_META, weight: 0.4060 cost: 2.0127 min: 0.7014 max: 2.6881 USE_META, weight: 0.2695 cost: 2.3140 min: 0.7014 max: 2.6881 USE_META, weight: 0.2713 cost: 2.3099 min: 0.7014 max: 2.6881 USE_META, weight: 0.2528 cost: 2.3507 min: 0.7014 max: 2.6881 USE_META, weight: 0.1978 cost: 2.4722 min: 0.7014 max: 2.6881 USE_META, weight: 0.1746 cost: 2.5234 min: 0.7014 max: 2.6881 USE_META, weight: 0.3541 cost: 2.1272 min: 0.7014 max: 2.6881 USE_META, weight: 0.5836 cost: 1.6206 min: 0.7014 max: 2.6881 USE_META, weight: 0.3583 cost: 2.1179 min: 0.7014 max: 2.6881 USE_META, weight: 0.5104 cost: 1.7822 min: 0.7014 max: 2.6881 USE_META, weight: 0.9378 cost: 0.8388 min: 0.7014 max: 2.6881 USE_META, weight: 0.3590 cost: 2.1165 min: 0.7014 max: 2.6881 USE_META, weight: 0.3889 cost: 2.0504 min: 0.7014 max: 2.6881 USE_META, weight: 0.5060 cost: 1.7918 min: 0.7014 max: 2.6881 USE_META, weight: 0.4105 cost: 2.0026 min: 0.7014 max: 2.6881 USE_META, weight: 0.4427 cost: 1.9317 min: 0.7014 max: 2.6881 USE_META, weight: 0.2432 cost: 2.3720 min: 0.7014 max: 2.6881 USE_META, weight: 0.5335 cost: 1.7311 min: 0.7014 max: 2.6881 USE_META, weight: 0.4593 cost: 1.8950 min: 0.7014 max: 2.6881 USE_META, weight: 0.5679 cost: 1.6552 min: 0.7014 max: 2.6881 USE_META, weight: 0.6257 cost: 1.5277 min: 0.7014 max: 2.6881 USE_META, weight: 0.2296 cost: 2.4020 min: 0.7014 max: 2.6881 USE_META, weight: 0.6666 cost: 1.4374 min: 0.7014 max: 2.6881 USE_META, weight: 0.9127 cost: 0.8941 min: 0.7014 max: 2.6881 USE_EVALUE, weight: 0.9513 eval: 4.5860 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9513 eval: 4.5860 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9513 eval: 4.5860 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.1054 eval: 67.6000 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.1054 eval: 67.6000 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.1054 eval: 67.6000 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.1000 eval: 68.0000 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.1000 eval: 68.0000 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.1000 eval: 68.0000 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9822 eval: 2.2800 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9822 eval: 2.2800 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9822 eval: 2.2800 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9876 eval: 1.8800 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9876 eval: 1.8800 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9876 eval: 1.8800 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9964 eval: 1.2235 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9964 eval: 1.2235 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9964 eval: 1.2235 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9529 eval: 4.4682 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9529 eval: 4.4682 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9529 eval: 4.4682 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9935 eval: 1.4400 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9935 eval: 1.4400 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9935 eval: 1.4400 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9883 eval: 1.8297 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9883 eval: 1.8297 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9883 eval: 1.8297 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9873 eval: 1.9060 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9873 eval: 1.9060 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9873 eval: 1.9060 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 1.0000 eval: 0.9567 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 1.0000 eval: 0.9567 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 1.0000 eval: 0.9567 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9684 eval: 3.3107 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9684 eval: 3.3107 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9684 eval: 3.3107 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9488 eval: 4.7721 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9488 eval: 4.7721 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9488 eval: 4.7721 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9934 eval: 1.4500 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9934 eval: 1.4500 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9934 eval: 1.4500 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9653 eval: 3.5393 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9653 eval: 3.5393 min: 0.9567 max: 68.0000 USE_EVALUE, weight: 0.9653 eval: 3.5393 min: 0.9567 max: 68.0000 Number of contacts in models: 270 Number of contacts in alignments: 45 NUMB_ALIGNS: 45 Adding 17856 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -476.7998, CN propb: -476.7998 weights: 0.1355 constraints: 1482 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 1482 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 1482 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 16374 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 16374 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 17856 # command: