# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0333/ # command:# Making conformation for sequence T0333 numbered 1 through 376 Created new target T0333 from T0333.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0333/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0333//projects/compbio/experiments/protein-predict/casp7/T0333/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0333//projects/compbio/experiments/protein-predict/casp7/T0333/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0333/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0333/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0333)A19.CB, (T0333)V29.CB) [> 3.1524 = 5.2539 < 6.8301] w=1.0000 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)I31.CB) [> 4.0315 = 6.7192 < 8.7349] w=0.9096 to align # Constraint # added constraint: constraint((T0333)A19.CB, (T0333)I31.CB) [> 3.6309 = 6.0514 < 7.8669] w=0.8932 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)V130.CB) [> 3.8443 = 6.4072 < 8.3294] w=0.7722 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V48.CB) [> 3.8618 = 6.4364 < 8.3673] w=0.7099 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)L30.CB) [> 3.7433 = 6.2389 < 8.1106] w=0.7086 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V130.CB) [> 3.4235 = 5.7058 < 7.4175] w=0.7076 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)A32.CB) [> 3.8763 = 6.4605 < 8.3987] w=0.7026 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V47.CB) [> 3.7315 = 6.2192 < 8.0849] w=0.6982 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)I31.CB) [> 3.7213 = 6.2022 < 8.0628] w=0.6965 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V113.CB) [> 3.8037 = 6.3396 < 8.2414] w=0.6912 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)P131.CB) [> 3.1216 = 5.2027 < 6.7636] w=0.6765 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)P109.CB) [> 3.5825 = 5.9708 < 7.7620] w=0.6733 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)P131.CB) [> 3.9896 = 6.6494 < 8.6442] w=0.6701 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V113.CB) [> 3.8476 = 6.4127 < 8.3365] w=0.6692 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)A32.CB) [> 3.7398 = 6.2330 < 8.1029] w=0.6562 to align # Constraint # added constraint: constraint((T0333)V104.CB, (T0333)V130.CB) [> 3.7902 = 6.3170 < 8.2121] w=0.6425 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V48.CB) [> 4.1168 = 6.8614 < 8.9198] w=0.6379 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)L45.CB) [> 3.4356 = 5.7260 < 7.4438] w=0.6374 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V47.CB) [> 3.6591 = 6.0986 < 7.9282] w=0.6365 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)R135.CB) [> 3.8308 = 6.3847 < 8.3002] w=0.6344 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V112.CB) [> 3.6976 = 6.1626 < 8.0114] w=0.6308 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)D243.CB) [> 3.9436 = 6.5726 < 8.5444] w=0.6277 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V113.CB) [> 3.7339 = 6.2231 < 8.0900] w=0.6265 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)D49.CB) [> 4.0849 = 6.8082 < 8.8507] w=0.6259 to align # Constraint # added constraint: constraint((T0333)P109.CB, (T0333)V130.CB) [> 3.4295 = 5.7159 < 7.4307] w=0.6230 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)F244.CB) [> 3.9014 = 6.5023 < 8.4529] w=0.6216 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)E46.CB) [> 3.4298 = 5.7163 < 7.4311] w=0.6181 to align # Constraint # added constraint: constraint((T0333)A19.CB, (T0333)L45.CB) [> 3.2920 = 5.4866 < 7.1326] w=0.6139 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)I31.CB) [> 3.7054 = 6.1757 < 8.0284] w=0.6135 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)V245.CB) [> 3.3805 = 5.6342 < 7.3244] w=0.6095 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)V245.CB) [> 3.8719 = 6.4531 < 8.3890] w=0.6043 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)A242.CB) [> 3.2994 = 5.4989 < 7.1486] w=0.6035 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V112.CB) [> 3.7829 = 6.3048 < 8.1962] w=0.6002 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)A125.CB) [> 3.4799 = 5.7999 < 7.5399] w=0.5970 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)L30.CB) [> 3.6366 = 6.0610 < 7.8793] w=0.5967 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V29.CB) [> 3.6810 = 6.1349 < 7.9754] w=0.5951 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V133.CB) [> 3.9717 = 6.6195 < 8.6053] w=0.5941 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)D243.CB) [> 3.2006 = 5.3343 < 6.9346] w=0.5926 to align # Constraint # added constraint: constraint((T0333)M101.CB, (T0333)A128.CB) [> 3.9889 = 6.6482 < 8.6427] w=0.5839 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)L45.CB) [> 2.9549 = 4.9248 < 6.4023] w=0.5839 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)Y107.CB) [> 3.3304 = 5.5507 < 7.2159] w=0.5764 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)A132.CB) [> 3.4403 = 5.7338 < 7.4539] w=0.5761 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)A242.CB) [> 3.8879 = 6.4799 < 8.4238] w=0.5727 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)V50.CB) [> 4.0745 = 6.7909 < 8.8281] w=0.5725 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V50.CB) [> 4.0010 = 6.6684 < 8.6689] w=0.5711 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)T100.CB) [> 3.8074 = 6.3457 < 8.2494] w=0.5668 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)F244.CB) [> 3.5152 = 5.8587 < 7.6164] w=0.5668 to align # Constraint # added constraint: constraint((T0333)V104.CB, (T0333)A128.CB) [> 3.8114 = 6.3522 < 8.2579] w=0.5665 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)V245.CB) [> 4.1146 = 6.8576 < 8.9149] w=0.5657 to align # Constraint # added constraint: constraint((T0333)R23.CB, (T0333)L45.CB) [> 4.0581 = 6.7635 < 8.7926] w=0.5654 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)L45.CB) [> 4.1643 = 6.9405 < 9.0226] w=0.5649 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)L246.CB) [> 3.4926 = 5.8210 < 7.5672] w=0.5602 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)L111.CB) [> 3.7725 = 6.2875 < 8.1738] w=0.5591 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)V133.CB) [> 3.9561 = 6.5935 < 8.5715] w=0.5580 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)P131.CB) [> 4.3339 = 7.2232 < 9.3901] w=0.5508 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)V48.CB) [> 4.3866 = 7.3111 < 9.5044] w=0.5483 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)R135.CB) [> 3.9347 = 6.5579 < 8.5252] w=0.5452 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)E46.CB) [> 3.8017 = 6.3362 < 8.2371] w=0.5408 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)A247.CB) [> 3.4672 = 5.7786 < 7.5122] w=0.5371 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V113.CB) [> 3.7335 = 6.2225 < 8.0892] w=0.5368 to align # Constraint # added constraint: constraint((T0333)P211.CB, (T0333)A242.CB) [> 3.5632 = 5.9387 < 7.7203] w=0.5362 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)A32.CB) [> 3.6591 = 6.0985 < 7.9281] w=0.5309 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)L103.CB) [> 3.6905 = 6.1508 < 7.9960] w=0.5182 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)L15.CB) [> 3.6911 = 6.1519 < 7.9974] w=0.5179 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)V133.CB) [> 3.2164 = 5.3607 < 6.9689] w=0.5032 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)Q134.CB) [> 3.5655 = 5.9425 < 7.7253] w=0.5030 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)V33.CB) [> 4.2111 = 7.0185 < 9.1240] w=0.5016 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)A247.CB) [> 3.6325 = 6.0541 < 7.8703] w=0.5001 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)L15.CB) [> 3.4085 = 5.6808 < 7.3851] w=0.5000 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)A132.CB) [> 3.8158 = 6.3596 < 8.2675] w=0.4969 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)I31.CB) [> 4.1450 = 6.9083 < 8.9808] w=0.4954 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)V33.CB) [> 3.4691 = 5.7818 < 7.5163] w=0.4929 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)D49.CB) [> 3.4225 = 5.7042 < 7.4155] w=0.4922 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)L248.CB) [> 3.1209 = 5.2014 < 6.7618] w=0.4822 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)A247.CB) [> 4.2007 = 7.0012 < 9.1015] w=0.4821 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)L246.CB) [> 4.0701 = 6.7835 < 8.8185] w=0.4818 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)Q137.CB) [> 3.2170 = 5.3616 < 6.9701] w=0.4800 to align # Constraint # added constraint: constraint((T0333)P211.CB, (T0333)D243.CB) [> 3.7308 = 6.2181 < 8.0835] w=0.4633 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)L103.CB) [> 4.0439 = 6.7399 < 8.7618] w=0.4632 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)F244.CB) [> 3.9485 = 6.5808 < 8.5551] w=0.4605 to align # Constraint # added constraint: constraint((T0333)I234.CB, (T0333)F244.CB) [> 3.3983 = 5.6638 < 7.3630] w=0.4585 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)L15.CB) [> 3.3822 = 5.6370 < 7.3281] w=0.4516 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V112.CB) [> 4.1290 = 6.8817 < 8.9462] w=0.4460 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)Q134.CB) [> 3.9799 = 6.6332 < 8.6232] w=0.4431 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V29.CB) [> 3.8816 = 6.4694 < 8.4102] w=0.4417 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)V33.CB) [> 3.5124 = 5.8540 < 7.6102] w=0.4405 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)V33.CB) [> 3.6904 = 6.1507 < 7.9959] w=0.4399 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)L248.CB) [> 3.6296 = 6.0493 < 7.8641] w=0.4339 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)E46.CB) [> 3.7799 = 6.2998 < 8.1897] w=0.4327 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)Y114.CB) [> 3.3911 = 5.6518 < 7.3474] w=0.4269 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)G117.CA) [> 3.4770 = 5.7951 < 7.5336] w=0.4265 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)V50.CB) [> 3.6273 = 6.0454 < 7.8591] w=0.4264 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)C278.CB) [> 4.0692 = 6.7821 < 8.8167] w=0.4220 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)P109.CB) [> 3.2884 = 5.4806 < 7.1248] w=0.4217 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)V245.CB) [> 3.5869 = 5.9781 < 7.7716] w=0.4204 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)V133.CB) [> 4.3209 = 7.2014 < 9.3619] w=0.4204 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)Q116.CB) [> 4.1872 = 6.9786 < 9.0722] w=0.4200 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)Y114.CB) [> 3.6554 = 6.0923 < 7.9200] w=0.4156 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)A40.CB) [> 3.8445 = 6.4074 < 8.3297] w=0.4156 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V48.CB) [> 3.1908 = 5.3180 < 6.9134] w=0.4119 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)Q137.CB) [> 4.1307 = 6.8846 < 8.9499] w=0.4101 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)A40.CB) [> 3.4236 = 5.7061 < 7.4179] w=0.4097 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)R135.CB) [> 3.4483 = 5.7471 < 7.4713] w=0.4057 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)L325.CB) [> 4.0422 = 6.7370 < 8.7581] w=0.4052 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)I233.CB) [> 3.6778 = 6.1297 < 7.9686] w=0.4036 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)A32.CB) [> 4.0669 = 6.7781 < 8.8116] w=0.4017 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)I31.CB) [> 3.8555 = 6.4259 < 8.3537] w=0.4010 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)E115.CB) [> 3.2908 = 5.4847 < 7.1301] w=0.3941 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)V120.CB) [> 3.5059 = 5.8432 < 7.5962] w=0.3935 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)V47.CB) [> 4.0312 = 6.7187 < 8.7343] w=0.3875 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)A128.CB) [> 4.2174 = 7.0290 < 9.1376] w=0.3841 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)A280.CB) [> 3.7981 = 6.3301 < 8.2291] w=0.3822 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)F244.CB) [> 4.3524 = 7.2540 < 9.4302] w=0.3816 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)N136.CB) [> 4.1538 = 6.9229 < 8.9998] w=0.3787 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)A237.CB) [> 3.3168 = 5.5281 < 7.1865] w=0.3785 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)A293.CB) [> 2.9430 = 4.9049 < 6.3764] w=0.3761 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)T279.CB) [> 3.7234 = 6.2056 < 8.0673] w=0.3760 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)G249.CA) [> 3.4448 = 5.7414 < 7.4638] w=0.3739 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)Q116.CB) [> 3.9881 = 6.6468 < 8.6408] w=0.3731 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)G121.CA) [> 3.6978 = 6.1631 < 8.0120] w=0.3708 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)H283.CB) [> 3.4440 = 5.7400 < 7.4620] w=0.3701 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)V282.CB) [> 3.7833 = 6.3054 < 8.1971] w=0.3700 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)C278.CB) [> 3.3394 = 5.5656 < 7.2353] w=0.3699 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)F22.CB) [> 3.7484 = 6.2473 < 8.1215] w=0.3668 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)D110.CB) [> 3.6585 = 6.0975 < 7.9267] w=0.3665 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)A247.CB) [> 4.0487 = 6.7479 < 8.7722] w=0.3664 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)A124.CB) [> 3.9356 = 6.5593 < 8.5271] w=0.3656 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)V282.CB) [> 3.3789 = 5.6315 < 7.3210] w=0.3639 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)I31.CB) [> 4.2085 = 7.0142 < 9.1185] w=0.3629 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)L246.CB) [> 3.6300 = 6.0500 < 7.8650] w=0.3627 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)L15.CB) [> 3.7173 = 6.1955 < 8.0541] w=0.3619 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)H27.CB) [> 3.3725 = 5.6208 < 7.3070] w=0.3601 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)V281.CB) [> 3.4197 = 5.6995 < 7.4093] w=0.3577 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)V230.CB) [> 3.6941 = 6.1569 < 8.0040] w=0.3549 to align # Constraint # added constraint: constraint((T0333)R210.CB, (T0333)A242.CB) [> 3.9157 = 6.5261 < 8.4840] w=0.3548 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)V281.CB) [> 4.1790 = 6.9650 < 9.0546] w=0.3524 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)T279.CB) [> 3.4051 = 5.6751 < 7.3777] w=0.3518 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)C278.CB) [> 3.5478 = 5.9130 < 7.6869] w=0.3516 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)G324.CA) [> 3.8173 = 6.3622 < 8.2709] w=0.3510 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)Q134.CB) [> 4.4383 = 7.3972 < 9.6163] w=0.3494 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)L248.CB) [> 4.3987 = 7.3312 < 9.5305] w=0.3490 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)G117.CA) [> 3.4613 = 5.7688 < 7.4994] w=0.3473 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)P299.CB) [> 4.1274 = 6.8790 < 8.9427] w=0.3463 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)V281.CB) [> 3.9881 = 6.6469 < 8.6410] w=0.3461 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)V120.CB) [> 3.9616 = 6.6027 < 8.5836] w=0.3458 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)V282.CB) [> 3.9565 = 6.5941 < 8.5724] w=0.3457 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)R264.CB) [> 3.1277 = 5.2128 < 6.7766] w=0.3454 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V29.CB) [> 3.9203 = 6.5339 < 8.4940] w=0.3447 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)Q300.CB) [> 3.0571 = 5.0953 < 6.6238] w=0.3402 to align # Constraint # added constraint: constraint((T0333)V230.CB, (T0333)L246.CB) [> 4.1670 = 6.9450 < 9.0285] w=0.3384 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)L30.CB) [> 4.0631 = 6.7718 < 8.8033] w=0.3380 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)L248.CB) [> 3.8737 = 6.4561 < 8.3930] w=0.3375 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)A303.CB) [> 3.2828 = 5.4713 < 7.1127] w=0.3343 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)L301.CB) [> 4.1038 = 6.8397 < 8.8917] w=0.3343 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)P299.CB) [> 2.9834 = 4.9723 < 6.4640] w=0.3341 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)R264.CB) [> 4.1870 = 6.9784 < 9.0719] w=0.3333 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)L111.CB) [> 3.4711 = 5.7851 < 7.5207] w=0.3319 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)Y114.CB) [> 3.7090 = 6.1816 < 8.0361] w=0.3305 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)A280.CB) [> 3.4800 = 5.7999 < 7.5399] w=0.3275 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)A265.CB) [> 3.0969 = 5.1615 < 6.7100] w=0.3275 to align # Constraint # added constraint: constraint((T0333)Q300.CB, (T0333)G324.CA) [> 3.2805 = 5.4674 < 7.1076] w=0.3265 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)V47.CB) [> 4.2746 = 7.1243 < 9.2616] w=0.3220 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)V263.CB) [> 3.6070 = 6.0117 < 7.8152] w=0.3213 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)A132.CB) [> 4.2411 = 7.0684 < 9.1890] w=0.3208 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)D28.CB) [> 4.0897 = 6.8161 < 8.8609] w=0.3195 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)A125.CB) [> 2.4111 = 4.0185 < 5.2240] w=0.3172 to align # Constraint # added constraint: constraint((T0333)M101.CB, (T0333)R127.CB) [> 3.7519 = 6.2532 < 8.1291] w=0.3160 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)L301.CB) [> 3.0835 = 5.1392 < 6.6810] w=0.3160 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)V263.CB) [> 2.7207 = 4.5345 < 5.8948] w=0.3154 to align # Constraint # added constraint: constraint((T0333)H283.CB, (T0333)A293.CB) [> 4.0837 = 6.8061 < 8.8480] w=0.3148 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V47.CB) [> 4.1932 = 6.9887 < 9.0853] w=0.3147 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)L18.CB) [> 3.7604 = 6.2673 < 8.1475] w=0.3142 to align # Constraint # added constraint: constraint((T0333)V97.CB, (T0333)A124.CB) [> 3.5967 = 5.9945 < 7.7929] w=0.3138 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)E115.CB) [> 3.2352 = 5.3920 < 7.0096] w=0.3135 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)A19.CB) [> 3.7502 = 6.2503 < 8.1254] w=0.3130 to align # Constraint # added constraint: constraint((T0333)H283.CB, (T0333)L302.CB) [> 3.3582 = 5.5971 < 7.2762] w=0.3102 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)I298.CB) [> 3.0486 = 5.0810 < 6.6053] w=0.3102 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)L301.CB) [> 3.6498 = 6.0829 < 7.9078] w=0.3099 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)V266.CB) [> 3.0772 = 5.1287 < 6.6673] w=0.3097 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)R264.CB) [> 4.2441 = 7.0735 < 9.1955] w=0.3095 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)H27.CB) [> 3.2635 = 5.4392 < 7.0709] w=0.3076 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)G249.CA) [> 3.9773 = 6.6287 < 8.6174] w=0.3075 to align # Constraint # added constraint: constraint((T0333)W20.CB, (T0333)A43.CB) [> 3.6653 = 6.1089 < 7.9415] w=0.3074 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)A19.CB) [> 3.6446 = 6.0744 < 7.8967] w=0.3074 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)E115.CB) [> 3.9137 = 6.5228 < 8.4796] w=0.3072 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)L111.CB) [> 4.0885 = 6.8142 < 8.8585] w=0.3060 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)V113.CB) [> 4.0874 = 6.8124 < 8.8561] w=0.3060 to align # Constraint # added constraint: constraint((T0333)V97.CB, (T0333)R127.CB) [> 3.4211 = 5.7018 < 7.4124] w=0.3053 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)A132.CB) [> 3.9172 = 6.5287 < 8.4873] w=0.3050 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)Q137.CB) [> 4.0040 = 6.6733 < 8.6752] w=0.3042 to align # Constraint # added constraint: constraint((T0333)H283.CB, (T0333)A303.CB) [> 4.0948 = 6.8246 < 8.8720] w=0.3041 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)I298.CB) [> 3.8470 = 6.4117 < 8.3352] w=0.3039 to align # Constraint # added constraint: constraint((T0333)H283.CB, (T0333)Q300.CB) [> 3.8014 = 6.3357 < 8.2365] w=0.3036 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)V266.CB) [> 4.2025 = 7.0042 < 9.1055] w=0.3035 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)V266.CB) [> 3.8921 = 6.4869 < 8.4329] w=0.3035 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)D28.CB) [> 4.0529 = 6.7548 < 8.7813] w=0.3015 to align # Constraint # added constraint: constraint((T0333)H283.CB, (T0333)L301.CB) [> 4.3642 = 7.2737 < 9.4558] w=0.2980 to align # Constraint # added constraint: constraint((T0333)T279.CB, (T0333)P299.CB) [> 4.0113 = 6.6855 < 8.6911] w=0.2980 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)Q300.CB) [> 4.2607 = 7.1012 < 9.2315] w=0.2975 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)L325.CB) [> 3.5732 = 5.9554 < 7.7420] w=0.2969 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)D250.CB) [> 3.4174 = 5.6958 < 7.4045] w=0.2958 to align # Constraint # added constraint: constraint((T0333)R210.CB, (T0333)D241.CB) [> 4.1927 = 6.9879 < 9.0843] w=0.2936 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)Q116.CB) [> 3.8749 = 6.4581 < 8.3955] w=0.2933 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)A118.CB) [> 3.0144 = 5.0240 < 6.5311] w=0.2933 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)V33.CB) [> 3.9029 = 6.5049 < 8.4564] w=0.2917 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V29.CB) [> 4.1396 = 6.8994 < 8.9692] w=0.2891 to align # Constraint # added constraint: constraint((T0333)C278.CB, (T0333)I298.CB) [> 3.4377 = 5.7295 < 7.4484] w=0.2860 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)V113.CB) [> 3.9102 = 6.5170 < 8.4721] w=0.2857 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)G267.CA) [> 3.3231 = 5.5385 < 7.2000] w=0.2853 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)V263.CB) [> 4.2321 = 7.0535 < 9.1695] w=0.2845 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)D250.CB) [> 3.4151 = 5.6918 < 7.3994] w=0.2835 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)L246.CB) [> 4.5114 = 7.5190 < 9.7747] w=0.2831 to align # Constraint # added constraint: constraint((T0333)R210.CB, (T0333)D243.CB) [> 2.7758 = 4.6264 < 6.0143] w=0.2829 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)Q116.CB) [> 3.3860 = 5.6432 < 7.3362] w=0.2811 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)E115.CB) [> 3.3161 = 5.5268 < 7.1848] w=0.2800 to align # Constraint # added constraint: constraint((T0333)G285.CA, (T0333)A303.CB) [> 4.0013 = 6.6689 < 8.6695] w=0.2786 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)V326.CB) [> 3.8282 = 6.3803 < 8.2944] w=0.2785 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)L18.CB) [> 3.6574 = 6.0957 < 7.9244] w=0.2774 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)E115.CB) [> 3.1617 = 5.2695 < 6.8503] w=0.2768 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)S138.CB) [> 3.5233 = 5.8722 < 7.6338] w=0.2740 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)G324.CA) [> 3.7882 = 6.3136 < 8.2077] w=0.2736 to align # Constraint # added constraint: constraint((T0333)Q300.CB, (T0333)I323.CB) [> 4.1044 = 6.8407 < 8.8929] w=0.2728 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)G267.CA) [> 3.6602 = 6.1003 < 7.9304] w=0.2727 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)Q137.CB) [> 3.5322 = 5.8871 < 7.6532] w=0.2721 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)Q137.CB) [> 3.8876 = 6.4794 < 8.4232] w=0.2714 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)N136.CB) [> 3.5538 = 5.9230 < 7.6999] w=0.2667 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)G249.CA) [> 3.7382 = 6.2304 < 8.0995] w=0.2666 to align # Constraint # added constraint: constraint((T0333)P211.CB, (T0333)T279.CB) [> 2.8135 = 4.6892 < 6.0959] w=0.2664 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)C278.CB) [> 3.2308 = 5.3847 < 7.0002] w=0.2663 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)I31.CB) [> 3.7171 = 6.1952 < 8.0537] w=0.2654 to align # Constraint # added constraint: constraint((T0333)I233.CB, (T0333)F244.CB) [> 3.8665 = 6.4441 < 8.3774] w=0.2654 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)V192.CB) [> 4.0876 = 6.8127 < 8.8566] w=0.2654 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)A32.CB) [> 3.7901 = 6.3169 < 8.2119] w=0.2649 to align # Constraint # added constraint: constraint((T0333)I171.CB, (T0333)V192.CB) [> 3.2955 = 5.4924 < 7.1402] w=0.2636 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)G249.CA) [> 3.6504 = 6.0840 < 7.9092] w=0.2628 to align # Constraint # added constraint: constraint((T0333)L275.CB, (T0333)A296.CB) [> 2.9969 = 4.9948 < 6.4932] w=0.2613 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)A132.CB) [> 3.0844 = 5.1407 < 6.6829] w=0.2607 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)E115.CB) [> 3.1081 = 5.1802 < 6.7343] w=0.2603 to align # Constraint # added constraint: constraint((T0333)A37.CB, (T0333)V47.CB) [> 3.7109 = 6.1849 < 8.0404] w=0.2600 to align # Constraint # added constraint: constraint((T0333)I171.CB, (T0333)Y194.CB) [> 3.6552 = 6.0920 < 7.9196] w=0.2579 to align # Constraint # added constraint: constraint((T0333)A51.CB, (T0333)L103.CB) [> 4.1487 = 6.9146 < 8.9889] w=0.2568 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)Q116.CB) [> 3.1549 = 5.2582 < 6.8357] w=0.2567 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)G267.CA) [> 3.6859 = 6.1432 < 7.9862] w=0.2551 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)G121.CA) [> 4.0485 = 6.7475 < 8.7718] w=0.2551 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)D110.CB) [> 3.9860 = 6.6433 < 8.6363] w=0.2535 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)G121.CA) [> 3.6724 = 6.1207 < 7.9569] w=0.2526 to align # Constraint # added constraint: constraint((T0333)A51.CB, (T0333)T100.CB) [> 4.6466 = 7.7443 < 10.0676] w=0.2517 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)Q300.CB) [> 3.6680 = 6.1133 < 7.9474] w=0.2502 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)R135.CB) [> 3.6611 = 6.1018 < 7.9324] w=0.2500 to align # Constraint # added constraint: constraint((T0333)R276.CB, (T0333)A296.CB) [> 3.2952 = 5.4920 < 7.1395] w=0.2496 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)G324.CA) [> 3.8394 = 6.3989 < 8.3186] w=0.2484 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)I234.CB) [> 3.8170 = 6.3617 < 8.2702] w=0.2473 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)V230.CB) [> 3.8422 = 6.4037 < 8.3248] w=0.2472 to align # Constraint # added constraint: constraint((T0333)R23.CB, (T0333)A43.CB) [> 3.7239 = 6.2064 < 8.0683] w=0.2465 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)G129.CA) [> 4.6672 = 7.7786 < 10.1122] w=0.2455 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)V120.CB) [> 4.2619 = 7.1031 < 9.2340] w=0.2445 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)Q300.CB) [> 4.5102 = 7.5170 < 9.7721] w=0.2434 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)L302.CB) [> 4.1824 = 6.9707 < 9.0619] w=0.2431 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)H284.CB) [> 4.4350 = 7.3917 < 9.6092] w=0.2429 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)V281.CB) [> 4.4215 = 7.3692 < 9.5799] w=0.2422 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)L301.CB) [> 3.2495 = 5.4159 < 7.0407] w=0.2415 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)C278.CB) [> 3.4540 = 5.7566 < 7.4836] w=0.2414 to align # Constraint # added constraint: constraint((T0333)S327.CB, (T0333)L336.CB) [> 3.1916 = 5.3193 < 6.9150] w=0.2406 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)V33.CB) [> 3.3936 = 5.6560 < 7.3528] w=0.2405 to align # Constraint # added constraint: constraint((T0333)V207.CB, (T0333)D243.CB) [> 3.6570 = 6.0951 < 7.9236] w=0.2403 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)V230.CB) [> 4.3153 = 7.1922 < 9.3498] w=0.2398 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)L302.CB) [> 3.9822 = 6.6371 < 8.6282] w=0.2381 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)L337.CB) [> 4.2021 = 7.0035 < 9.1046] w=0.2371 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)L340.CB) [> 3.4810 = 5.8016 < 7.5421] w=0.2371 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)V266.CB) [> 4.4362 = 7.3936 < 9.6117] w=0.2368 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)R135.CB) [> 4.1579 = 6.9299 < 9.0088] w=0.2357 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)L30.CB) [> 4.2400 = 7.0667 < 9.1867] w=0.2342 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)V29.CB) [> 3.2545 = 5.4241 < 7.0513] w=0.2342 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)D250.CB) [> 4.1447 = 6.9079 < 8.9802] w=0.2338 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)Q116.CB) [> 3.9564 = 6.5940 < 8.5722] w=0.2338 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)D126.CB) [> 4.7028 = 7.8380 < 10.1894] w=0.2336 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)G117.CA) [> 4.6208 = 7.7014 < 10.0118] w=0.2334 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)Q116.CB) [> 2.7419 = 4.5699 < 5.9408] w=0.2323 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)G117.CA) [> 3.6825 = 6.1375 < 7.9788] w=0.2323 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)G117.CA) [> 4.1641 = 6.9401 < 9.0221] w=0.2323 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)T119.CB) [> 3.6231 = 6.0385 < 7.8500] w=0.2323 to align # Constraint # added constraint: constraint((T0333)L275.CB, (T0333)T292.CB) [> 3.6409 = 6.0682 < 7.8886] w=0.2313 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)T269.CB) [> 3.3993 = 5.6655 < 7.3652] w=0.2311 to align # Constraint # added constraint: constraint((T0333)V104.CB, (T0333)A124.CB) [> 3.7796 = 6.2993 < 8.1891] w=0.2310 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)L274.CB) [> 4.0212 = 6.7021 < 8.7127] w=0.2304 to align # Constraint # added constraint: constraint((T0333)Q300.CB, (T0333)L325.CB) [> 3.8817 = 6.4695 < 8.4103] w=0.2297 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V104.CB) [> 4.1464 = 6.9107 < 8.9839] w=0.2293 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)N136.CB) [> 4.0020 = 6.6700 < 8.6710] w=0.2290 to align # Constraint # added constraint: constraint((T0333)G10.CA, (T0333)Q137.CB) [> 4.1132 = 6.8553 < 8.9120] w=0.2283 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)L18.CB) [> 3.5372 = 5.8954 < 7.6640] w=0.2273 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)V120.CB) [> 3.4358 = 5.7263 < 7.4442] w=0.2268 to align # Constraint # added constraint: constraint((T0333)M101.CB, (T0333)A124.CB) [> 3.2034 = 5.3390 < 6.9407] w=0.2259 to align # Constraint # added constraint: constraint((T0333)D105.CB, (T0333)A128.CB) [> 3.7249 = 6.2081 < 8.0705] w=0.2257 to align # Constraint # added constraint: constraint((T0333)L275.CB, (T0333)I298.CB) [> 3.5393 = 5.8988 < 7.6685] w=0.2251 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)V263.CB) [> 4.3850 = 7.3082 < 9.5007] w=0.2251 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)A303.CB) [> 4.1150 = 6.8583 < 8.9158] w=0.2248 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)N262.CB) [> 3.9948 = 6.6579 < 8.6553] w=0.2248 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)N262.CB) [> 3.1944 = 5.3240 < 6.9212] w=0.2248 to align # Constraint # added constraint: constraint((T0333)L275.CB, (T0333)A293.CB) [> 3.7483 = 6.2472 < 8.1214] w=0.2245 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)H284.CB) [> 3.4841 = 5.8069 < 7.5490] w=0.2245 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)W268.CB) [> 3.8016 = 6.3361 < 8.2369] w=0.2244 to align # Constraint # added constraint: constraint((T0333)P211.CB, (T0333)D241.CB) [> 3.9083 = 6.5139 < 8.4680] w=0.2227 to align # Constraint # added constraint: constraint((T0333)E221.CB, (T0333)D250.CB) [> 3.7570 = 6.2617 < 8.1402] w=0.2225 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V104.CB) [> 3.9508 = 6.5846 < 8.5600] w=0.2225 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)V112.CB) [> 4.2115 = 7.0192 < 9.1250] w=0.2224 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)I323.CB) [> 3.1841 = 5.3068 < 6.8989] w=0.2223 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)F22.CB) [> 3.6005 = 6.0008 < 7.8011] w=0.2220 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)A280.CB) [> 3.5942 = 5.9904 < 7.7875] w=0.2219 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)V281.CB) [> 4.1221 = 6.8702 < 8.9312] w=0.2219 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)V230.CB) [> 3.4923 = 5.8205 < 7.5666] w=0.2217 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)A118.CB) [> 3.6054 = 6.0090 < 7.8116] w=0.2216 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)N136.CB) [> 4.0882 = 6.8137 < 8.8578] w=0.2206 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)G121.CA) [> 4.0880 = 6.8133 < 8.8573] w=0.2200 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)A350.CB) [> 3.2032 = 5.3386 < 6.9402] w=0.2193 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)I323.CB) [> 4.3384 = 7.2306 < 9.3998] w=0.2191 to align # Constraint # added constraint: constraint((T0333)T279.CB, (T0333)I298.CB) [> 4.2700 = 7.1167 < 9.2517] w=0.2191 to align # Constraint # added constraint: constraint((T0333)V104.CB, (T0333)A125.CB) [> 3.9727 = 6.6213 < 8.6076] w=0.2191 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)L340.CB) [> 3.6629 = 6.1048 < 7.9362] w=0.2188 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)R264.CB) [> 4.3642 = 7.2736 < 9.4557] w=0.2187 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)D243.CB) [> 3.7937 = 6.3228 < 8.2197] w=0.2186 to align # Constraint # added constraint: constraint((T0333)G121.CA, (T0333)A132.CB) [> 4.1721 = 6.9535 < 9.0396] w=0.2185 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)H283.CB) [> 3.9899 = 6.6498 < 8.6447] w=0.2184 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)A265.CB) [> 4.4987 = 7.4978 < 9.7472] w=0.2182 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)W268.CB) [> 3.6542 = 6.0904 < 7.9175] w=0.2182 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)V282.CB) [> 3.8778 = 6.4630 < 8.4019] w=0.2178 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)A265.CB) [> 4.6368 = 7.7280 < 10.0464] w=0.2177 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)R135.CB) [> 4.1178 = 6.8631 < 8.9220] w=0.2176 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)T277.CB) [> 3.6091 = 6.0152 < 7.8198] w=0.2175 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)V245.CB) [> 3.9163 = 6.5272 < 8.4854] w=0.2175 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)V112.CB) [> 3.9117 = 6.5196 < 8.4754] w=0.2173 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)S138.CB) [> 4.0134 = 6.6889 < 8.6956] w=0.2168 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)W191.CB) [> 3.4863 = 5.8105 < 7.5536] w=0.2166 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)P109.CB) [> 4.0314 = 6.7190 < 8.7347] w=0.2166 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)D110.CB) [> 3.7180 = 6.1967 < 8.0556] w=0.2163 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)T289.CB) [> 4.0956 = 6.8260 < 8.8738] w=0.2162 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)H312.CB) [> 3.8435 = 6.4058 < 8.3275] w=0.2159 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)T279.CB) [> 3.4925 = 5.8208 < 7.5670] w=0.2158 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)G117.CA) [> 3.3809 = 5.6349 < 7.3254] w=0.2157 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)G117.CA) [> 3.6708 = 6.1180 < 7.9534] w=0.2156 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)H36.CB) [> 3.5924 = 5.9873 < 7.7835] w=0.2149 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)S138.CB) [> 4.2308 = 7.0512 < 9.1666] w=0.2146 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)H36.CB) [> 3.9818 = 6.6363 < 8.6271] w=0.2144 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)H36.CB) [> 4.0561 = 6.7602 < 8.7882] w=0.2143 to align # Constraint # added constraint: constraint((T0333)G285.CA, (T0333)L302.CB) [> 3.9800 = 6.6333 < 8.6233] w=0.2135 to align # Constraint # added constraint: constraint((T0333)A236.CB, (T0333)A334.CB) [> 3.0766 = 5.1277 < 6.6660] w=0.2133 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)S327.CB) [> 3.6752 = 6.1254 < 7.9630] w=0.2117 to align # Constraint # added constraint: constraint((T0333)F22.CB, (T0333)V113.CB) [> 4.6056 = 7.6760 < 9.9788] w=0.2109 to align # Constraint # added constraint: constraint((T0333)I234.CB, (T0333)L246.CB) [> 3.6324 = 6.0540 < 7.8702] w=0.2103 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)Q134.CB) [> 3.5656 = 5.9427 < 7.7256] w=0.2102 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)S138.CB) [> 3.5128 = 5.8546 < 7.6110] w=0.2100 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)P193.CB) [> 3.5768 = 5.9614 < 7.7498] w=0.2099 to align # Constraint # added constraint: constraint((T0333)A51.CB, (T0333)G99.CA) [> 3.7603 = 6.2672 < 8.1474] w=0.2098 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)T279.CB) [> 3.6391 = 6.0651 < 7.8847] w=0.2097 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)L301.CB) [> 4.4145 = 7.3575 < 9.5647] w=0.2097 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)A118.CB) [> 3.7512 = 6.2519 < 8.1275] w=0.2094 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)A19.CB) [> 4.1095 = 6.8492 < 8.9039] w=0.2084 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)L336.CB) [> 3.3196 = 5.5327 < 7.1925] w=0.2066 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)A242.CB) [> 3.6307 = 6.0511 < 7.8664] w=0.2065 to align # Constraint # added constraint: constraint((T0333)P304.CB, (T0333)V326.CB) [> 3.8187 = 6.3644 < 8.2738] w=0.2056 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)P52.CB) [> 3.4802 = 5.8003 < 7.5404] w=0.2053 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)F22.CB) [> 4.3499 = 7.2498 < 9.4247] w=0.2052 to align # Constraint # added constraint: constraint((T0333)I233.CB, (T0333)L246.CB) [> 4.1667 = 6.9444 < 9.0278] w=0.2051 to align # Constraint # added constraint: constraint((T0333)P304.CB, (T0333)S327.CB) [> 3.7977 = 6.3295 < 8.2283] w=0.2050 to align # Constraint # added constraint: constraint((T0333)G287.CA, (T0333)H312.CB) [> 3.2919 = 5.4865 < 7.1325] w=0.2046 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)V113.CB) [> 3.6283 = 6.0471 < 7.8613] w=0.2042 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)H283.CB) [> 4.0256 = 6.7094 < 8.7222] w=0.2037 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)V281.CB) [> 3.5140 = 5.8566 < 7.6136] w=0.2036 to align # Constraint # added constraint: constraint((T0333)I89.CB, (T0333)V120.CB) [> 3.0601 = 5.1001 < 6.6301] w=0.2007 to align # Constraint # added constraint: constraint((T0333)G285.CA, (T0333)P304.CB) [> 3.6373 = 6.0622 < 7.8809] w=0.2007 to align # Constraint # added constraint: constraint((T0333)N93.CB, (T0333)A124.CB) [> 3.4874 = 5.8123 < 7.5560] w=0.2004 to align # Constraint # added constraint: constraint((T0333)I294.CB, (T0333)I323.CB) [> 3.3796 = 5.6327 < 7.3225] w=0.2000 to align # Constraint # added constraint: constraint((T0333)I233.CB, (T0333)V282.CB) [> 4.0870 = 6.8116 < 8.8551] w=0.1998 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)A280.CB) [> 4.3864 = 7.3108 < 9.5040] w=0.1997 to align # Constraint # added constraint: constraint((T0333)L325.CB, (T0333)L336.CB) [> 3.3843 = 5.6405 < 7.3327] w=0.1996 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)A34.CB) [> 3.2236 = 5.3726 < 6.9844] w=0.1987 to align # Constraint # added constraint: constraint((T0333)D53.CB, (T0333)V120.CB) [> 3.5403 = 5.9005 < 7.6706] w=0.1977 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)T279.CB) [> 3.5075 = 5.8459 < 7.5997] w=0.1976 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)V290.CB) [> 3.7538 = 6.2564 < 8.1333] w=0.1972 to align # Constraint # added constraint: constraint((T0333)I294.CB, (T0333)R354.CB) [> 3.4580 = 5.7634 < 7.4924] w=0.1948 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)N136.CB) [> 4.1243 = 6.8739 < 8.9360] w=0.1945 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)L274.CB) [> 4.2171 = 7.0286 < 9.1371] w=0.1943 to align # Constraint # added constraint: constraint((T0333)I234.CB, (T0333)V263.CB) [> 3.8348 = 6.3914 < 8.3088] w=0.1940 to align # Constraint # added constraint: constraint((T0333)G286.CA, (T0333)D308.CB) [> 4.3414 = 7.2357 < 9.4064] w=0.1939 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V112.CB) [> 4.1332 = 6.8886 < 8.9552] w=0.1935 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)E35.CB) [> 3.6815 = 6.1359 < 7.9767] w=0.1933 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)P109.CB) [> 2.5465 = 4.2441 < 5.5173] w=0.1932 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)F244.CB) [> 4.2445 = 7.0742 < 9.1965] w=0.1931 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)G285.CA) [> 3.9595 = 6.5992 < 8.5789] w=0.1924 to align # Constraint # added constraint: constraint((T0333)Y54.CB, (T0333)T100.CB) [> 3.9845 = 6.6408 < 8.6330] w=0.1922 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)P109.CB) [> 3.7292 = 6.2153 < 8.0799] w=0.1919 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)Y114.CB) [> 3.6057 = 6.0095 < 7.8124] w=0.1919 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)Y114.CB) [> 4.1174 = 6.8624 < 8.9211] w=0.1918 to align # Constraint # added constraint: constraint((T0333)G121.CA, (T0333)Q134.CB) [> 3.9629 = 6.6048 < 8.5863] w=0.1918 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)L301.CB) [> 4.5089 = 7.5149 < 9.7693] w=0.1916 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)N136.CB) [> 3.3254 = 5.5424 < 7.2051] w=0.1913 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)H284.CB) [> 3.7262 = 6.2104 < 8.0735] w=0.1889 to align # Constraint # added constraint: constraint((T0333)L271.CB, (T0333)T292.CB) [> 4.1016 = 6.8359 < 8.8867] w=0.1889 to align # Constraint # added constraint: constraint((T0333)P109.CB, (T0333)A128.CB) [> 4.1920 = 6.9867 < 9.0827] w=0.1887 to align # Constraint # added constraint: constraint((T0333)A242.CB, (T0333)T279.CB) [> 4.1597 = 6.9328 < 9.0126] w=0.1873 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)I227.CB) [> 4.0905 = 6.8174 < 8.8626] w=0.1863 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)Q116.CB) [> 3.9908 = 6.6513 < 8.6467] w=0.1860 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)A293.CB) [> 4.3835 = 7.3058 < 9.4975] w=0.1857 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)Q300.CB) [> 4.2020 = 7.0033 < 9.1043] w=0.1857 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)P299.CB) [> 2.7232 = 4.5386 < 5.9002] w=0.1856 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)A280.CB) [> 3.7615 = 6.2692 < 8.1500] w=0.1854 to align # Constraint # added constraint: constraint((T0333)F310.CB, (T0333)L337.CB) [> 3.9668 = 6.6113 < 8.5947] w=0.1846 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)Q309.CB) [> 3.6924 = 6.1540 < 8.0001] w=0.1846 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)N136.CB) [> 2.9687 = 4.9479 < 6.4322] w=0.1846 to align # Constraint # added constraint: constraint((T0333)T313.CB, (T0333)L337.CB) [> 3.7120 = 6.1867 < 8.0427] w=0.1843 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)A247.CB) [> 3.8730 = 6.4551 < 8.3916] w=0.1831 to align # Constraint # added constraint: constraint((T0333)A242.CB, (T0333)I341.CB) [> 4.0841 = 6.8069 < 8.8490] w=0.1825 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)L340.CB) [> 3.8017 = 6.3361 < 8.2370] w=0.1825 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)E115.CB) [> 3.8222 = 6.3703 < 8.2814] w=0.1821 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)A265.CB) [> 3.8767 = 6.4612 < 8.3996] w=0.1820 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)Y114.CB) [> 3.9196 = 6.5326 < 8.4924] w=0.1813 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)V318.CB) [> 3.8458 = 6.4096 < 8.3324] w=0.1809 to align # Constraint # added constraint: constraint((T0333)L340.CB, (T0333)A349.CB) [> 4.2974 = 7.1624 < 9.3111] w=0.1804 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)G285.CA) [> 3.4848 = 5.8081 < 7.5505] w=0.1802 to align # Constraint # added constraint: constraint((T0333)G285.CA, (T0333)Q309.CB) [> 3.5073 = 5.8454 < 7.5991] w=0.1801 to align # Constraint # added constraint: constraint((T0333)Y54.CB, (T0333)G99.CA) [> 3.0245 = 5.0409 < 6.5532] w=0.1800 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)Y107.CB) [> 3.9755 = 6.6259 < 8.6137] w=0.1798 to align # Constraint # added constraint: constraint((T0333)P206.CB, (T0333)A296.CB) [> 3.2769 = 5.4614 < 7.0999] w=0.1795 to align # Constraint # added constraint: constraint((T0333)P206.CB, (T0333)G297.CA) [> 2.9703 = 4.9504 < 6.4356] w=0.1795 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)A303.CB) [> 3.3475 = 5.5791 < 7.2529] w=0.1795 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)H284.CB) [> 4.1054 = 6.8424 < 8.8951] w=0.1787 to align # Constraint # added constraint: constraint((T0333)V240.CB, (T0333)R338.CB) [> 4.2141 = 7.0235 < 9.1306] w=0.1767 to align # Constraint # added constraint: constraint((T0333)T100.CB, (T0333)V112.CB) [> 4.1568 = 6.9280 < 9.0064] w=0.1763 to align # Constraint # added constraint: constraint((T0333)V48.CB, (T0333)L103.CB) [> 3.6048 = 6.0080 < 7.8104] w=0.1763 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)L302.CB) [> 4.4054 = 7.3423 < 9.5450] w=0.1762 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)L271.CB) [> 3.9222 = 6.5370 < 8.4981] w=0.1761 to align # Constraint # added constraint: constraint((T0333)A25.CB, (T0333)V371.CB) [> 3.6744 = 6.1241 < 7.9613] w=0.1759 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)P304.CB) [> 3.7050 = 6.1750 < 8.0275] w=0.1758 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)Y107.CB) [> 3.9392 = 6.5653 < 8.5349] w=0.1750 to align # Constraint # added constraint: constraint((T0333)I171.CB, (T0333)P193.CB) [> 3.6410 = 6.0683 < 7.8888] w=0.1749 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)V50.CB) [> 4.3667 = 7.2779 < 9.4612] w=0.1749 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)I227.CB) [> 4.3939 = 7.3231 < 9.5201] w=0.1748 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)Y194.CB) [> 3.9749 = 6.6249 < 8.6124] w=0.1744 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)L301.CB) [> 4.0841 = 6.8068 < 8.8488] w=0.1740 to align # Constraint # added constraint: constraint((T0333)R339.CB, (T0333)A349.CB) [> 3.3485 = 5.5808 < 7.2551] w=0.1739 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)Q300.CB) [> 3.1854 = 5.3090 < 6.9017] w=0.1735 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)H36.CB) [> 4.1748 = 6.9580 < 9.0453] w=0.1735 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)P299.CB) [> 3.9603 = 6.6006 < 8.5807] w=0.1734 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)H283.CB) [> 3.5720 = 5.9533 < 7.7392] w=0.1733 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V120.CB) [> 4.4008 = 7.3347 < 9.5351] w=0.1729 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)G285.CA) [> 3.8015 = 6.3358 < 8.2366] w=0.1726 to align # Constraint # added constraint: constraint((T0333)I294.CB, (T0333)M357.CB) [> 3.3797 = 5.6329 < 7.3227] w=0.1705 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)Q116.CB) [> 3.7634 = 6.2723 < 8.1540] w=0.1704 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)H283.CB) [> 4.2917 = 7.1528 < 9.2986] w=0.1697 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)Q134.CB) [> 3.8880 = 6.4800 < 8.4240] w=0.1696 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V33.CB) [> 3.3228 = 5.5380 < 7.1994] w=0.1691 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)G285.CA) [> 3.9622 = 6.6037 < 8.5848] w=0.1690 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)Q137.CB) [> 4.1602 = 6.9337 < 9.0138] w=0.1685 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)C278.CB) [> 3.0502 = 5.0837 < 6.6088] w=0.1679 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)A293.CB) [> 3.9111 = 6.5185 < 8.4740] w=0.1678 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)L302.CB) [> 3.9984 = 6.6639 < 8.6631] w=0.1674 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)P193.CB) [> 3.3668 = 5.6113 < 7.2947] w=0.1672 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)Q137.CB) [> 3.1959 = 5.3264 < 6.9244] w=0.1670 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)R135.CB) [> 4.0460 = 6.7433 < 8.7662] w=0.1670 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)V47.CB) [> 4.5690 = 7.6151 < 9.8996] w=0.1659 to align # Constraint # added constraint: constraint((T0333)G238.CA, (T0333)N262.CB) [> 3.8220 = 6.3701 < 8.2811] w=0.1643 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)T279.CB) [> 4.0142 = 6.6903 < 8.6974] w=0.1642 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)A280.CB) [> 4.1725 = 6.9541 < 9.0403] w=0.1642 to align # Constraint # added constraint: constraint((T0333)H272.CB, (T0333)A296.CB) [> 3.9631 = 6.6052 < 8.5868] w=0.1638 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)T289.CB) [> 3.8389 = 6.3981 < 8.3175] w=0.1637 to align # Constraint # added constraint: constraint((T0333)G226.CA, (T0333)H284.CB) [> 3.7003 = 6.1672 < 8.0174] w=0.1634 to align # Constraint # added constraint: constraint((T0333)P304.CB, (T0333)L325.CB) [> 3.9117 = 6.5195 < 8.4754] w=0.1632 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)P299.CB) [> 4.0079 = 6.6799 < 8.6838] w=0.1631 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)A34.CB) [> 3.6252 = 6.0420 < 7.8546] w=0.1628 to align # Constraint # added constraint: constraint((T0333)R94.CB, (T0333)A124.CB) [> 3.5568 = 5.9280 < 7.7064] w=0.1628 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)V282.CB) [> 3.9917 = 6.6528 < 8.6486] w=0.1623 to align # Constraint # added constraint: constraint((T0333)I171.CB, (T0333)G195.CA) [> 4.1921 = 6.9869 < 9.0829] w=0.1621 to align # Constraint # added constraint: constraint((T0333)L204.CB, (T0333)A296.CB) [> 3.4733 = 5.7889 < 7.5255] w=0.1613 to align # Constraint # added constraint: constraint((T0333)G287.CA, (T0333)R315.CB) [> 3.8186 = 6.3644 < 8.2737] w=0.1613 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)L302.CB) [> 2.8123 = 4.6872 < 6.0934] w=0.1613 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)L301.CB) [> 3.9985 = 6.6641 < 8.6634] w=0.1612 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)P299.CB) [> 2.8063 = 4.6772 < 6.0804] w=0.1612 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)D250.CB) [> 3.8495 = 6.4158 < 8.3406] w=0.1608 to align # Constraint # added constraint: constraint((T0333)I89.CB, (T0333)G121.CA) [> 3.8540 = 6.4233 < 8.3503] w=0.1587 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)V326.CB) [> 3.8881 = 6.4801 < 8.4241] w=0.1585 to align # Constraint # added constraint: constraint((T0333)A242.CB, (T0333)N262.CB) [> 4.2500 = 7.0833 < 9.2083] w=0.1584 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)I374.CB) [> 3.8031 = 6.3385 < 8.2401] w=0.1583 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)R347.CB) [> 3.6550 = 6.0916 < 7.9191] w=0.1583 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)R135.CB) [> 4.1802 = 6.9670 < 9.0571] w=0.1582 to align # Constraint # added constraint: constraint((T0333)N93.CB, (T0333)L123.CB) [> 3.4112 = 5.6853 < 7.3909] w=0.1576 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)V282.CB) [> 4.1109 = 6.8514 < 8.9069] w=0.1573 to align # Constraint # added constraint: constraint((T0333)H160.CB, (T0333)V192.CB) [> 3.6308 = 6.0514 < 7.8668] w=0.1573 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)L274.CB) [> 3.8528 = 6.4214 < 8.3478] w=0.1572 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)H36.CB) [> 3.2432 = 5.4054 < 7.0270] w=0.1572 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)L251.CB) [> 3.6365 = 6.0607 < 7.8790] w=0.1566 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)L96.CB) [> 3.9993 = 6.6655 < 8.6652] w=0.1564 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)A229.CB) [> 3.6831 = 6.1385 < 7.9800] w=0.1563 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)V282.CB) [> 3.2746 = 5.4577 < 7.0950] w=0.1562 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)V290.CB) [> 3.7141 = 6.1902 < 8.0472] w=0.1556 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)A293.CB) [> 4.3545 = 7.2575 < 9.4348] w=0.1556 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)A37.CB) [> 3.1607 = 5.2679 < 6.8482] w=0.1554 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)V281.CB) [> 4.3869 = 7.3115 < 9.5050] w=0.1554 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)E115.CB) [> 3.9793 = 6.6321 < 8.6217] w=0.1552 to align # Constraint # added constraint: constraint((T0333)P304.CB, (T0333)L337.CB) [> 4.5670 = 7.6116 < 9.8951] w=0.1552 to align # Constraint # added constraint: constraint((T0333)A229.CB, (T0333)D305.CB) [> 2.9427 = 4.9045 < 6.3758] w=0.1552 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)L302.CB) [> 4.0115 = 6.6859 < 8.6916] w=0.1552 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)P306.CB) [> 2.5222 = 4.2037 < 5.4648] w=0.1552 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)D305.CB) [> 3.8477 = 6.4128 < 8.3366] w=0.1552 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)G297.CA) [> 3.7418 = 6.2363 < 8.1072] w=0.1551 to align # Constraint # added constraint: constraint((T0333)A314.CB, (T0333)R338.CB) [> 4.1205 = 6.8675 < 8.9278] w=0.1549 to align # Constraint # added constraint: constraint((T0333)M291.CB, (T0333)R321.CB) [> 3.8212 = 6.3686 < 8.2792] w=0.1547 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)A237.CB) [> 4.2308 = 7.0513 < 9.1667] w=0.1528 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)V326.CB) [> 4.0028 = 6.6713 < 8.6726] w=0.1525 to align # Constraint # added constraint: constraint((T0333)T279.CB, (T0333)I341.CB) [> 3.7550 = 6.2583 < 8.1357] w=0.1522 to align # Constraint # added constraint: constraint((T0333)A237.CB, (T0333)V263.CB) [> 3.5430 = 5.9049 < 7.6764] w=0.1520 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)L153.CB) [> 3.4102 = 5.6836 < 7.3887] w=0.1519 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)L122.CB) [> 4.2059 = 7.0098 < 9.1128] w=0.1515 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V367.CB) [> 3.3643 = 5.6072 < 7.2894] w=0.1513 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)H36.CB) [> 4.2161 = 7.0268 < 9.1349] w=0.1512 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)E115.CB) [> 4.4771 = 7.4618 < 9.7003] w=0.1510 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)A118.CB) [> 3.7060 = 6.1768 < 8.0298] w=0.1507 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)A125.CB) [> 4.3845 = 7.3075 < 9.4998] w=0.1505 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)D308.CB) [> 3.7382 = 6.2304 < 8.0995] w=0.1495 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)L15.CB) [> 3.8954 = 6.4923 < 8.4399] w=0.1493 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)G285.CA) [> 4.1379 = 6.8965 < 8.9654] w=0.1491 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)R307.CB) [> 3.5152 = 5.8586 < 7.6162] w=0.1491 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)D305.CB) [> 4.0306 = 6.7176 < 8.7329] w=0.1491 to align # Constraint # added constraint: constraint((T0333)F13.CB, (T0333)D252.CB) [> 3.7086 = 6.1811 < 8.0354] w=0.1487 to align # Constraint # added constraint: constraint((T0333)G86.CA, (T0333)V120.CB) [> 3.5357 = 5.8929 < 7.6608] w=0.1464 to align # Constraint # added constraint: constraint((T0333)F22.CB, (T0333)V371.CB) [> 4.0172 = 6.6954 < 8.7040] w=0.1462 to align # Constraint # added constraint: constraint((T0333)T100.CB, (T0333)A125.CB) [> 4.3997 = 7.3328 < 9.5326] w=0.1462 to align # Constraint # added constraint: constraint((T0333)I294.CB, (T0333)V353.CB) [> 3.0712 = 5.1187 < 6.6543] w=0.1461 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)V112.CB) [> 4.3563 = 7.2606 < 9.4387] w=0.1458 to align # Constraint # added constraint: constraint((T0333)V92.CB, (T0333)V120.CB) [> 3.6179 = 6.0298 < 7.8387] w=0.1457 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)H160.CB) [> 3.2781 = 5.4635 < 7.1026] w=0.1454 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)L45.CB) [> 4.1134 = 6.8557 < 8.9124] w=0.1454 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)V192.CB) [> 3.7401 = 6.2335 < 8.1036] w=0.1452 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)H283.CB) [> 3.6926 = 6.1543 < 8.0006] w=0.1446 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)S327.CB) [> 3.9433 = 6.5722 < 8.5439] w=0.1446 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)H36.CB) [> 3.8433 = 6.4055 < 8.3271] w=0.1441 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)V282.CB) [> 4.0981 = 6.8302 < 8.8793] w=0.1440 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)A280.CB) [> 3.9670 = 6.6116 < 8.5951] w=0.1440 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)A280.CB) [> 4.1968 = 6.9946 < 9.0930] w=0.1440 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)Q137.CB) [> 3.1709 = 5.2848 < 6.8703] w=0.1440 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)S138.CB) [> 4.0878 = 6.8130 < 8.8569] w=0.1439 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)G297.CA) [> 4.5376 = 7.5627 < 9.8315] w=0.1436 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)V282.CB) [> 4.1585 = 6.9307 < 9.0100] w=0.1436 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)A132.CB) [> 3.9221 = 6.5368 < 8.4979] w=0.1435 to align # Constraint # added constraint: constraint((T0333)G226.CA, (T0333)P306.CB) [> 3.8229 = 6.3715 < 8.2830] w=0.1433 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)G117.CA) [> 4.3528 = 7.2547 < 9.4311] w=0.1432 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)I298.CB) [> 4.5328 = 7.5546 < 9.8210] w=0.1432 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)G228.CA) [> 3.4835 = 5.8059 < 7.5476] w=0.1431 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)T119.CB) [> 3.8742 = 6.4570 < 8.3941] w=0.1430 to align # Constraint # added constraint: constraint((T0333)I233.CB, (T0333)D305.CB) [> 3.2959 = 5.4932 < 7.1412] w=0.1430 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)L302.CB) [> 4.0833 = 6.8055 < 8.8472] w=0.1430 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)D38.CB) [> 3.6082 = 6.0137 < 7.8178] w=0.1430 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)L111.CB) [> 3.2724 = 5.4541 < 7.0903] w=0.1415 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)I374.CB) [> 3.4873 = 5.8121 < 7.5557] w=0.1402 to align # Constraint # added constraint: constraint((T0333)G297.CA, (T0333)R351.CB) [> 3.3108 = 5.5180 < 7.1734] w=0.1402 to align # Constraint # added constraint: constraint((T0333)A90.CB, (T0333)V120.CB) [> 3.4573 = 5.7622 < 7.4909] w=0.1398 to align # Constraint # added constraint: constraint((T0333)I89.CB, (T0333)T119.CB) [> 3.3556 = 5.5927 < 7.2705] w=0.1398 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)Q137.CB) [> 3.6830 = 6.1382 < 7.9797] w=0.1397 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)P14.CB) [> 4.1328 = 6.8880 < 8.9544] w=0.1396 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)T289.CB) [> 3.7561 = 6.2602 < 8.1383] w=0.1394 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)I323.CB) [> 4.3032 = 7.1719 < 9.3235] w=0.1394 to align # Constraint # added constraint: constraint((T0333)Q300.CB, (T0333)G322.CA) [> 3.3823 = 5.6372 < 7.3284] w=0.1394 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)R135.CB) [> 3.9398 = 6.5663 < 8.5362] w=0.1392 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)L248.CB) [> 3.5494 = 5.9156 < 7.6903] w=0.1387 to align # Constraint # added constraint: constraint((T0333)T100.CB, (T0333)R127.CB) [> 4.0441 = 6.7402 < 8.7622] w=0.1385 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)E35.CB) [> 3.9262 = 6.5436 < 8.5067] w=0.1382 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)G285.CA) [> 4.0695 = 6.7825 < 8.8173] w=0.1381 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)S138.CB) [> 3.4177 = 5.6962 < 7.4050] w=0.1380 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)G195.CA) [> 3.4296 = 5.7160 < 7.4308] w=0.1379 to align # Constraint # added constraint: constraint((T0333)V230.CB, (T0333)D305.CB) [> 3.6656 = 6.1094 < 7.9422] w=0.1372 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)S138.CB) [> 4.2458 = 7.0764 < 9.1993] w=0.1368 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V113.CB) [> 3.0687 = 5.1145 < 6.6488] w=0.1354 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)P193.CB) [> 3.6302 = 6.0503 < 7.8654] w=0.1345 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)L325.CB) [> 3.8967 = 6.4946 < 8.4429] w=0.1341 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)H283.CB) [> 4.1321 = 6.8869 < 8.9529] w=0.1340 to align # Constraint # added constraint: constraint((T0333)D295.CB, (T0333)R354.CB) [> 3.9893 = 6.6488 < 8.6435] w=0.1340 to align # Constraint # added constraint: constraint((T0333)A90.CB, (T0333)L123.CB) [> 3.4994 = 5.8323 < 7.5820] w=0.1337 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)I149.CB) [> 3.8537 = 6.4228 < 8.3497] w=0.1337 to align # Constraint # added constraint: constraint((T0333)I234.CB, (T0333)L256.CB) [> 3.8001 = 6.3334 < 8.2335] w=0.1336 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V113.CB) [> 3.8808 = 6.4679 < 8.4083] w=0.1336 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)T289.CB) [> 3.8317 = 6.3861 < 8.3019] w=0.1335 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)Q161.CB) [> 3.1763 = 5.2939 < 6.8820] w=0.1333 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)G322.CA) [> 4.0163 = 6.6939 < 8.7021] w=0.1333 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)K159.CB) [> 3.3085 = 5.5142 < 7.1684] w=0.1332 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)Q161.CB) [> 3.8664 = 6.4440 < 8.3772] w=0.1332 to align # Constraint # added constraint: constraint((T0333)R94.CB, (T0333)A128.CB) [> 3.4930 = 5.8216 < 7.5681] w=0.1328 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)G324.CA) [> 4.4062 = 7.3436 < 9.5467] w=0.1327 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)H284.CB) [> 3.6327 = 6.0546 < 7.8709] w=0.1325 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)G196.CA) [> 3.7313 = 6.2189 < 8.0846] w=0.1323 to align # Constraint # added constraint: constraint((T0333)S327.CB, (T0333)L337.CB) [> 3.8023 = 6.3372 < 8.2383] w=0.1316 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)Q300.CB) [> 4.4681 = 7.4468 < 9.6809] w=0.1311 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)D110.CB) [> 3.8579 = 6.4299 < 8.3589] w=0.1293 to align # Constraint # added constraint: constraint((T0333)H160.CB, (T0333)P193.CB) [> 3.6710 = 6.1184 < 7.9539] w=0.1284 to align # Constraint # added constraint: constraint((T0333)S163.CB, (T0333)G195.CA) [> 3.6608 = 6.1013 < 7.9317] w=0.1283 to align # Constraint # added constraint: constraint((T0333)R276.CB, (T0333)I298.CB) [> 3.9648 = 6.6080 < 8.5904] w=0.1280 to align # Constraint # added constraint: constraint((T0333)A236.CB, (T0333)L337.CB) [> 3.5878 = 5.9796 < 7.7735] w=0.1280 to align # Constraint # added constraint: constraint((T0333)I89.CB, (T0333)A124.CB) [> 3.5903 = 5.9839 < 7.7790] w=0.1279 to align # Constraint # added constraint: constraint((T0333)H272.CB, (T0333)T292.CB) [> 3.5660 = 5.9434 < 7.7264] w=0.1279 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)I149.CB) [> 3.5104 = 5.8506 < 7.6058] w=0.1276 to align # Constraint # added constraint: constraint((T0333)K159.CB, (T0333)W191.CB) [> 3.5666 = 5.9443 < 7.7276] w=0.1276 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)H160.CB) [> 4.1141 = 6.8568 < 8.9138] w=0.1275 to align # Constraint # added constraint: constraint((T0333)H27.CB, (T0333)D110.CB) [> 3.1420 = 5.2366 < 6.8076] w=0.1275 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)Y114.CB) [> 3.1625 = 5.2708 < 6.8521] w=0.1275 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V112.CB) [> 3.2354 = 5.3924 < 7.0101] w=0.1275 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)T328.CB) [> 4.1505 = 6.9176 < 8.9929] w=0.1275 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)Q161.CB) [> 3.9534 = 6.5890 < 8.5657] w=0.1272 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)Q161.CB) [> 3.9908 = 6.6513 < 8.6467] w=0.1271 to align # Constraint # added constraint: constraint((T0333)G21.CA, (T0333)V367.CB) [> 3.3432 = 5.5721 < 7.2437] w=0.1269 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)L271.CB) [> 3.9621 = 6.6035 < 8.5846] w=0.1269 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)I323.CB) [> 4.5845 = 7.6409 < 9.9331] w=0.1268 to align # Constraint # added constraint: constraint((T0333)P211.CB, (T0333)C278.CB) [> 3.9881 = 6.6469 < 8.6409] w=0.1267 to align # Constraint # added constraint: constraint((T0333)L325.CB, (T0333)L340.CB) [> 3.7747 = 6.2911 < 8.1785] w=0.1265 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)R321.CB) [> 4.4248 = 7.3747 < 9.5871] w=0.1262 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)A237.CB) [> 3.8138 = 6.3563 < 8.2632] w=0.1261 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)A293.CB) [> 3.3366 = 5.5609 < 7.2292] w=0.1259 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)Q137.CB) [> 4.1573 = 6.9288 < 9.0074] w=0.1258 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)V133.CB) [> 4.3045 = 7.1741 < 9.3263] w=0.1251 to align # Constraint # added constraint: constraint((T0333)V162.CB, (T0333)G195.CA) [> 3.9633 = 6.6055 < 8.5872] w=0.1222 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)V192.CB) [> 4.0373 = 6.7288 < 8.7474] w=0.1222 to align # Constraint # added constraint: constraint((T0333)I294.CB, (T0333)A350.CB) [> 3.7676 = 6.2793 < 8.1632] w=0.1219 to align # Constraint # added constraint: constraint((T0333)G195.CA, (T0333)T366.CB) [> 3.3128 = 5.5214 < 7.1778] w=0.1219 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)N136.CB) [> 3.9563 = 6.5938 < 8.5720] w=0.1217 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)L156.CB) [> 3.2145 = 5.3575 < 6.9647] w=0.1217 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)Q134.CB) [> 4.5154 = 7.5257 < 9.7834] w=0.1217 to align # Constraint # added constraint: constraint((T0333)G238.CA, (T0333)V263.CB) [> 4.1421 = 6.9036 < 8.9746] w=0.1217 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)I149.CB) [> 3.8005 = 6.3342 < 8.2345] w=0.1216 to align # Constraint # added constraint: constraint((T0333)P131.CB, (T0333)D158.CB) [> 3.1562 = 5.2604 < 6.8384] w=0.1216 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)I341.CB) [> 3.8136 = 6.3560 < 8.2628] w=0.1215 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)M157.CB) [> 3.0233 = 5.0388 < 6.5504] w=0.1215 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)P109.CB) [> 3.8054 = 6.3423 < 8.2450] w=0.1214 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)W268.CB) [> 4.1021 = 6.8369 < 8.8880] w=0.1213 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)V113.CB) [> 3.9308 = 6.5513 < 8.5167] w=0.1212 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)V162.CB) [> 3.5596 = 5.9326 < 7.7124] w=0.1211 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)I370.CB) [> 3.9134 = 6.5223 < 8.4790] w=0.1209 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)A32.CB) [> 3.5973 = 5.9955 < 7.7942] w=0.1209 to align # Constraint # added constraint: constraint((T0333)H27.CB, (T0333)V371.CB) [> 4.2153 = 7.0255 < 9.1332] w=0.1207 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)G117.CA) [> 3.6385 = 6.0641 < 7.8834] w=0.1198 to align # Constraint # added constraint: constraint((T0333)G297.CA, (T0333)R354.CB) [> 3.0130 = 5.0216 < 6.5281] w=0.1159 to align # Constraint # added constraint: constraint((T0333)I323.CB, (T0333)A350.CB) [> 3.5011 = 5.8352 < 7.5858] w=0.1159 to align # Constraint # added constraint: constraint((T0333)A237.CB, (T0333)L337.CB) [> 3.7533 = 6.2555 < 8.1321] w=0.1159 to align # Constraint # added constraint: constraint((T0333)G197.CA, (T0333)M291.CB) [> 3.7438 = 6.2397 < 8.1116] w=0.1158 to align # Constraint # added constraint: constraint((T0333)L96.CB, (T0333)V120.CB) [> 3.2959 = 5.4932 < 7.1411] w=0.1157 to align # Constraint # added constraint: constraint((T0333)L271.CB, (T0333)T289.CB) [> 4.0963 = 6.8272 < 8.8753] w=0.1157 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)T277.CB) [> 4.0690 = 6.7818 < 8.8163] w=0.1156 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)V281.CB) [> 4.0854 = 6.8090 < 8.8517] w=0.1156 to align # Constraint # added constraint: constraint((T0333)K159.CB, (T0333)P193.CB) [> 4.1509 = 6.9181 < 8.9935] w=0.1156 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)G195.CA) [> 3.8385 = 6.3975 < 8.3167] w=0.1156 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)D158.CB) [> 3.7894 = 6.3158 < 8.2105] w=0.1155 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)D158.CB) [> 3.4287 = 5.7145 < 7.4289] w=0.1155 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)K159.CB) [> 4.1510 = 6.9184 < 8.9939] w=0.1154 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)L325.CB) [> 3.4599 = 5.7665 < 7.4964] w=0.1154 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)L111.CB) [> 4.2501 = 7.0835 < 9.2086] w=0.1153 to align # Constraint # added constraint: constraint((T0333)Q300.CB, (T0333)V318.CB) [> 3.8263 = 6.3772 < 8.2903] w=0.1153 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)G286.CA) [> 3.7637 = 6.2728 < 8.1547] w=0.1152 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)S163.CB) [> 3.9932 = 6.6553 < 8.6518] w=0.1149 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)A303.CB) [> 3.7398 = 6.2330 < 8.1029] w=0.1147 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)Q134.CB) [> 3.3318 = 5.5530 < 7.2189] w=0.1146 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)D305.CB) [> 3.5417 = 5.9029 < 7.6737] w=0.1146 to align # Constraint # added constraint: constraint((T0333)V168.CB, (T0333)Y194.CB) [> 3.5695 = 5.9492 < 7.7339] w=0.1144 to align # Constraint # added constraint: constraint((T0333)T170.CB, (T0333)V192.CB) [> 3.7704 = 6.2840 < 8.1693] w=0.1144 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)V281.CB) [> 3.3861 = 5.6435 < 7.3366] w=0.1142 to align # Constraint # added constraint: constraint((T0333)I294.CB, (T0333)V318.CB) [> 4.3747 = 7.2911 < 9.4784] w=0.1142 to align # Constraint # added constraint: constraint((T0333)T170.CB, (T0333)W191.CB) [> 3.2719 = 5.4532 < 7.0891] w=0.1140 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)H284.CB) [> 4.3039 = 7.1732 < 9.3252] w=0.1140 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)H284.CB) [> 3.6260 = 6.0434 < 7.8564] w=0.1140 to align # Constraint # added constraint: constraint((T0333)L156.CB, (T0333)E166.CB) [> 2.9715 = 4.9526 < 6.4384] w=0.1140 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)Q116.CB) [> 3.7005 = 6.1676 < 8.0178] w=0.1139 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)H283.CB) [> 3.9488 = 6.5813 < 8.5557] w=0.1132 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)V282.CB) [> 3.1228 = 5.2046 < 6.7660] w=0.1132 to align # Constraint # added constraint: constraint((T0333)R190.CB, (T0333)V281.CB) [> 3.0286 = 5.0476 < 6.5619] w=0.1132 to align # Constraint # added constraint: constraint((T0333)M189.CB, (T0333)A280.CB) [> 2.9399 = 4.8998 < 6.3698] w=0.1132 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)Y194.CB) [> 3.9580 = 6.5967 < 8.5757] w=0.1101 to align # Constraint # added constraint: constraint((T0333)S163.CB, (T0333)G196.CA) [> 3.1865 = 5.3108 < 6.9041] w=0.1100 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)V290.CB) [> 4.4479 = 7.4131 < 9.6371] w=0.1098 to align # Constraint # added constraint: constraint((T0333)F13.CB, (T0333)G288.CA) [> 4.3597 = 7.2661 < 9.4459] w=0.1096 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)L156.CB) [> 3.8912 = 6.4854 < 8.4311] w=0.1095 to align # Constraint # added constraint: constraint((T0333)F225.CB, (T0333)H284.CB) [> 3.6312 = 6.0521 < 7.8677] w=0.1093 to align # Constraint # added constraint: constraint((T0333)D250.CB, (T0333)G267.CA) [> 4.0535 = 6.7558 < 8.7825] w=0.1093 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)D305.CB) [> 3.7277 = 6.2129 < 8.0767] w=0.1093 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)A118.CB) [> 4.2954 = 7.1590 < 9.3068] w=0.1091 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)A56.CB) [> 3.6791 = 6.1318 < 7.9714] w=0.1091 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)L246.CB) [> 4.3063 = 7.1771 < 9.3303] w=0.1091 to align # Constraint # added constraint: constraint((T0333)A25.CB, (T0333)V367.CB) [> 3.6151 = 6.0251 < 7.8327] w=0.1090 to align # Constraint # added constraint: constraint((T0333)E221.CB, (T0333)L251.CB) [> 3.7300 = 6.2167 < 8.0817] w=0.1090 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)W191.CB) [> 3.5067 = 5.8446 < 7.5979] w=0.1089 to align # Constraint # added constraint: constraint((T0333)V63.CB, (T0333)Q88.CB) [> 4.0203 = 6.7005 < 8.7107] w=0.1088 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)H283.CB) [> 4.5690 = 7.6149 < 9.8994] w=0.1088 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V50.CB) [> 3.6079 = 6.0132 < 7.8171] w=0.1086 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)R190.CB) [> 3.8417 = 6.4029 < 8.3237] w=0.1084 to align # Constraint # added constraint: constraint((T0333)E221.CB, (T0333)V230.CB) [> 4.3052 = 7.1753 < 9.3279] w=0.1082 to align # Constraint # added constraint: constraint((T0333)L360.CB, (T0333)R369.CB) [> 3.4715 = 5.7859 < 7.5217] w=0.1081 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)Y114.CB) [> 4.4033 = 7.3389 < 9.5406] w=0.1080 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)Y114.CB) [> 3.7730 = 6.2883 < 8.1748] w=0.1078 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)A150.CB) [> 3.7278 = 6.2129 < 8.0768] w=0.1076 to align # Constraint # added constraint: constraint((T0333)M291.CB, (T0333)V318.CB) [> 4.4269 = 7.3782 < 9.5916] w=0.1075 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)P306.CB) [> 3.0661 = 5.1101 < 6.6431] w=0.1074 to align # Constraint # added constraint: constraint((T0333)V168.CB, (T0333)G195.CA) [> 3.3061 = 5.5101 < 7.1632] w=0.1073 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)H283.CB) [> 3.3844 = 5.6406 < 7.3328] w=0.1072 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)V281.CB) [> 4.1516 = 6.9193 < 8.9951] w=0.1072 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)T76.CB) [> 3.5670 = 5.9451 < 7.7286] w=0.1072 to align # Constraint # added constraint: constraint((T0333)I234.CB, (T0333)T277.CB) [> 3.1487 = 5.2478 < 6.8222] w=0.1071 to align # Constraint # added constraint: constraint((T0333)L275.CB, (T0333)T289.CB) [> 4.5234 = 7.5391 < 9.8008] w=0.1045 to align # Constraint # added constraint: constraint((T0333)V162.CB, (T0333)P193.CB) [> 4.0879 = 6.8132 < 8.8572] w=0.1042 to align # Constraint # added constraint: constraint((T0333)L164.CB, (T0333)G196.CA) [> 3.8034 = 6.3389 < 8.2406] w=0.1040 to align # Constraint # added constraint: constraint((T0333)S163.CB, (T0333)Y194.CB) [> 4.0736 = 6.7894 < 8.8262] w=0.1040 to align # Constraint # added constraint: constraint((T0333)W85.CB, (T0333)V120.CB) [> 3.6715 = 6.1192 < 7.9550] w=0.1039 to align # Constraint # added constraint: constraint((T0333)V199.CB, (T0333)M291.CB) [> 3.4226 = 5.7043 < 7.4156] w=0.1037 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)A198.CB) [> 3.8063 = 6.3439 < 8.2470] w=0.1037 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)L346.CB) [> 3.4856 = 5.8093 < 7.5521] w=0.1037 to align # Constraint # added constraint: constraint((T0333)G324.CA, (T0333)A350.CB) [> 3.7524 = 6.2540 < 8.1302] w=0.1037 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)V133.CB) [> 4.1670 = 6.9450 < 9.0285] w=0.1036 to align # Constraint # added constraint: constraint((T0333)D295.CB, (T0333)M357.CB) [> 3.5218 = 5.8697 < 7.6306] w=0.1036 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)R135.CB) [> 4.0225 = 6.7042 < 8.7154] w=0.1035 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)L153.CB) [> 3.3430 = 5.5716 < 7.2431] w=0.1035 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)R373.CB) [> 4.0396 = 6.7327 < 8.7525] w=0.1035 to align # Constraint # added constraint: constraint((T0333)D158.CB, (T0333)W191.CB) [> 3.6711 = 6.1185 < 7.9540] w=0.1034 to align # Constraint # added constraint: constraint((T0333)I253.CB, (T0333)A265.CB) [> 3.7690 = 6.2818 < 8.1663] w=0.1034 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)L153.CB) [> 3.5132 = 5.8554 < 7.6120] w=0.1033 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)M157.CB) [> 3.8824 = 6.4707 < 8.4119] w=0.1033 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)L111.CB) [> 4.5317 = 7.5529 < 9.8187] w=0.1032 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)L45.CB) [> 4.3993 = 7.3321 < 9.5317] w=0.1032 to align # Constraint # added constraint: constraint((T0333)E231.CB, (T0333)L256.CB) [> 3.7897 = 6.3161 < 8.2109] w=0.1032 to align # Constraint # added constraint: constraint((T0333)F225.CB, (T0333)L248.CB) [> 4.2657 = 7.1096 < 9.2425] w=0.1032 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)I149.CB) [> 3.8033 = 6.3388 < 8.2404] w=0.1032 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)E115.CB) [> 4.1057 = 6.8428 < 8.8957] w=0.1031 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)Q134.CB) [> 4.1738 = 6.9563 < 9.0432] w=0.1031 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)S327.CB) [> 3.5135 = 5.8558 < 7.6125] w=0.1030 to align # Constraint # added constraint: constraint((T0333)V162.CB, (T0333)I171.CB) [> 3.6397 = 6.0662 < 7.8860] w=0.1030 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)A56.CB) [> 4.0416 = 6.7361 < 8.7569] w=0.1020 to align # Constraint # added constraint: constraint((T0333)R190.CB, (T0333)L204.CB) [> 3.6974 = 6.1623 < 8.0110] w=0.1018 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)E35.CB) [> 3.2535 = 5.4225 < 7.0493] w=0.1018 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)P306.CB) [> 4.2623 = 7.1038 < 9.2350] w=0.1016 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)Q137.CB) [> 4.1118 = 6.8529 < 8.9088] w=0.1016 to align # Constraint # added constraint: constraint((T0333)P175.CB, (T0333)F188.CB) [> 3.7130 = 6.1883 < 8.0447] w=0.1015 to align # Constraint # added constraint: constraint((T0333)P175.CB, (T0333)R190.CB) [> 3.4763 = 5.7939 < 7.5321] w=0.1013 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)A75.CB) [> 3.7727 = 6.2879 < 8.1743] w=0.1012 to align # Constraint # added constraint: constraint((T0333)A235.CB, (T0333)T277.CB) [> 4.1998 = 6.9997 < 9.0997] w=0.1011 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)H36.CB) [> 3.3832 = 5.6387 < 7.3303] w=0.1004 to align # Constraint # added constraint: constraint((T0333)P232.CB, (T0333)S329.CB) [> 3.1004 = 5.1673 < 6.7175] w=0.0976 to align # Constraint # added constraint: constraint((T0333)V199.CB, (T0333)T292.CB) [> 3.6948 = 6.1581 < 8.0055] w=0.0976 to align # Constraint # added constraint: constraint((T0333)G10.CA, (T0333)G288.CA) [> 3.8880 = 6.4800 < 8.4240] w=0.0976 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)G197.CA) [> 4.2332 = 7.0554 < 9.1720] w=0.0976 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)A198.CB) [> 3.3100 = 5.5166 < 7.1716] w=0.0976 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V59.CB) [> 3.3766 = 5.6276 < 7.3159] w=0.0976 to align # Constraint # added constraint: constraint((T0333)L164.CB, (T0333)Y194.CB) [> 3.9244 = 6.5406 < 8.5028] w=0.0976 to align # Constraint # added constraint: constraint((T0333)F22.CB, (T0333)I370.CB) [> 4.3235 = 7.2058 < 9.3676] w=0.0974 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)M157.CB) [> 3.0409 = 5.0681 < 6.5886] w=0.0973 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)I374.CB) [> 3.4446 = 5.7410 < 7.4632] w=0.0973 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V112.CB) [> 4.3007 = 7.1679 < 9.3183] w=0.0972 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)Q134.CB) [> 3.7493 = 6.2488 < 8.1235] w=0.0972 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V113.CB) [> 4.2289 = 7.0482 < 9.1627] w=0.0971 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)E115.CB) [> 3.4758 = 5.7929 < 7.5308] w=0.0970 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)V245.CB) [> 4.4043 = 7.3404 < 9.5426] w=0.0969 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)V266.CB) [> 4.0425 = 6.7375 < 8.7587] w=0.0967 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)T366.CB) [> 4.0321 = 6.7201 < 8.7361] w=0.0964 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)Q137.CB) [> 3.7657 = 6.2761 < 8.1589] w=0.0964 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)V57.CB) [> 4.1901 = 6.9834 < 9.0784] w=0.0962 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)A139.CB) [> 3.8572 = 6.4287 < 8.3573] w=0.0962 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V50.CB) [> 4.0396 = 6.7326 < 8.7524] w=0.0961 to align # Constraint # added constraint: constraint((T0333)G10.CA, (T0333)A118.CB) [> 4.6044 = 7.6739 < 9.9761] w=0.0960 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)E35.CB) [> 4.1636 = 6.9393 < 9.0211] w=0.0959 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)R141.CB) [> 3.2424 = 5.4041 < 7.0253] w=0.0958 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)E221.CB) [> 4.4734 = 7.4556 < 9.6923] w=0.0957 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)V120.CB) [> 3.6213 = 6.0355 < 7.8462] w=0.0956 to align # Constraint # added constraint: constraint((T0333)V168.CB, (T0333)G196.CA) [> 4.0146 = 6.6910 < 8.6983] w=0.0956 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)Q137.CB) [> 2.9397 = 4.8995 < 6.3693] w=0.0956 to align # Constraint # added constraint: constraint((T0333)F188.CB, (T0333)L204.CB) [> 4.3286 = 7.2143 < 9.3786] w=0.0955 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)N67.CB) [> 3.6855 = 6.1425 < 7.9852] w=0.0954 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)A139.CB) [> 3.2321 = 5.3868 < 7.0029] w=0.0954 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)S138.CB) [> 4.1646 = 6.9411 < 9.0234] w=0.0953 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)R77.CB) [> 3.6671 = 6.1119 < 7.9455] w=0.0951 to align # Constraint # added constraint: constraint((T0333)V162.CB, (T0333)Y194.CB) [> 3.4601 = 5.7668 < 7.4968] w=0.0921 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)V59.CB) [> 3.8544 = 6.4240 < 8.3512] w=0.0917 to align # Constraint # added constraint: constraint((T0333)G322.CA, (T0333)A349.CB) [> 3.9011 = 6.5019 < 8.4525] w=0.0915 to align # Constraint # added constraint: constraint((T0333)V199.CB, (T0333)D295.CB) [> 3.7216 = 6.2026 < 8.0634] w=0.0915 to align # Constraint # added constraint: constraint((T0333)E239.CB, (T0333)A334.CB) [> 3.4724 = 5.7874 < 7.5236] w=0.0915 to align # Constraint # added constraint: constraint((T0333)G286.CA, (T0333)R307.CB) [> 3.6993 = 6.1656 < 8.0152] w=0.0915 to align # Constraint # added constraint: constraint((T0333)H160.CB, (T0333)W191.CB) [> 3.9075 = 6.5126 < 8.4663] w=0.0915 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)V282.CB) [> 4.3226 = 7.2044 < 9.3657] w=0.0914 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)A56.CB) [> 3.8463 = 6.4105 < 8.3337] w=0.0914 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)V33.CB) [> 3.4595 = 5.7659 < 7.4956] w=0.0914 to align # Constraint # added constraint: constraint((T0333)A237.CB, (T0333)A334.CB) [> 3.4715 = 5.7858 < 7.5215] w=0.0914 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)F152.CB) [> 3.3784 = 5.6307 < 7.3199] w=0.0914 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)Q134.CB) [> 3.7412 = 6.2353 < 8.1059] w=0.0914 to align # Constraint # added constraint: constraint((T0333)A25.CB, (T0333)R368.CB) [> 3.5589 = 5.9314 < 7.7109] w=0.0914 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)A303.CB) [> 4.1905 = 6.9842 < 9.0794] w=0.0913 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)R135.CB) [> 3.7219 = 6.2032 < 8.0641] w=0.0913 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)L274.CB) [> 3.9214 = 6.5357 < 8.4964] w=0.0912 to align # Constraint # added constraint: constraint((T0333)S163.CB, (T0333)G197.CA) [> 3.6131 = 6.0219 < 7.8285] w=0.0912 to align # Constraint # added constraint: constraint((T0333)K159.CB, (T0333)V192.CB) [> 3.8496 = 6.4159 < 8.3407] w=0.0912 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)F152.CB) [> 3.7120 = 6.1867 < 8.0428] w=0.0912 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)I149.CB) [> 3.6672 = 6.1120 < 7.9456] w=0.0912 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)L18.CB) [> 3.8004 = 6.3340 < 8.2343] w=0.0911 to align # Constraint # added constraint: constraint((T0333)V162.CB, (T0333)G196.CA) [> 4.1688 = 6.9481 < 9.0325] w=0.0911 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)H160.CB) [> 4.0803 = 6.8006 < 8.8407] w=0.0911 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)E172.CB) [> 3.2626 = 5.4377 < 7.0690] w=0.0910 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)V168.CB) [> 3.4650 = 5.7750 < 7.5075] w=0.0910 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)K159.CB) [> 4.0840 = 6.8067 < 8.8488] w=0.0909 to align # Constraint # added constraint: constraint((T0333)I294.CB, (T0333)G324.CA) [> 4.5236 = 7.5394 < 9.8012] w=0.0907 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)S163.CB) [> 3.6396 = 6.0660 < 7.8858] w=0.0906 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)A139.CB) [> 4.2466 = 7.0776 < 9.2009] w=0.0905 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V57.CB) [> 3.9919 = 6.6531 < 8.6490] w=0.0903 to align # Constraint # added constraint: constraint((T0333)I227.CB, (T0333)L256.CB) [> 3.6501 = 6.0834 < 7.9085] w=0.0902 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)E35.CB) [> 4.5957 = 7.6595 < 9.9573] w=0.0900 to align # Constraint # added constraint: constraint((T0333)F13.CB, (T0333)L271.CB) [> 3.0459 = 5.0764 < 6.5994] w=0.0900 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)R190.CB) [> 3.7871 = 6.3118 < 8.2054] w=0.0899 to align # Constraint # added constraint: constraint((T0333)L153.CB, (T0333)E166.CB) [> 2.9067 = 4.8444 < 6.2978] w=0.0896 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)V318.CB) [> 4.0757 = 6.7928 < 8.8306] w=0.0896 to align # Constraint # added constraint: constraint((T0333)L153.CB, (T0333)P167.CB) [> 3.8966 = 6.4944 < 8.4427] w=0.0896 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)H146.CB) [> 3.3105 = 5.5174 < 7.1726] w=0.0896 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)V318.CB) [> 4.0382 = 6.7304 < 8.7495] w=0.0896 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)P306.CB) [> 3.3752 = 5.6254 < 7.3130] w=0.0894 to align # Constraint # added constraint: constraint((T0333)R190.CB, (T0333)A280.CB) [> 4.3574 = 7.2624 < 9.4411] w=0.0893 to align # Constraint # added constraint: constraint((T0333)D155.CB, (T0333)P165.CB) [> 4.2453 = 7.0754 < 9.1980] w=0.0892 to align # Constraint # added constraint: constraint((T0333)I227.CB, (T0333)P306.CB) [> 4.1600 = 6.9334 < 9.0134] w=0.0891 to align # Constraint # added constraint: constraint((T0333)L222.CB, (T0333)R307.CB) [> 3.1979 = 5.3299 < 6.9288] w=0.0891 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)T277.CB) [> 3.8230 = 6.3717 < 8.2831] w=0.0891 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)S138.CB) [> 4.1882 = 6.9804 < 9.0745] w=0.0882 to align # Constraint # added constraint: constraint((T0333)I323.CB, (T0333)V353.CB) [> 3.1998 = 5.3330 < 6.9330] w=0.0854 to align # Constraint # added constraint: constraint((T0333)V326.CB, (T0333)L336.CB) [> 3.6554 = 6.0923 < 7.9200] w=0.0854 to align # Constraint # added constraint: constraint((T0333)G197.CA, (T0333)P363.CB) [> 3.6270 = 6.0450 < 7.8585] w=0.0854 to align # Constraint # added constraint: constraint((T0333)I298.CB, (T0333)A350.CB) [> 3.6612 = 6.1020 < 7.9325] w=0.0854 to align # Constraint # added constraint: constraint((T0333)V92.CB, (T0333)T119.CB) [> 3.2795 = 5.4659 < 7.1057] w=0.0853 to align # Constraint # added constraint: constraint((T0333)Q17.CB, (T0333)P363.CB) [> 3.4900 = 5.8167 < 7.5617] w=0.0853 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)I370.CB) [> 4.0357 = 6.7262 < 8.7441] w=0.0853 to align # Constraint # added constraint: constraint((T0333)D295.CB, (T0333)V358.CB) [> 4.0283 = 6.7139 < 8.7280] w=0.0853 to align # Constraint # added constraint: constraint((T0333)M291.CB, (T0333)M357.CB) [> 3.7033 = 6.1722 < 8.0239] w=0.0853 to align # Constraint # added constraint: constraint((T0333)L256.CB, (T0333)A265.CB) [> 3.8163 = 6.3605 < 8.2687] w=0.0853 to align # Constraint # added constraint: constraint((T0333)G10.CA, (T0333)V33.CB) [> 3.3428 = 5.5713 < 7.2427] w=0.0852 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)T366.CB) [> 3.4131 = 5.6885 < 7.3950] w=0.0852 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)I31.CB) [> 4.5027 = 7.5045 < 9.7559] w=0.0851 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)S163.CB) [> 4.1921 = 6.9869 < 9.0829] w=0.0850 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)V162.CB) [> 3.2717 = 5.4528 < 7.0887] w=0.0850 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)L164.CB) [> 3.7145 = 6.1908 < 8.0480] w=0.0850 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)Q137.CB) [> 3.6311 = 6.0518 < 7.8674] w=0.0850 to align # Constraint # added constraint: constraint((T0333)D250.CB, (T0333)W268.CB) [> 3.9591 = 6.5985 < 8.5781] w=0.0849 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)A32.CB) [> 4.5883 = 7.6471 < 9.9412] w=0.0849 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)I16.CB) [> 4.1812 = 6.9687 < 9.0593] w=0.0849 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V120.CB) [> 3.9218 = 6.5363 < 8.4972] w=0.0848 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)H160.CB) [> 4.1442 = 6.9070 < 8.9791] w=0.0848 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)S163.CB) [> 3.8609 = 6.4348 < 8.3653] w=0.0846 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)L325.CB) [> 3.5751 = 5.9584 < 7.7460] w=0.0843 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)V240.CB) [> 4.2259 = 7.0431 < 9.1560] w=0.0842 to align # Constraint # added constraint: constraint((T0333)T154.CB, (T0333)P167.CB) [> 4.2695 = 7.1159 < 9.2507] w=0.0842 to align # Constraint # added constraint: constraint((T0333)F225.CB, (T0333)P306.CB) [> 3.2433 = 5.4054 < 7.0271] w=0.0841 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V57.CB) [> 3.7276 = 6.2127 < 8.0765] w=0.0840 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)D308.CB) [> 3.5469 = 5.9114 < 7.6849] w=0.0840 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)A34.CB) [> 4.2286 = 7.0477 < 9.1620] w=0.0839 to align # Constraint # added constraint: constraint((T0333)T154.CB, (T0333)P165.CB) [> 3.8389 = 6.3982 < 8.3177] w=0.0835 to align # Constraint # added constraint: constraint((T0333)L153.CB, (T0333)P165.CB) [> 4.5320 = 7.5534 < 9.8194] w=0.0835 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)G197.CA) [> 3.2023 = 5.3371 < 6.9382] w=0.0835 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)Q223.CB) [> 4.0009 = 6.6681 < 8.6686] w=0.0835 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)W140.CB) [> 2.4911 = 4.1519 < 5.3975] w=0.0835 to align # Constraint # added constraint: constraint((T0333)R190.CB, (T0333)V282.CB) [> 4.3411 = 7.2352 < 9.4057] w=0.0834 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)P306.CB) [> 4.3459 = 7.2432 < 9.4161] w=0.0833 to align # Constraint # added constraint: constraint((T0333)A43.CB, (T0333)D106.CB) [> 4.3218 = 7.2029 < 9.3638] w=0.0822 to align # Constraint # added constraint: constraint((T0333)V162.CB, (T0333)V192.CB) [> 3.7636 = 6.2727 < 8.1545] w=0.0799 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)T366.CB) [> 3.8048 = 6.3413 < 8.2437] w=0.0793 to align # Constraint # added constraint: constraint((T0333)P211.CB, (T0333)I341.CB) [> 4.1422 = 6.9036 < 8.9747] w=0.0793 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)V162.CB) [> 4.0755 = 6.7925 < 8.8303] w=0.0793 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)N136.CB) [> 3.4550 = 5.7584 < 7.4859] w=0.0792 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)I374.CB) [> 4.0658 = 6.7763 < 8.8092] w=0.0791 to align # Constraint # added constraint: constraint((T0333)P131.CB, (T0333)K159.CB) [> 4.4013 = 7.3355 < 9.5361] w=0.0791 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)R108.CB) [> 3.9266 = 6.5443 < 8.5076] w=0.0790 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)E35.CB) [> 4.1709 = 6.9515 < 9.0369] w=0.0790 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)G117.CA) [> 4.1638 = 6.9396 < 9.0215] w=0.0790 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)V162.CB) [> 4.0193 = 6.6988 < 8.7084] w=0.0789 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)T142.CB) [> 3.7791 = 6.2986 < 8.1881] w=0.0789 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)V133.CB) [> 4.2290 = 7.0484 < 9.1629] w=0.0789 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)A56.CB) [> 3.8242 = 6.3736 < 8.2857] w=0.0788 to align # Constraint # added constraint: constraint((T0333)R315.CB, (T0333)V326.CB) [> 3.6339 = 6.0565 < 7.8734] w=0.0788 to align # Constraint # added constraint: constraint((T0333)A64.CB, (T0333)Q88.CB) [> 3.8669 = 6.4448 < 8.3783] w=0.0786 to align # Constraint # added constraint: constraint((T0333)A139.CB, (T0333)L164.CB) [> 4.2153 = 7.0254 < 9.1331] w=0.0786 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)R261.CB) [> 3.7821 = 6.3035 < 8.1946] w=0.0785 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)T119.CB) [> 3.9114 = 6.5190 < 8.4747] w=0.0784 to align # Constraint # added constraint: constraint((T0333)M291.CB, (T0333)E316.CB) [> 4.2758 = 7.1263 < 9.2642] w=0.0784 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)I370.CB) [> 3.9419 = 6.5699 < 8.5408] w=0.0781 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)D330.CB) [> 4.5122 = 7.5204 < 9.7765] w=0.0778 to align # Constraint # added constraint: constraint((T0333)L180.CB, (T0333)M189.CB) [> 3.7087 = 6.1812 < 8.0356] w=0.0777 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)E35.CB) [> 3.9675 = 6.6125 < 8.5962] w=0.0777 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)R141.CB) [> 4.3136 = 7.1893 < 9.3461] w=0.0776 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)G324.CA) [> 3.6039 = 6.0065 < 7.8085] w=0.0776 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V59.CB) [> 4.0529 = 6.7548 < 8.7812] w=0.0776 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V59.CB) [> 3.7477 = 6.2462 < 8.1201] w=0.0776 to align # Constraint # added constraint: constraint((T0333)P167.CB, (T0333)D295.CB) [> 4.2658 = 7.1097 < 9.2426] w=0.0774 to align # Constraint # added constraint: constraint((T0333)P167.CB, (T0333)T292.CB) [> 3.8836 = 6.4727 < 8.4145] w=0.0774 to align # Constraint # added constraint: constraint((T0333)A150.CB, (T0333)M291.CB) [> 4.4633 = 7.4388 < 9.6705] w=0.0774 to align # Constraint # added constraint: constraint((T0333)A150.CB, (T0333)G288.CA) [> 4.1113 = 6.8521 < 8.9077] w=0.0774 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)H146.CB) [> 4.3890 = 7.3150 < 9.5095] w=0.0774 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V120.CB) [> 4.5202 = 7.5337 < 9.7938] w=0.0774 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)A198.CB) [> 2.5303 = 4.2172 < 5.4824] w=0.0774 to align # Constraint # added constraint: constraint((T0333)L222.CB, (T0333)D308.CB) [> 3.7726 = 6.2877 < 8.1740] w=0.0774 to align # Constraint # added constraint: constraint((T0333)G287.CA, (T0333)V318.CB) [> 4.1050 = 6.8417 < 8.8943] w=0.0774 to align # Constraint # added constraint: constraint((T0333)M291.CB, (T0333)I323.CB) [> 4.3612 = 7.2686 < 9.4492] w=0.0774 to align # Constraint # added constraint: constraint((T0333)A317.CB, (T0333)S329.CB) [> 4.6483 = 7.7471 < 10.0712] w=0.0774 to align # Constraint # added constraint: constraint((T0333)S319.CB, (T0333)T328.CB) [> 4.5686 = 7.6143 < 9.8986] w=0.0774 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)R203.CB) [> 4.1400 = 6.9001 < 8.9701] w=0.0774 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)V48.CB) [> 3.6425 = 6.0708 < 7.8920] w=0.0773 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)L325.CB) [> 3.7173 = 6.1955 < 8.0542] w=0.0771 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)E115.CB) [> 4.1486 = 6.9143 < 8.9886] w=0.0741 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)L30.CB) [> 3.9160 = 6.5267 < 8.4847] w=0.0737 to align # Constraint # added constraint: constraint((T0333)L164.CB, (T0333)G197.CA) [> 3.9450 = 6.5751 < 8.5476] w=0.0735 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)M145.CB) [> 3.7463 = 6.2438 < 8.1169] w=0.0735 to align # Constraint # added constraint: constraint((T0333)L82.CB, (T0333)T119.CB) [> 3.0191 = 5.0318 < 6.5414] w=0.0733 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)G288.CA) [> 4.4913 = 7.4856 < 9.7312] w=0.0732 to align # Constraint # added constraint: constraint((T0333)V199.CB, (T0333)G288.CA) [> 4.1636 = 6.9394 < 9.0212] w=0.0732 to align # Constraint # added constraint: constraint((T0333)G195.CA, (T0333)V367.CB) [> 3.6437 = 6.0729 < 7.8948] w=0.0732 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)I370.CB) [> 3.6189 = 6.0315 < 7.8409] w=0.0732 to align # Constraint # added constraint: constraint((T0333)D305.CB, (T0333)V326.CB) [> 3.7094 = 6.1824 < 8.0371] w=0.0732 to align # Constraint # added constraint: constraint((T0333)F13.CB, (T0333)V199.CB) [> 4.1994 = 6.9990 < 9.0987] w=0.0732 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)R135.CB) [> 4.2078 = 7.0131 < 9.1170] w=0.0731 to align # Constraint # added constraint: constraint((T0333)G21.CA, (T0333)A364.CB) [> 3.5345 = 5.8908 < 7.6580] w=0.0731 to align # Constraint # added constraint: constraint((T0333)P299.CB, (T0333)R354.CB) [> 3.8648 = 6.4414 < 8.3738] w=0.0731 to align # Constraint # added constraint: constraint((T0333)G197.CA, (T0333)G288.CA) [> 4.0887 = 6.8145 < 8.8588] w=0.0730 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)Q134.CB) [> 2.9995 = 4.9992 < 6.4989] w=0.0730 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V133.CB) [> 3.9659 = 6.6097 < 8.5927] w=0.0730 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)Q134.CB) [> 3.7288 = 6.2147 < 8.0791] w=0.0730 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)A132.CB) [> 3.6808 = 6.1346 < 7.9750] w=0.0730 to align # Constraint # added constraint: constraint((T0333)T279.CB, (T0333)R347.CB) [> 4.2624 = 7.1039 < 9.2351] w=0.0729 to align # Constraint # added constraint: constraint((T0333)P304.CB, (T0333)T328.CB) [> 3.7741 = 6.2901 < 8.1772] w=0.0727 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)L274.CB) [> 3.7350 = 6.2251 < 8.0926] w=0.0727 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)A265.CB) [> 4.0411 = 6.7352 < 8.7557] w=0.0726 to align # Constraint # added constraint: constraint((T0333)N67.CB, (T0333)Q88.CB) [> 3.6328 = 6.0547 < 7.8711] w=0.0726 to align # Constraint # added constraint: constraint((T0333)E231.CB, (T0333)L246.CB) [> 4.3517 = 7.2529 < 9.4287] w=0.0724 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)Y54.CB) [> 4.4213 = 7.3688 < 9.5794] w=0.0723 to align # Constraint # added constraint: constraint((T0333)L82.CB, (T0333)A118.CB) [> 4.3113 = 7.1855 < 9.3412] w=0.0723 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)Q137.CB) [> 3.9638 = 6.6063 < 8.5882] w=0.0721 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)L325.CB) [> 4.2766 = 7.1277 < 9.2661] w=0.0720 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)F60.CB) [> 3.3744 = 5.6239 < 7.3111] w=0.0719 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)V282.CB) [> 3.2899 = 5.4833 < 7.1282] w=0.0718 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)A280.CB) [> 4.5105 = 7.5175 < 9.7728] w=0.0718 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)T279.CB) [> 4.2242 = 7.0403 < 9.1524] w=0.0718 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)T142.CB) [> 4.2164 = 7.0273 < 9.1355] w=0.0718 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)M189.CB) [> 3.9391 = 6.5651 < 8.5347] w=0.0717 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)T292.CB) [> 3.9266 = 6.5443 < 8.5076] w=0.0717 to align # Constraint # added constraint: constraint((T0333)M291.CB, (T0333)S319.CB) [> 3.5299 = 5.8832 < 7.6481] w=0.0717 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)I323.CB) [> 3.3387 = 5.5645 < 7.2338] w=0.0717 to align # Constraint # added constraint: constraint((T0333)F310.CB, (T0333)V326.CB) [> 3.7557 = 6.2596 < 8.1374] w=0.0717 to align # Constraint # added constraint: constraint((T0333)G287.CA, (T0333)R321.CB) [> 4.7306 = 7.8843 < 10.2496] w=0.0715 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)T73.CB) [> 3.1590 = 5.2651 < 6.8446] w=0.0711 to align # Constraint # added constraint: constraint((T0333)F13.CB, (T0333)N67.CB) [> 3.4199 = 5.6999 < 7.4099] w=0.0710 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)E72.CB) [> 4.1079 = 6.8465 < 8.9004] w=0.0710 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)A71.CB) [> 4.1553 = 6.9255 < 9.0032] w=0.0710 to align # Constraint # added constraint: constraint((T0333)L222.CB, (T0333)G249.CA) [> 3.7743 = 6.2906 < 8.1777] w=0.0682 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)F60.CB) [> 3.9096 = 6.5160 < 8.4708] w=0.0682 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)H146.CB) [> 3.6731 = 6.1219 < 7.9584] w=0.0675 to align # Constraint # added constraint: constraint((T0333)P165.CB, (T0333)G196.CA) [> 3.7511 = 6.2519 < 8.1275] w=0.0675 to align # Constraint # added constraint: constraint((T0333)W85.CB, (T0333)T119.CB) [> 3.0128 = 5.0213 < 6.5278] w=0.0673 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)G287.CA) [> 3.7415 = 6.2358 < 8.1065] w=0.0671 to align # Constraint # added constraint: constraint((T0333)G10.CA, (T0333)G287.CA) [> 4.2927 = 7.1544 < 9.3008] w=0.0671 to align # Constraint # added constraint: constraint((T0333)L204.CB, (T0333)V266.CB) [> 4.0035 = 6.6725 < 8.6743] w=0.0671 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)T273.CB) [> 3.6432 = 6.0720 < 7.8936] w=0.0671 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)V367.CB) [> 3.6786 = 6.1311 < 7.9704] w=0.0671 to align # Constraint # added constraint: constraint((T0333)R321.CB, (T0333)V353.CB) [> 3.3432 = 5.5719 < 7.2435] w=0.0671 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)R369.CB) [> 4.0778 = 6.7964 < 8.8353] w=0.0671 to align # Constraint # added constraint: constraint((T0333)G195.CA, (T0333)I370.CB) [> 4.3556 = 7.2593 < 9.4371] w=0.0671 to align # Constraint # added constraint: constraint((T0333)G322.CA, (T0333)V353.CB) [> 3.9350 = 6.5583 < 8.5258] w=0.0671 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)L248.CB) [> 4.5722 = 7.6204 < 9.9065] w=0.0671 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)T154.CB) [> 3.8811 = 6.4685 < 8.4091] w=0.0671 to align # Constraint # added constraint: constraint((T0333)G195.CA, (T0333)P363.CB) [> 3.1586 = 5.2643 < 6.8436] w=0.0671 to align # Constraint # added constraint: constraint((T0333)A209.CB, (T0333)D243.CB) [> 3.7599 = 6.2664 < 8.1464] w=0.0671 to align # Constraint # added constraint: constraint((T0333)P165.CB, (T0333)Y194.CB) [> 3.5308 = 5.8847 < 7.6501] w=0.0671 to align # Constraint # added constraint: constraint((T0333)P131.CB, (T0333)I374.CB) [> 3.8040 = 6.3401 < 8.2421] w=0.0671 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)N136.CB) [> 4.3159 = 7.1931 < 9.3511] w=0.0671 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)A118.CB) [> 2.7502 = 4.5837 < 5.9588] w=0.0670 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)Q134.CB) [> 3.7348 = 6.2246 < 8.0920] w=0.0670 to align # Constraint # added constraint: constraint((T0333)G10.CA, (T0333)I31.CB) [> 3.1849 = 5.3081 < 6.9006] w=0.0670 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)Q134.CB) [> 3.8660 = 6.4433 < 8.3762] w=0.0670 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)N136.CB) [> 3.5338 = 5.8896 < 7.6565] w=0.0670 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)Q134.CB) [> 4.0469 = 6.7449 < 8.7684] w=0.0669 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)A132.CB) [> 4.0390 = 6.7317 < 8.7512] w=0.0669 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)G218.CA) [> 3.9804 = 6.6339 < 8.6241] w=0.0669 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V133.CB) [> 3.7895 = 6.3158 < 8.2106] w=0.0669 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)Y194.CB) [> 4.1018 = 6.8364 < 8.8873] w=0.0668 to align # Constraint # added constraint: constraint((T0333)V92.CB, (T0333)L123.CB) [> 3.8520 = 6.4199 < 8.3459] w=0.0668 to align # Constraint # added constraint: constraint((T0333)L274.CB, (T0333)T292.CB) [> 3.5832 = 5.9721 < 7.7637] w=0.0668 to align # Constraint # added constraint: constraint((T0333)V92.CB, (T0333)A118.CB) [> 3.7214 = 6.2023 < 8.0630] w=0.0668 to align # Constraint # added constraint: constraint((T0333)I253.CB, (T0333)V263.CB) [> 3.9736 = 6.6226 < 8.6094] w=0.0667 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)Q134.CB) [> 4.3485 = 7.2476 < 9.4218] w=0.0667 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)K58.CB) [> 3.7068 = 6.1780 < 8.0314] w=0.0666 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)V33.CB) [> 3.6718 = 6.1197 < 7.9556] w=0.0665 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)A118.CB) [> 4.1664 = 6.9440 < 9.0272] w=0.0665 to align # Constraint # added constraint: constraint((T0333)G286.CA, (T0333)P304.CB) [> 4.0711 = 6.7852 < 8.8207] w=0.0665 to align # Constraint # added constraint: constraint((T0333)N67.CB, (T0333)W85.CB) [> 3.8162 = 6.3603 < 8.2683] w=0.0664 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)H146.CB) [> 3.3475 = 5.5791 < 7.2528] w=0.0664 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)A75.CB) [> 3.5924 = 5.9874 < 7.7836] w=0.0660 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)S55.CB) [> 3.7388 = 6.2313 < 8.1007] w=0.0660 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)I323.CB) [> 3.9411 = 6.5685 < 8.5390] w=0.0659 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)T73.CB) [> 2.9924 = 4.9874 < 6.4836] w=0.0658 to align # Constraint # added constraint: constraint((T0333)F13.CB, (T0333)E115.CB) [> 4.1977 = 6.9962 < 9.0950] w=0.0658 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V48.CB) [> 3.9653 = 6.6089 < 8.5916] w=0.0657 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)S138.CB) [> 3.3740 = 5.6233 < 7.3102] w=0.0656 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)S138.CB) [> 4.0672 = 6.7786 < 8.8122] w=0.0656 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)G288.CA) [> 4.1364 = 6.8939 < 8.9621] w=0.0656 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)M291.CB) [> 4.4528 = 7.4214 < 9.6478] w=0.0656 to align # Constraint # added constraint: constraint((T0333)I171.CB, (T0333)T292.CB) [> 3.2179 = 5.3632 < 6.9722] w=0.0656 to align # Constraint # added constraint: constraint((T0333)F188.CB, (T0333)T279.CB) [> 3.0134 = 5.0223 < 6.5290] w=0.0656 to align # Constraint # added constraint: constraint((T0333)F188.CB, (T0333)A280.CB) [> 4.0989 = 6.8314 < 8.8809] w=0.0656 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)R261.CB) [> 3.6524 = 6.0873 < 7.9134] w=0.0655 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)Y114.CB) [> 3.7198 = 6.1997 < 8.0596] w=0.0655 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)F60.CB) [> 3.9533 = 6.5888 < 8.5655] w=0.0654 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)Q137.CB) [> 3.3119 = 5.5199 < 7.1759] w=0.0649 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V112.CB) [> 3.7566 = 6.2610 < 8.1392] w=0.0649 to align # Constraint # added constraint: constraint((T0333)L164.CB, (T0333)G195.CA) [> 4.0675 = 6.7792 < 8.8130] w=0.0616 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)V29.CB) [> 4.5191 = 7.5319 < 9.7915] w=0.0615 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)S148.CB) [> 3.9648 = 6.6080 < 8.5904] w=0.0615 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)R307.CB) [> 4.3447 = 7.2412 < 9.4136] w=0.0610 to align # Constraint # added constraint: constraint((T0333)I233.CB, (T0333)V263.CB) [> 3.8712 = 6.4519 < 8.3875] w=0.0610 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)Y194.CB) [> 3.7878 = 6.3129 < 8.2068] w=0.0610 to align # Constraint # added constraint: constraint((T0333)L122.CB, (T0333)M157.CB) [> 3.7849 = 6.3081 < 8.2005] w=0.0610 to align # Constraint # added constraint: constraint((T0333)E221.CB, (T0333)G249.CA) [> 3.9493 = 6.5821 < 8.5568] w=0.0610 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)A118.CB) [> 4.4653 = 7.4422 < 9.6749] w=0.0609 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)L156.CB) [> 3.8516 = 6.4193 < 8.3451] w=0.0609 to align # Constraint # added constraint: constraint((T0333)H160.CB, (T0333)F174.CB) [> 3.5588 = 5.9313 < 7.7107] w=0.0609 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)D333.CB) [> 4.1667 = 6.9445 < 9.0278] w=0.0609 to align # Constraint # added constraint: constraint((T0333)V199.CB, (T0333)P363.CB) [> 3.9002 = 6.5004 < 8.4505] w=0.0609 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)M291.CB) [> 4.2659 = 7.1098 < 9.2427] w=0.0609 to align # Constraint # added constraint: constraint((T0333)I323.CB, (T0333)L346.CB) [> 3.6723 = 6.1204 < 7.9566] w=0.0609 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)V192.CB) [> 4.4484 = 7.4140 < 9.6382] w=0.0609 to align # Constraint # added constraint: constraint((T0333)L96.CB, (T0333)T119.CB) [> 4.3681 = 7.2802 < 9.4643] w=0.0609 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)A118.CB) [> 3.9745 = 6.6242 < 8.6114] w=0.0608 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)M157.CB) [> 4.4332 = 7.3886 < 9.6053] w=0.0607 to align # Constraint # added constraint: constraint((T0333)D28.CB, (T0333)P131.CB) [> 3.1194 = 5.1990 < 6.7587] w=0.0607 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)A132.CB) [> 3.2474 = 5.4124 < 7.0361] w=0.0607 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V133.CB) [> 2.5768 = 4.2946 < 5.5830] w=0.0607 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V133.CB) [> 4.1878 = 6.9797 < 9.0736] w=0.0607 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)Q134.CB) [> 4.1167 = 6.8611 < 8.9194] w=0.0607 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)R135.CB) [> 2.8975 = 4.8292 < 6.2779] w=0.0607 to align # Constraint # added constraint: constraint((T0333)V50.CB, (T0333)V59.CB) [> 2.9970 = 4.9950 < 6.4935] w=0.0606 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)M145.CB) [> 3.9266 = 6.5444 < 8.5077] w=0.0606 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V33.CB) [> 4.4699 = 7.4498 < 9.6847] w=0.0606 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)L301.CB) [> 4.5073 = 7.5121 < 9.7658] w=0.0606 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)L164.CB) [> 4.0655 = 6.7758 < 8.8086] w=0.0606 to align # Constraint # added constraint: constraint((T0333)A71.CB, (T0333)D81.CB) [> 3.5167 = 5.8612 < 7.6195] w=0.0605 to align # Constraint # added constraint: constraint((T0333)V63.CB, (T0333)V92.CB) [> 3.3898 = 5.6497 < 7.3446] w=0.0605 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)V113.CB) [> 4.0818 = 6.8030 < 8.8439] w=0.0605 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)G324.CA) [> 3.6640 = 6.1066 < 7.9387] w=0.0604 to align # Constraint # added constraint: constraint((T0333)F70.CB, (T0333)L82.CB) [> 3.6938 = 6.1564 < 8.0033] w=0.0603 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)W268.CB) [> 4.0756 = 6.7927 < 8.8305] w=0.0603 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)F188.CB) [> 4.3529 = 7.2548 < 9.4313] w=0.0603 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)A314.CB) [> 3.4060 = 5.6766 < 7.3796] w=0.0603 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)L325.CB) [> 4.4832 = 7.4721 < 9.7137] w=0.0601 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)L123.CB) [> 4.2227 = 7.0379 < 9.1493] w=0.0600 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)Q134.CB) [> 4.1949 = 6.9915 < 9.0890] w=0.0600 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)L246.CB) [> 3.9627 = 6.6046 < 8.5859] w=0.0600 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)V266.CB) [> 4.1692 = 6.9487 < 9.0333] w=0.0599 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)G288.CA) [> 4.0680 = 6.7800 < 8.8140] w=0.0598 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)G324.CA) [> 3.8007 = 6.3344 < 8.2347] w=0.0598 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)F188.CB) [> 3.9452 = 6.5753 < 8.5479] w=0.0598 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)S138.CB) [> 3.7478 = 6.2463 < 8.1202] w=0.0598 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)A296.CB) [> 4.7113 = 7.8521 < 10.2077] w=0.0597 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)V281.CB) [> 4.6030 = 7.6716 < 9.9731] w=0.0596 to align # Constraint # added constraint: constraint((T0333)R190.CB, (T0333)T279.CB) [> 4.4287 = 7.3812 < 9.5956] w=0.0596 to align # Constraint # added constraint: constraint((T0333)M189.CB, (T0333)V282.CB) [> 4.0676 = 6.7793 < 8.8131] w=0.0596 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)P78.CB) [> 2.9692 = 4.9487 < 6.4333] w=0.0596 to align # Constraint # added constraint: constraint((T0333)M189.CB, (T0333)V281.CB) [> 4.0155 = 6.6924 < 8.7001] w=0.0596 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)L248.CB) [> 3.5944 = 5.9907 < 7.7880] w=0.0595 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)L325.CB) [> 3.6620 = 6.1033 < 7.9342] w=0.0594 to align # Constraint # added constraint: constraint((T0333)H160.CB, (T0333)F244.CB) [> 3.8256 = 6.3761 < 8.2889] w=0.0593 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V74.CB) [> 3.3810 = 5.6350 < 7.3255] w=0.0593 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)R77.CB) [> 3.8827 = 6.4711 < 8.4125] w=0.0589 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)A247.CB) [> 3.6041 = 6.0068 < 7.8088] w=0.0589 to align # Constraint # added constraint: constraint((T0333)H11.CB, (T0333)A71.CB) [> 4.1650 = 6.9417 < 9.0242] w=0.0588 to align # Constraint # added constraint: constraint((T0333)G322.CA, (T0333)L346.CB) [> 3.6160 = 6.0267 < 7.8347] w=0.0549 to align # Constraint # added constraint: constraint((T0333)P14.CB, (T0333)V199.CB) [> 3.6329 = 6.0548 < 7.8713] w=0.0549 to align # Constraint # added constraint: constraint((T0333)G286.CA, (T0333)L302.CB) [> 4.6058 = 7.6763 < 9.9792] w=0.0549 to align # Constraint # added constraint: constraint((T0333)G297.CA, (T0333)I323.CB) [> 4.6467 = 7.7445 < 10.0678] w=0.0549 to align # Constraint # added constraint: constraint((T0333)G10.CA, (T0333)G286.CA) [> 4.4179 = 7.3632 < 9.5722] w=0.0549 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)A198.CB) [> 3.9584 = 6.5974 < 8.5766] w=0.0549 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)A198.CB) [> 4.0651 = 6.7751 < 8.8076] w=0.0549 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)R135.CB) [> 4.0614 = 6.7690 < 8.7997] w=0.0549 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)Q134.CB) [> 3.4983 = 5.8305 < 7.5796] w=0.0548 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)G195.CA) [> 4.2816 = 7.1360 < 9.2768] w=0.0548 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)G197.CA) [> 3.8229 = 6.3715 < 8.2829] w=0.0548 to align # Constraint # added constraint: constraint((T0333)L301.CB, (T0333)V332.CB) [> 4.1845 = 6.9742 < 9.0665] w=0.0548 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)Y114.CB) [> 4.0715 = 6.7858 < 8.8216] w=0.0548 to align # Constraint # added constraint: constraint((T0333)E231.CB, (T0333)G257.CA) [> 3.8729 = 6.4548 < 8.3912] w=0.0548 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)I323.CB) [> 3.9429 = 6.5715 < 8.5429] w=0.0548 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)I253.CB) [> 3.3230 = 5.5384 < 7.1999] w=0.0548 to align # Constraint # added constraint: constraint((T0333)V50.CB, (T0333)P95.CB) [> 3.7710 = 6.2851 < 8.1706] w=0.0548 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)A132.CB) [> 4.1173 = 6.8621 < 8.9207] w=0.0547 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V133.CB) [> 4.1818 = 6.9696 < 9.0605] w=0.0547 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)S327.CB) [> 3.9734 = 6.6224 < 8.6091] w=0.0547 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)V192.CB) [> 3.8873 = 6.4788 < 8.4225] w=0.0547 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)V192.CB) [> 4.0335 = 6.7225 < 8.7393] w=0.0547 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)D243.CB) [> 4.2520 = 7.0868 < 9.2128] w=0.0546 to align # Constraint # added constraint: constraint((T0333)K159.CB, (T0333)F174.CB) [> 3.7781 = 6.2968 < 8.1859] w=0.0546 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)F174.CB) [> 4.1301 = 6.8835 < 8.9485] w=0.0546 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)F174.CB) [> 3.7832 = 6.3053 < 8.1969] w=0.0546 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)E172.CB) [> 4.0376 = 6.7294 < 8.7481] w=0.0546 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)Y194.CB) [> 3.9442 = 6.5737 < 8.5458] w=0.0546 to align # Constraint # added constraint: constraint((T0333)V59.CB, (T0333)V92.CB) [> 2.9870 = 4.9784 < 6.4719] w=0.0546 to align # Constraint # added constraint: constraint((T0333)E72.CB, (T0333)Q88.CB) [> 3.9534 = 6.5890 < 8.5656] w=0.0546 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)T73.CB) [> 3.9039 = 6.5065 < 8.4584] w=0.0545 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)P260.CB) [> 3.6507 = 6.0845 < 7.9098] w=0.0544 to align # Constraint # added constraint: constraint((T0333)G285.CA, (T0333)A314.CB) [> 3.7015 = 6.1691 < 8.0199] w=0.0544 to align # Constraint # added constraint: constraint((T0333)V63.CB, (T0333)A91.CB) [> 3.9889 = 6.6481 < 8.6426] w=0.0544 to align # Constraint # added constraint: constraint((T0333)T73.CB, (T0333)I89.CB) [> 4.0468 = 6.7447 < 8.7681] w=0.0544 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)V326.CB) [> 4.0887 = 6.8144 < 8.8588] w=0.0543 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)W268.CB) [> 3.9056 = 6.5094 < 8.4622] w=0.0543 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)D110.CB) [> 4.1168 = 6.8614 < 8.9198] w=0.0542 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)G324.CA) [> 3.6976 = 6.1627 < 8.0115] w=0.0542 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)V59.CB) [> 3.6578 = 6.0963 < 7.9252] w=0.0542 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)H146.CB) [> 3.9438 = 6.5729 < 8.5448] w=0.0542 to align # Constraint # added constraint: constraint((T0333)A314.CB, (T0333)L325.CB) [> 4.5020 = 7.5033 < 9.7542] w=0.0542 to align # Constraint # added constraint: constraint((T0333)H160.CB, (T0333)V245.CB) [> 4.0133 = 6.6888 < 8.6955] w=0.0539 to align # Constraint # added constraint: constraint((T0333)T142.CB, (T0333)S163.CB) [> 4.4580 = 7.4300 < 9.6590] w=0.0538 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)V74.CB) [> 3.9528 = 6.5879 < 8.5643] w=0.0538 to align # Constraint # added constraint: constraint((T0333)L179.CB, (T0333)W191.CB) [> 3.6329 = 6.0548 < 7.8713] w=0.0538 to align # Constraint # added constraint: constraint((T0333)E221.CB, (T0333)P255.CB) [> 3.3505 = 5.5842 < 7.2595] w=0.0538 to align # Constraint # added constraint: constraint((T0333)G286.CA, (T0333)A303.CB) [> 2.4694 = 4.1157 < 5.3505] w=0.0537 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)V326.CB) [> 3.6048 = 6.0081 < 7.8105] w=0.0537 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)I323.CB) [> 4.2060 = 7.0100 < 9.1130] w=0.0537 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V74.CB) [> 3.0410 = 5.0684 < 6.5889] w=0.0537 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)L18.CB) [> 4.4493 = 7.4156 < 9.6402] w=0.0537 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)I16.CB) [> 3.8311 = 6.3851 < 8.3007] w=0.0535 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)V263.CB) [> 3.9533 = 6.5889 < 8.5655] w=0.0535 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)V282.CB) [> 4.3757 = 7.2928 < 9.4807] w=0.0535 to align # Constraint # added constraint: constraint((T0333)R190.CB, (T0333)H283.CB) [> 4.0134 = 6.6890 < 8.6957] w=0.0535 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)L248.CB) [> 3.7058 = 6.1763 < 8.0292] w=0.0533 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)T73.CB) [> 3.6798 = 6.1330 < 7.9730] w=0.0533 to align # Constraint # added constraint: constraint((T0333)I9.CB, (T0333)A71.CB) [> 4.3733 = 7.2888 < 9.4755] w=0.0532 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)A314.CB) [> 3.8739 = 6.4564 < 8.3934] w=0.0532 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)R135.CB) [> 4.1569 = 6.9282 < 9.0066] w=0.0499 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)E72.CB) [> 4.2944 = 7.1573 < 9.3044] w=0.0494 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)R69.CB) [> 3.9684 = 6.6140 < 8.5982] w=0.0493 to align # Constraint # added constraint: constraint((T0333)V74.CB, (T0333)W85.CB) [> 3.6025 = 6.0042 < 7.8054] w=0.0492 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)M145.CB) [> 3.7183 = 6.1972 < 8.0563] w=0.0492 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)E115.CB) [> 3.0445 = 5.0742 < 6.5964] w=0.0491 to align # Constraint # added constraint: constraint((T0333)A64.CB, (T0333)V92.CB) [> 3.9846 = 6.6411 < 8.6334] w=0.0491 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)L274.CB) [> 3.8676 = 6.4460 < 8.3798] w=0.0488 to align # Constraint # added constraint: constraint((T0333)D295.CB, (T0333)L360.CB) [> 4.1789 = 6.9647 < 9.0542] w=0.0488 to align # Constraint # added constraint: constraint((T0333)L204.CB, (T0333)R264.CB) [> 3.8547 = 6.4245 < 8.3518] w=0.0488 to align # Constraint # added constraint: constraint((T0333)I323.CB, (T0333)M357.CB) [> 3.0291 = 5.0486 < 6.5631] w=0.0488 to align # Constraint # added constraint: constraint((T0333)P208.CB, (T0333)D243.CB) [> 3.8611 = 6.4352 < 8.3658] w=0.0488 to align # Constraint # added constraint: constraint((T0333)G197.CA, (T0333)D295.CB) [> 3.6532 = 6.0887 < 7.9154] w=0.0488 to align # Constraint # added constraint: constraint((T0333)G197.CA, (T0333)T366.CB) [> 3.3475 = 5.5792 < 7.2529] w=0.0488 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)V192.CB) [> 4.5926 = 7.6543 < 9.9506] w=0.0488 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)F152.CB) [> 3.2057 = 5.3428 < 6.9456] w=0.0488 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)Q134.CB) [> 3.8930 = 6.4883 < 8.4348] w=0.0487 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)Q134.CB) [> 4.0611 = 6.7685 < 8.7990] w=0.0487 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)N136.CB) [> 4.4769 = 7.4615 < 9.7000] w=0.0487 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)N136.CB) [> 3.6270 = 6.0449 < 7.8584] w=0.0487 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)N136.CB) [> 2.7956 = 4.6594 < 6.0572] w=0.0487 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)A34.CB) [> 4.0575 = 6.7625 < 8.7913] w=0.0487 to align # Constraint # added constraint: constraint((T0333)Q300.CB, (T0333)V326.CB) [> 3.3899 = 5.6498 < 7.3447] w=0.0487 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)R373.CB) [> 4.0191 = 6.6985 < 8.7080] w=0.0487 to align # Constraint # added constraint: constraint((T0333)H27.CB, (T0333)I374.CB) [> 4.2008 = 7.0013 < 9.1017] w=0.0487 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)R69.CB) [> 2.9263 = 4.8772 < 6.3403] w=0.0487 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)L325.CB) [> 3.8303 = 6.3837 < 8.2989] w=0.0487 to align # Constraint # added constraint: constraint((T0333)E231.CB, (T0333)L259.CB) [> 3.3790 = 5.6317 < 7.3212] w=0.0487 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)L256.CB) [> 3.2731 = 5.4551 < 7.0917] w=0.0487 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)P193.CB) [> 4.3040 = 7.1733 < 9.3253] w=0.0487 to align # Constraint # added constraint: constraint((T0333)I253.CB, (T0333)V266.CB) [> 4.2446 = 7.0744 < 9.1967] w=0.0487 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)V120.CB) [> 3.6899 = 6.1499 < 7.9948] w=0.0487 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)M145.CB) [> 4.0661 = 6.7769 < 8.8099] w=0.0486 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)A71.CB) [> 4.2102 = 7.0171 < 9.1222] w=0.0486 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)S148.CB) [> 4.2340 = 7.0567 < 9.1738] w=0.0486 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)T216.CB) [> 3.0171 = 5.0285 < 6.5370] w=0.0486 to align # Constraint # added constraint: constraint((T0333)V50.CB, (T0333)V120.CB) [> 4.1146 = 6.8577 < 8.9150] w=0.0485 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)G117.CA) [> 4.5781 = 7.6301 < 9.9192] w=0.0485 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)E172.CB) [> 3.5217 = 5.8695 < 7.6304] w=0.0485 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)M145.CB) [> 3.9250 = 6.5416 < 8.5041] w=0.0485 to align # Constraint # added constraint: constraint((T0333)R315.CB, (T0333)L325.CB) [> 3.9233 = 6.5388 < 8.5005] w=0.0485 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)F174.CB) [> 3.6156 = 6.0260 < 7.8338] w=0.0484 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)V120.CB) [> 3.0691 = 5.1151 < 6.6496] w=0.0483 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)T119.CB) [> 4.5232 = 7.5387 < 9.8003] w=0.0483 to align # Constraint # added constraint: constraint((T0333)L178.CB, (T0333)W191.CB) [> 4.2086 = 7.0143 < 9.1186] w=0.0482 to align # Constraint # added constraint: constraint((T0333)T142.CB, (T0333)V162.CB) [> 3.8427 = 6.4044 < 8.3258] w=0.0482 to align # Constraint # added constraint: constraint((T0333)L164.CB, (T0333)L248.CB) [> 3.1533 = 5.2555 < 6.8322] w=0.0482 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)W268.CB) [> 3.4641 = 5.7736 < 7.5057] w=0.0482 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)Q137.CB) [> 3.6609 = 6.1015 < 7.9319] w=0.0478 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)G186.CA) [> 3.3823 = 5.6371 < 7.3283] w=0.0478 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)I323.CB) [> 3.1616 = 5.2693 < 6.8501] w=0.0476 to align # Constraint # added constraint: constraint((T0333)M189.CB, (T0333)T279.CB) [> 4.2530 = 7.0883 < 9.2148] w=0.0476 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)A280.CB) [> 4.3349 = 7.2248 < 9.3922] w=0.0476 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)H284.CB) [> 3.9248 = 6.5413 < 8.5036] w=0.0476 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)V282.CB) [> 4.5034 = 7.5058 < 9.7575] w=0.0476 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)H284.CB) [> 3.4283 = 5.7138 < 7.4279] w=0.0476 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)T292.CB) [> 3.8299 = 6.3832 < 8.2982] w=0.0476 to align # Constraint # added constraint: constraint((T0333)G21.CA, (T0333)R315.CB) [> 3.3260 = 5.5434 < 7.2064] w=0.0476 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)N136.CB) [> 4.1448 = 6.9080 < 8.9804] w=0.0474 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)N136.CB) [> 3.6165 = 6.0275 < 7.8358] w=0.0472 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)L111.CB) [> 4.4413 = 7.4021 < 9.6227] w=0.0467 to align # Constraint # added constraint: constraint((T0333)L179.CB, (T0333)M189.CB) [> 4.1326 = 6.8877 < 8.9540] w=0.0433 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)A71.CB) [> 3.9412 = 6.5686 < 8.5392] w=0.0431 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)A314.CB) [> 3.6880 = 6.1467 < 7.9907] w=0.0428 to align # Constraint # added constraint: constraint((T0333)P131.CB, (T0333)R373.CB) [> 3.5208 = 5.8680 < 7.6284] w=0.0427 to align # Constraint # added constraint: constraint((T0333)R203.CB, (T0333)R264.CB) [> 3.4196 = 5.6993 < 7.4091] w=0.0427 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)P270.CB) [> 3.5725 = 5.9542 < 7.7405] w=0.0427 to align # Constraint # added constraint: constraint((T0333)P205.CB, (T0333)R264.CB) [> 3.7004 = 6.1673 < 8.0174] w=0.0427 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)A198.CB) [> 4.3207 = 7.2011 < 9.3615] w=0.0427 to align # Constraint # added constraint: constraint((T0333)G201.CA, (T0333)T277.CB) [> 4.2479 = 7.0799 < 9.2038] w=0.0427 to align # Constraint # added constraint: constraint((T0333)I323.CB, (T0333)E356.CB) [> 3.4870 = 5.8117 < 7.5552] w=0.0427 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)M157.CB) [> 3.8132 = 6.3553 < 8.2619] w=0.0427 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)G196.CA) [> 3.9838 = 6.6397 < 8.6317] w=0.0427 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)A71.CB) [> 4.0129 = 6.6882 < 8.6947] w=0.0427 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)A34.CB) [> 3.8639 = 6.4398 < 8.3718] w=0.0427 to align # Constraint # added constraint: constraint((T0333)A303.CB, (T0333)S329.CB) [> 3.7497 = 6.2495 < 8.1244] w=0.0427 to align # Constraint # added constraint: constraint((T0333)L178.CB, (T0333)Y194.CB) [> 3.9714 = 6.6190 < 8.6047] w=0.0427 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)N136.CB) [> 3.6853 = 6.1421 < 7.9847] w=0.0427 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)Q116.CB) [> 4.3914 = 7.3191 < 9.5148] w=0.0427 to align # Constraint # added constraint: constraint((T0333)L179.CB, (T0333)V192.CB) [> 3.7289 = 6.2148 < 8.0793] w=0.0426 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)R135.CB) [> 4.0485 = 6.7474 < 8.7717] w=0.0426 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)T73.CB) [> 3.8792 = 6.4654 < 8.4050] w=0.0426 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)A214.CB) [> 3.9054 = 6.5090 < 8.4616] w=0.0426 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)N136.CB) [> 3.3408 = 5.5680 < 7.2383] w=0.0426 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)F70.CB) [> 3.3928 = 5.6547 < 7.3511] w=0.0426 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)R69.CB) [> 3.6580 = 6.0967 < 7.9257] w=0.0426 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)V192.CB) [> 3.4828 = 5.8046 < 7.5460] w=0.0426 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)W191.CB) [> 4.3967 = 7.3278 < 9.5262] w=0.0426 to align # Constraint # added constraint: constraint((T0333)M157.CB, (T0333)W191.CB) [> 4.3377 = 7.2294 < 9.3983] w=0.0426 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)A71.CB) [> 4.2122 = 7.0204 < 9.1265] w=0.0426 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)F244.CB) [> 4.2971 = 7.1618 < 9.3104] w=0.0426 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)Q116.CB) [> 3.8498 = 6.4164 < 8.3413] w=0.0425 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)R108.CB) [> 4.2561 = 7.0935 < 9.2216] w=0.0425 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)W191.CB) [> 3.6966 = 6.1609 < 8.0092] w=0.0425 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)G196.CA) [> 4.0125 = 6.6874 < 8.6937] w=0.0425 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)I215.CB) [> 3.1998 = 5.3330 < 6.9329] w=0.0425 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)V213.CB) [> 3.2791 = 5.4652 < 7.1047] w=0.0425 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)R135.CB) [> 4.4876 = 7.4793 < 9.7231] w=0.0425 to align # Constraint # added constraint: constraint((T0333)D158.CB, (T0333)P193.CB) [> 3.9829 = 6.6381 < 8.6295] w=0.0424 to align # Constraint # added constraint: constraint((T0333)A91.CB, (T0333)L123.CB) [> 4.3429 = 7.2382 < 9.4096] w=0.0424 to align # Constraint # added constraint: constraint((T0333)V63.CB, (T0333)P95.CB) [> 4.1890 = 6.9817 < 9.0762] w=0.0424 to align # Constraint # added constraint: constraint((T0333)I227.CB, (T0333)L259.CB) [> 3.8785 = 6.4642 < 8.4035] w=0.0423 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)L111.CB) [> 4.2567 = 7.0946 < 9.2229] w=0.0423 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)L96.CB) [> 4.4283 = 7.3805 < 9.5946] w=0.0423 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)V245.CB) [> 3.6393 = 6.0655 < 7.8851] w=0.0422 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)V245.CB) [> 3.8673 = 6.4455 < 8.3792] w=0.0422 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)G249.CA) [> 3.7575 = 6.2625 < 8.1413] w=0.0422 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)V133.CB) [> 4.1666 = 6.9443 < 9.0275] w=0.0422 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)I215.CB) [> 3.7225 = 6.2041 < 8.0653] w=0.0421 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)G286.CA) [> 3.9201 = 6.5335 < 8.4935] w=0.0420 to align # Constraint # added constraint: constraint((T0333)D158.CB, (T0333)D243.CB) [> 3.9532 = 6.5887 < 8.5654] w=0.0420 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)V290.CB) [> 4.0259 = 6.7099 < 8.7229] w=0.0420 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)I16.CB) [> 4.4145 = 7.3575 < 9.5648] w=0.0419 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)L246.CB) [> 3.7789 = 6.2982 < 8.1876] w=0.0417 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)V245.CB) [> 3.5211 = 5.8685 < 7.6291] w=0.0417 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)F70.CB) [> 3.4300 = 5.7166 < 7.4316] w=0.0416 to align # Constraint # added constraint: constraint((T0333)A317.CB, (T0333)S327.CB) [> 4.4433 = 7.4055 < 9.6271] w=0.0415 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)L122.CB) [> 4.1946 = 6.9910 < 9.0882] w=0.0411 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)L325.CB) [> 3.2034 = 5.3391 < 6.9408] w=0.0411 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)I323.CB) [> 4.4372 = 7.3954 < 9.6140] w=0.0411 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)S319.CB) [> 3.9390 = 6.5651 < 8.5346] w=0.0372 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)F70.CB) [> 3.1995 = 5.3326 < 6.9323] w=0.0371 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)Q116.CB) [> 3.7497 = 6.2495 < 8.1243] w=0.0370 to align # Constraint # added constraint: constraint((T0333)G324.CA, (T0333)L346.CB) [> 3.6337 = 6.0562 < 7.8731] w=0.0366 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)G26.CA) [> 3.5978 = 5.9963 < 7.7952] w=0.0366 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)R307.CB) [> 4.6118 = 7.6863 < 9.9921] w=0.0366 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)T269.CB) [> 3.8899 = 6.4831 < 8.4280] w=0.0366 to align # Constraint # added constraint: constraint((T0333)F310.CB, (T0333)R320.CB) [> 3.4766 = 5.7943 < 7.5326] w=0.0366 to align # Constraint # added constraint: constraint((T0333)G8.CA, (T0333)I220.CB) [> 4.3165 = 7.1941 < 9.3524] w=0.0366 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)T73.CB) [> 3.8316 = 6.3860 < 8.3018] w=0.0366 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)V290.CB) [> 4.4073 = 7.3454 < 9.5491] w=0.0366 to align # Constraint # added constraint: constraint((T0333)P95.CB, (T0333)V120.CB) [> 3.6307 = 6.0512 < 7.8666] w=0.0366 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)L96.CB) [> 4.2510 = 7.0850 < 9.2106] w=0.0366 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)L302.CB) [> 4.0923 = 6.8206 < 8.8667] w=0.0366 to align # Constraint # added constraint: constraint((T0333)T279.CB, (T0333)Q300.CB) [> 4.1195 = 6.8658 < 8.9255] w=0.0366 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)F174.CB) [> 3.9472 = 6.5787 < 8.5523] w=0.0366 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)S138.CB) [> 3.6511 = 6.0852 < 7.9107] w=0.0366 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)N136.CB) [> 3.9376 = 6.5626 < 8.5314] w=0.0366 to align # Constraint # added constraint: constraint((T0333)S163.CB, (T0333)A198.CB) [> 3.3306 = 5.5510 < 7.2163] w=0.0366 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)V281.CB) [> 4.1675 = 6.9459 < 9.0296] w=0.0366 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)V213.CB) [> 4.0869 = 6.8115 < 8.8549] w=0.0365 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)L111.CB) [> 4.0947 = 6.8245 < 8.8718] w=0.0365 to align # Constraint # added constraint: constraint((T0333)R69.CB, (T0333)W85.CB) [> 4.2060 = 7.0101 < 9.1131] w=0.0365 to align # Constraint # added constraint: constraint((T0333)D250.CB, (T0333)A265.CB) [> 3.7494 = 6.2489 < 8.1236] w=0.0365 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)W191.CB) [> 3.0491 = 5.0819 < 6.6064] w=0.0365 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)M189.CB) [> 3.1409 = 5.2348 < 6.8052] w=0.0365 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)M189.CB) [> 3.9723 = 6.6205 < 8.6067] w=0.0365 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)P193.CB) [> 3.6652 = 6.1086 < 7.9412] w=0.0365 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)A280.CB) [> 4.4556 = 7.4260 < 9.6538] w=0.0365 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)A247.CB) [> 4.3577 = 7.2628 < 9.4417] w=0.0364 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)A214.CB) [> 4.4288 = 7.3814 < 9.5958] w=0.0364 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)V213.CB) [> 4.4568 = 7.4280 < 9.6564] w=0.0364 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)E212.CB) [> 4.1433 = 6.9055 < 8.9772] w=0.0364 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)T216.CB) [> 3.9191 = 6.5319 < 8.4915] w=0.0364 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)V213.CB) [> 4.3334 = 7.2223 < 9.3890] w=0.0364 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)Y114.CB) [> 3.6045 = 6.0075 < 7.8098] w=0.0364 to align # Constraint # added constraint: constraint((T0333)V207.CB, (T0333)R276.CB) [> 4.1423 = 6.9037 < 8.9749] w=0.0364 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)I31.CB) [> 4.3755 = 7.2925 < 9.4803] w=0.0364 to align # Constraint # added constraint: constraint((T0333)A64.CB, (T0333)A91.CB) [> 3.5257 = 5.8761 < 7.6389] w=0.0364 to align # Constraint # added constraint: constraint((T0333)Q62.CB, (T0333)Q88.CB) [> 3.9179 = 6.5299 < 8.4888] w=0.0363 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)A265.CB) [> 4.0065 = 6.6774 < 8.6807] w=0.0363 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)A265.CB) [> 3.6823 = 6.1372 < 7.9783] w=0.0363 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)Q116.CB) [> 4.2037 = 7.0061 < 9.1079] w=0.0363 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)G249.CA) [> 3.8833 = 6.4722 < 8.4138] w=0.0363 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)V245.CB) [> 3.8689 = 6.4482 < 8.3827] w=0.0363 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)F244.CB) [> 3.0328 = 5.0547 < 6.5712] w=0.0363 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)V245.CB) [> 4.3842 = 7.3070 < 9.4991] w=0.0363 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)A247.CB) [> 3.5831 = 5.9718 < 7.7634] w=0.0363 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)L246.CB) [> 3.6054 = 6.0090 < 7.8117] w=0.0363 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)A247.CB) [> 4.1423 = 6.9038 < 8.9750] w=0.0363 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)A247.CB) [> 3.2528 = 5.4213 < 7.0477] w=0.0363 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)L248.CB) [> 4.5098 = 7.5163 < 9.7712] w=0.0363 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)G249.CA) [> 3.5251 = 5.8752 < 7.6377] w=0.0363 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)V120.CB) [> 3.9879 = 6.6465 < 8.6405] w=0.0363 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)V263.CB) [> 4.1385 = 6.8975 < 8.9667] w=0.0362 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)N262.CB) [> 4.4992 = 7.4987 < 9.7484] w=0.0362 to align # Constraint # added constraint: constraint((T0333)A139.CB, (T0333)P165.CB) [> 4.1885 = 6.9809 < 9.0751] w=0.0362 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)V245.CB) [> 4.0621 = 6.7701 < 8.8012] w=0.0361 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)W268.CB) [> 3.5707 = 5.9511 < 7.7365] w=0.0361 to align # Constraint # added constraint: constraint((T0333)V199.CB, (T0333)T362.CB) [> 4.0172 = 6.6953 < 8.7039] w=0.0361 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)T328.CB) [> 3.6791 = 6.1318 < 7.9713] w=0.0360 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)A265.CB) [> 3.9174 = 6.5290 < 8.4878] w=0.0360 to align # Constraint # added constraint: constraint((T0333)P165.CB, (T0333)G249.CA) [> 3.7239 = 6.2066 < 8.0686] w=0.0360 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)V245.CB) [> 3.8869 = 6.4781 < 8.4215] w=0.0360 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)E212.CB) [> 3.6288 = 6.0479 < 7.8623] w=0.0359 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)N262.CB) [> 3.2620 = 5.4366 < 7.0676] w=0.0359 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)A247.CB) [> 3.6452 = 6.0753 < 7.8980] w=0.0359 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)R261.CB) [> 4.1255 = 6.8758 < 8.9385] w=0.0359 to align # Constraint # added constraint: constraint((T0333)V281.CB, (T0333)L325.CB) [> 2.6384 = 4.3973 < 5.7165] w=0.0357 to align # Constraint # added constraint: constraint((T0333)H283.CB, (T0333)L325.CB) [> 3.7809 = 6.3015 < 8.1919] w=0.0357 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)G249.CA) [> 3.6203 = 6.0338 < 7.8440] w=0.0357 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)A314.CB) [> 4.1920 = 6.9868 < 9.0828] w=0.0356 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)S327.CB) [> 4.2508 = 7.0846 < 9.2100] w=0.0356 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)T73.CB) [> 4.1137 = 6.8561 < 8.9129] w=0.0355 to align # Constraint # added constraint: constraint((T0333)L302.CB, (T0333)T328.CB) [> 3.9581 = 6.5968 < 8.5758] w=0.0355 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)I16.CB) [> 3.5004 = 5.8340 < 7.5841] w=0.0355 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)F244.CB) [> 4.2278 = 7.0464 < 9.1603] w=0.0354 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)A198.CB) [> 4.1929 = 6.9882 < 9.0847] w=0.0351 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)L325.CB) [> 4.3178 = 7.1964 < 9.3553] w=0.0350 to align # Constraint # added constraint: constraint((T0333)F70.CB, (T0333)P260.CB) [> 3.9264 = 6.5440 < 8.5072] w=0.0346 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)Q300.CB) [> 3.7186 = 6.1977 < 8.0570] w=0.0323 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)A71.CB) [> 2.8778 = 4.7963 < 6.2352] w=0.0311 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)F70.CB) [> 3.7190 = 6.1983 < 8.0578] w=0.0311 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)W191.CB) [> 3.8564 = 6.4273 < 8.3555] w=0.0311 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)F244.CB) [> 4.0389 = 6.7316 < 8.7511] w=0.0307 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)F244.CB) [> 3.5508 = 5.9180 < 7.6934] w=0.0305 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)L246.CB) [> 3.3419 = 5.5698 < 7.2407] w=0.0305 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)V266.CB) [> 3.8261 = 6.3768 < 8.2898] w=0.0305 to align # Constraint # added constraint: constraint((T0333)V207.CB, (T0333)V245.CB) [> 4.2603 = 7.1005 < 9.2307] w=0.0305 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)S327.CB) [> 4.3400 = 7.2334 < 9.4034] w=0.0305 to align # Constraint # added constraint: constraint((T0333)T24.CB, (T0333)V367.CB) [> 4.1407 = 6.9012 < 8.9715] w=0.0305 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)G196.CA) [> 3.8335 = 6.3892 < 8.3060] w=0.0305 to align # Constraint # added constraint: constraint((T0333)L178.CB, (T0333)F188.CB) [> 3.5734 = 5.9556 < 7.7423] w=0.0305 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)L180.CB) [> 3.5634 = 5.9390 < 7.7207] w=0.0305 to align # Constraint # added constraint: constraint((T0333)P7.CB, (T0333)Q62.CB) [> 3.8425 = 6.4042 < 8.3254] w=0.0305 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)H283.CB) [> 3.9402 = 6.5669 < 8.5370] w=0.0305 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)N136.CB) [> 3.3108 = 5.5179 < 7.1733] w=0.0305 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)F188.CB) [> 3.6250 = 6.0416 < 7.8541] w=0.0305 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)A303.CB) [> 3.8743 = 6.4572 < 8.3944] w=0.0305 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)T216.CB) [> 4.1098 = 6.8497 < 8.9046] w=0.0305 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)V192.CB) [> 4.2460 = 7.0766 < 9.1996] w=0.0305 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)D110.CB) [> 4.2442 = 7.0738 < 9.1959] w=0.0305 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V213.CB) [> 4.1265 = 6.8776 < 8.9408] w=0.0304 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)A118.CB) [> 4.2961 = 7.1602 < 9.3083] w=0.0304 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)L18.CB) [> 3.7478 = 6.2462 < 8.1201] w=0.0304 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)I215.CB) [> 4.5584 = 7.5974 < 9.8766] w=0.0304 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)W191.CB) [> 4.1127 = 6.8545 < 8.9108] w=0.0304 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)D243.CB) [> 3.6855 = 6.1424 < 7.9851] w=0.0304 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)F244.CB) [> 3.6194 = 6.0324 < 7.8421] w=0.0304 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)F244.CB) [> 4.2928 = 7.1547 < 9.3011] w=0.0304 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)G117.CA) [> 3.9453 = 6.5754 < 8.5481] w=0.0304 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)E172.CB) [> 3.5298 = 5.8830 < 7.6479] w=0.0304 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)L259.CB) [> 3.9520 = 6.5866 < 8.5625] w=0.0304 to align # Constraint # added constraint: constraint((T0333)N67.CB, (T0333)A79.CB) [> 3.0597 = 5.0995 < 6.6293] w=0.0304 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)R135.CB) [> 3.7061 = 6.1769 < 8.0300] w=0.0304 to align # Constraint # added constraint: constraint((T0333)P68.CB, (T0333)A79.CB) [> 4.2415 = 7.0691 < 9.1898] w=0.0304 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)A132.CB) [> 4.3513 = 7.2522 < 9.4278] w=0.0304 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)Q300.CB) [> 3.3682 = 5.6136 < 7.2977] w=0.0304 to align # Constraint # added constraint: constraint((T0333)T219.CB, (T0333)P304.CB) [> 4.6140 = 7.6900 < 9.9970] w=0.0303 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)T216.CB) [> 3.4427 = 5.7378 < 7.4591] w=0.0303 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)M217.CB) [> 3.4418 = 5.7363 < 7.4572] w=0.0303 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)G218.CA) [> 3.2416 = 5.4026 < 7.0234] w=0.0303 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)Y114.CB) [> 3.8476 = 6.4126 < 8.3364] w=0.0303 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)Y194.CB) [> 3.7587 = 6.2644 < 8.1438] w=0.0303 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)G117.CA) [> 4.1031 = 6.8384 < 8.8900] w=0.0303 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)V213.CB) [> 3.7298 = 6.2163 < 8.0813] w=0.0303 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)Y114.CB) [> 4.0876 = 6.8126 < 8.8564] w=0.0303 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)A247.CB) [> 3.8685 = 6.4475 < 8.3817] w=0.0303 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)M217.CB) [> 4.1842 = 6.9737 < 9.0658] w=0.0303 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)L12.CB) [> 4.7672 = 7.9453 < 10.3289] w=0.0303 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)T216.CB) [> 4.1584 = 6.9307 < 9.0099] w=0.0303 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)A214.CB) [> 2.8061 = 4.6769 < 6.0800] w=0.0303 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)A214.CB) [> 4.3418 = 7.2363 < 9.4072] w=0.0303 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)A214.CB) [> 3.6825 = 6.1375 < 7.9787] w=0.0303 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)E212.CB) [> 2.7384 = 4.5640 < 5.9331] w=0.0303 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)G196.CA) [> 4.0564 = 6.7607 < 8.7889] w=0.0303 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)T279.CB) [> 4.3226 = 7.2044 < 9.3657] w=0.0303 to align # Constraint # added constraint: constraint((T0333)G201.CA, (T0333)V240.CB) [> 4.0391 = 6.7318 < 8.7513] w=0.0303 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)Y107.CB) [> 4.1945 = 6.9908 < 9.0881] w=0.0302 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V290.CB) [> 3.8242 = 6.3737 < 8.2859] w=0.0302 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)A32.CB) [> 4.4836 = 7.4726 < 9.7144] w=0.0302 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)L248.CB) [> 3.5712 = 5.9520 < 7.7376] w=0.0302 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)V199.CB) [> 3.8505 = 6.4175 < 8.3428] w=0.0302 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)L325.CB) [> 3.8335 = 6.3892 < 8.3059] w=0.0302 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)G267.CA) [> 3.9161 = 6.5269 < 8.4850] w=0.0301 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)V245.CB) [> 3.7656 = 6.2759 < 8.1587] w=0.0301 to align # Constraint # added constraint: constraint((T0333)I80.CB, (T0333)A118.CB) [> 3.1578 = 5.2629 < 6.8418] w=0.0301 to align # Constraint # added constraint: constraint((T0333)P78.CB, (T0333)A118.CB) [> 3.2918 = 5.4864 < 7.1323] w=0.0301 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)P260.CB) [> 4.0672 = 6.7786 < 8.8122] w=0.0300 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)Q137.CB) [> 4.1655 = 6.9426 < 9.0253] w=0.0300 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)L259.CB) [> 3.6919 = 6.1532 < 7.9992] w=0.0300 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)I215.CB) [> 3.6429 = 6.0715 < 7.8929] w=0.0300 to align # Constraint # added constraint: constraint((T0333)G201.CA, (T0333)E212.CB) [> 3.6210 = 6.0350 < 7.8455] w=0.0300 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)T216.CB) [> 3.5809 = 5.9681 < 7.7586] w=0.0300 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)F244.CB) [> 3.1279 = 5.2132 < 6.7771] w=0.0299 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)V245.CB) [> 4.2468 = 7.0779 < 9.2013] w=0.0299 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)L246.CB) [> 3.1770 = 5.2950 < 6.8835] w=0.0299 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)V290.CB) [> 3.6606 = 6.1010 < 7.9313] w=0.0298 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)N136.CB) [> 3.7035 = 6.1726 < 8.0243] w=0.0297 to align # Constraint # added constraint: constraint((T0333)T279.CB, (T0333)I323.CB) [> 3.9859 = 6.6432 < 8.6362] w=0.0296 to align # Constraint # added constraint: constraint((T0333)R276.CB, (T0333)A317.CB) [> 3.9017 = 6.5028 < 8.4536] w=0.0296 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)S138.CB) [> 3.3693 = 5.6155 < 7.3001] w=0.0296 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)A198.CB) [> 3.9361 = 6.5601 < 8.5281] w=0.0295 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)A247.CB) [> 3.6564 = 6.0940 < 7.9222] w=0.0295 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)I323.CB) [> 3.8903 = 6.4839 < 8.4290] w=0.0294 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)A317.CB) [> 3.2350 = 5.3916 < 7.0091] w=0.0294 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)T328.CB) [> 3.7662 = 6.2770 < 8.1601] w=0.0294 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)Y114.CB) [> 4.2356 = 7.0594 < 9.1772] w=0.0294 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)P299.CB) [> 3.7627 = 6.2712 < 8.1526] w=0.0262 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)P299.CB) [> 4.7481 = 7.9135 < 10.2875] w=0.0262 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)L30.CB) [> 4.4172 = 7.3620 < 9.5706] w=0.0250 to align # Constraint # added constraint: constraint((T0333)D202.CB, (T0333)T273.CB) [> 3.9329 = 6.5549 < 8.5213] w=0.0244 to align # Constraint # added constraint: constraint((T0333)R307.CB, (T0333)A317.CB) [> 3.8558 = 6.4264 < 8.3543] w=0.0244 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)G342.CA) [> 4.5138 = 7.5230 < 9.7800] w=0.0244 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)V358.CB) [> 3.1939 = 5.3232 < 6.9201] w=0.0244 to align # Constraint # added constraint: constraint((T0333)P165.CB, (T0333)F188.CB) [> 4.0724 = 6.7874 < 8.8236] w=0.0244 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)H284.CB) [> 3.5943 = 5.9906 < 7.7877] w=0.0244 to align # Constraint # added constraint: constraint((T0333)T76.CB, (T0333)A91.CB) [> 4.3595 = 7.2658 < 9.4455] w=0.0244 to align # Constraint # added constraint: constraint((T0333)V74.CB, (T0333)A91.CB) [> 3.4406 = 5.7344 < 7.4547] w=0.0244 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)E172.CB) [> 3.9620 = 6.6033 < 8.5843] w=0.0244 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)A32.CB) [> 4.6534 = 7.7557 < 10.0824] w=0.0244 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)V133.CB) [> 4.0994 = 6.8324 < 8.8821] w=0.0244 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)E172.CB) [> 4.3058 = 7.1764 < 9.3293] w=0.0244 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)T119.CB) [> 3.5182 = 5.8636 < 7.6227] w=0.0244 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)T216.CB) [> 4.3514 = 7.2523 < 9.4280] w=0.0244 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)P193.CB) [> 3.9765 = 6.6274 < 8.6157] w=0.0244 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)A303.CB) [> 3.6516 = 6.0861 < 7.9119] w=0.0244 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)E172.CB) [> 4.0685 = 6.7808 < 8.8150] w=0.0244 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)Q116.CB) [> 4.2600 = 7.1000 < 9.2299] w=0.0244 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)A214.CB) [> 3.6986 = 6.1644 < 8.0137] w=0.0244 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)E212.CB) [> 4.1317 = 6.8862 < 8.9520] w=0.0244 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)E212.CB) [> 3.6787 = 6.1311 < 7.9704] w=0.0244 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)V113.CB) [> 3.0743 = 5.1238 < 6.6609] w=0.0244 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)V113.CB) [> 3.5630 = 5.9383 < 7.7198] w=0.0244 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)W187.CB) [> 3.3291 = 5.5485 < 7.2130] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)L246.CB) [> 4.0955 = 6.8258 < 8.8736] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V245.CB) [> 3.3691 = 5.6152 < 7.2997] w=0.0243 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)V245.CB) [> 3.9402 = 6.5669 < 8.5370] w=0.0243 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)F244.CB) [> 3.5731 = 5.9551 < 7.7417] w=0.0243 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)V29.CB) [> 4.4496 = 7.4159 < 9.6407] w=0.0243 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)Q161.CB) [> 3.6667 = 6.1111 < 7.9444] w=0.0243 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)G196.CA) [> 4.3696 = 7.2826 < 9.4674] w=0.0243 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)Y194.CB) [> 3.4646 = 5.7743 < 7.5066] w=0.0243 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)A34.CB) [> 4.6564 = 7.7607 < 10.0889] w=0.0243 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)V192.CB) [> 3.2129 = 5.3548 < 6.9613] w=0.0243 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)G196.CA) [> 3.3170 = 5.5284 < 7.1869] w=0.0243 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)F174.CB) [> 2.6985 = 4.4975 < 5.8468] w=0.0243 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)L246.CB) [> 3.9291 = 6.5486 < 8.5131] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)L246.CB) [> 2.9947 = 4.9912 < 6.4886] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)V245.CB) [> 4.2716 = 7.1194 < 9.2552] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)F244.CB) [> 4.0343 = 6.7239 < 8.7411] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)P193.CB) [> 3.2964 = 5.4940 < 7.1422] w=0.0243 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)P260.CB) [> 3.9814 = 6.6357 < 8.6264] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)Q137.CB) [> 4.0515 = 6.7525 < 8.7782] w=0.0243 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)L246.CB) [> 3.9694 = 6.6156 < 8.6003] w=0.0243 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)L302.CB) [> 3.6874 = 6.1457 < 7.9894] w=0.0243 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)I323.CB) [> 3.7459 = 6.2432 < 8.1162] w=0.0243 to align # Constraint # added constraint: constraint((T0333)L200.CB, (T0333)A214.CB) [> 3.9548 = 6.5913 < 8.5687] w=0.0242 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)V282.CB) [> 3.3583 = 5.5971 < 7.2763] w=0.0242 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V133.CB) [> 4.2160 = 7.0266 < 9.1346] w=0.0242 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)A280.CB) [> 4.6260 = 7.7101 < 10.0231] w=0.0242 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)V282.CB) [> 3.9610 = 6.6016 < 8.5821] w=0.0242 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)V281.CB) [> 3.2628 = 5.4380 < 7.0694] w=0.0242 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)A280.CB) [> 4.3302 = 7.2171 < 9.3822] w=0.0242 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V281.CB) [> 4.1357 = 6.8929 < 8.9608] w=0.0242 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)A280.CB) [> 3.2397 = 5.3995 < 7.0194] w=0.0242 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)A280.CB) [> 3.9697 = 6.6161 < 8.6010] w=0.0242 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)R135.CB) [> 3.5615 = 5.9358 < 7.7165] w=0.0242 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)R135.CB) [> 3.4641 = 5.7735 < 7.5056] w=0.0241 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)V290.CB) [> 4.1909 = 6.9849 < 9.0804] w=0.0241 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)G267.CA) [> 2.7149 = 4.5248 < 5.8822] w=0.0241 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)V112.CB) [> 3.7977 = 6.3296 < 8.2284] w=0.0241 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)D110.CB) [> 3.7480 = 6.2466 < 8.1206] w=0.0241 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)R108.CB) [> 3.7962 = 6.3271 < 8.2252] w=0.0241 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)F244.CB) [> 4.3784 = 7.2973 < 9.4866] w=0.0241 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)D243.CB) [> 2.9880 = 4.9800 < 6.4740] w=0.0241 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)D243.CB) [> 4.0651 = 6.7752 < 8.8078] w=0.0241 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)F244.CB) [> 4.4994 = 7.4989 < 9.7486] w=0.0241 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)V245.CB) [> 2.9592 = 4.9320 < 6.4116] w=0.0241 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)F244.CB) [> 3.7514 = 6.2524 < 8.1281] w=0.0241 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)V245.CB) [> 4.2864 = 7.1441 < 9.2873] w=0.0241 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)A247.CB) [> 4.2531 = 7.0885 < 9.2150] w=0.0241 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)P260.CB) [> 2.9013 = 4.8356 < 6.2862] w=0.0241 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)I323.CB) [> 4.4515 = 7.4192 < 9.6450] w=0.0241 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)D243.CB) [> 3.1994 = 5.3324 < 6.9321] w=0.0239 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)Q161.CB) [> 4.5742 = 7.6237 < 9.9108] w=0.0239 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)Y194.CB) [> 4.3787 = 7.2979 < 9.4873] w=0.0239 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)V192.CB) [> 3.7707 = 6.2845 < 8.1699] w=0.0239 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)G297.CA) [> 4.2365 = 7.0609 < 9.1792] w=0.0239 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)A214.CB) [> 4.5180 = 7.5300 < 9.7891] w=0.0239 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)V213.CB) [> 3.2438 = 5.4063 < 7.0282] w=0.0239 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)V213.CB) [> 3.5320 = 5.8867 < 7.6526] w=0.0239 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)A214.CB) [> 3.8419 = 6.4032 < 8.3241] w=0.0239 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)L248.CB) [> 4.4533 = 7.4222 < 9.6488] w=0.0239 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)I215.CB) [> 2.9533 = 4.9222 < 6.3989] w=0.0239 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)M217.CB) [> 3.2152 = 5.3586 < 6.9662] w=0.0239 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)G249.CA) [> 3.2690 = 5.4483 < 7.0828] w=0.0238 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)M217.CB) [> 4.2776 = 7.1293 < 9.2681] w=0.0238 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)H284.CB) [> 4.7397 = 7.8995 < 10.2694] w=0.0238 to align # Constraint # added constraint: constraint((T0333)T216.CB, (T0333)D243.CB) [> 4.2611 = 7.1019 < 9.2324] w=0.0234 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)G249.CA) [> 4.0382 = 6.7303 < 8.7494] w=0.0234 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)L246.CB) [> 3.4076 = 5.6794 < 7.3832] w=0.0233 to align # Constraint # added constraint: constraint((T0333)G297.CA, (T0333)L325.CB) [> 4.1022 = 6.8370 < 8.8881] w=0.0233 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)A303.CB) [> 4.2271 = 7.0451 < 9.1587] w=0.0201 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)L301.CB) [> 4.1692 = 6.9487 < 9.0333] w=0.0201 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)L301.CB) [> 3.8758 = 6.4596 < 8.3975] w=0.0201 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)L302.CB) [> 4.1214 = 6.8690 < 8.9297] w=0.0195 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)Q300.CB) [> 4.0893 = 6.8155 < 8.8601] w=0.0195 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)L302.CB) [> 3.7216 = 6.2027 < 8.0634] w=0.0189 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)A247.CB) [> 3.4047 = 5.6745 < 7.3768] w=0.0184 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)L246.CB) [> 4.7509 = 7.9182 < 10.2937] w=0.0183 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)I16.CB) [> 4.7579 = 7.9299 < 10.3089] w=0.0183 to align # Constraint # added constraint: constraint((T0333)A280.CB, (T0333)L302.CB) [> 3.7956 = 6.3260 < 8.2239] w=0.0183 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)V112.CB) [> 4.6717 = 7.7862 < 10.1221] w=0.0183 to align # Constraint # added constraint: constraint((T0333)G267.CA, (T0333)P304.CB) [> 3.9848 = 6.6414 < 8.6338] w=0.0183 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)I215.CB) [> 3.7848 = 6.3080 < 8.2004] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)E212.CB) [> 3.6282 = 6.0470 < 7.8611] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)E212.CB) [> 3.9147 = 6.5245 < 8.4819] w=0.0183 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)T119.CB) [> 4.4845 = 7.4742 < 9.7165] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)A247.CB) [> 4.1241 = 6.8734 < 8.9355] w=0.0183 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)L325.CB) [> 3.9023 = 6.5037 < 8.4549] w=0.0183 to align # Constraint # added constraint: constraint((T0333)L178.CB, (T0333)W187.CB) [> 3.6493 = 6.0821 < 7.9067] w=0.0183 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)M217.CB) [> 3.9259 = 6.5431 < 8.5060] w=0.0183 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)L302.CB) [> 4.4070 = 7.3450 < 9.5484] w=0.0183 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)A303.CB) [> 4.5135 = 7.5225 < 9.7793] w=0.0183 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)L302.CB) [> 3.0781 = 5.1302 < 6.6693] w=0.0183 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)A303.CB) [> 4.5076 = 7.5127 < 9.7665] w=0.0183 to align # Constraint # added constraint: constraint((T0333)G26.CA, (T0333)R69.CB) [> 4.6262 = 7.7103 < 10.0234] w=0.0183 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)E172.CB) [> 4.0696 = 6.7827 < 8.8175] w=0.0183 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)R135.CB) [> 4.7229 = 7.8715 < 10.2329] w=0.0183 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)G218.CA) [> 4.2189 = 7.0315 < 9.1410] w=0.0183 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)M217.CB) [> 3.4656 = 5.7760 < 7.5088] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)G218.CA) [> 4.1762 = 6.9603 < 9.0484] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)M217.CB) [> 3.8846 = 6.4744 < 8.4167] w=0.0183 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)F174.CB) [> 3.5184 = 5.8640 < 7.6232] w=0.0183 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)A247.CB) [> 3.1245 = 5.2075 < 6.7698] w=0.0183 to align # Constraint # added constraint: constraint((T0333)R108.CB, (T0333)D243.CB) [> 3.3686 = 5.6144 < 7.2987] w=0.0183 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)P193.CB) [> 2.5194 = 4.1991 < 5.4588] w=0.0183 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)G218.CA) [> 4.3135 = 7.1893 < 9.3460] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)G201.CA) [> 4.6987 = 7.8312 < 10.1806] w=0.0183 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)L301.CB) [> 4.1138 = 6.8563 < 8.9132] w=0.0183 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)T216.CB) [> 3.9839 = 6.6398 < 8.6318] w=0.0183 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)T216.CB) [> 3.0963 = 5.1604 < 6.7086] w=0.0183 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)V213.CB) [> 3.2334 = 5.3889 < 7.0056] w=0.0183 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)A214.CB) [> 4.2338 = 7.0563 < 9.1732] w=0.0183 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)A132.CB) [> 3.7899 = 6.3166 < 8.2115] w=0.0183 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)T216.CB) [> 3.3071 = 5.5118 < 7.1653] w=0.0183 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)M217.CB) [> 3.4858 = 5.8096 < 7.5525] w=0.0183 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)Q134.CB) [> 4.3593 = 7.2654 < 9.4450] w=0.0183 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)Q300.CB) [> 4.2762 = 7.1270 < 9.2651] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)L301.CB) [> 3.4817 = 5.8029 < 7.5438] w=0.0183 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)L302.CB) [> 4.2377 = 7.0629 < 9.1817] w=0.0183 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)A118.CB) [> 3.4614 = 5.7690 < 7.4997] w=0.0183 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)A118.CB) [> 3.7319 = 6.2198 < 8.0858] w=0.0183 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)Q137.CB) [> 4.5696 = 7.6160 < 9.9008] w=0.0183 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)S138.CB) [> 3.9758 = 6.6264 < 8.6143] w=0.0183 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)G218.CA) [> 3.5165 = 5.8609 < 7.6191] w=0.0183 to align # Constraint # added constraint: constraint((T0333)I220.CB, (T0333)D343.CB) [> 2.7973 = 4.6622 < 6.0608] w=0.0182 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)F174.CB) [> 3.0491 = 5.0818 < 6.6064] w=0.0182 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)Y194.CB) [> 2.7434 = 4.5724 < 5.9441] w=0.0182 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)P193.CB) [> 4.1139 = 6.8565 < 8.9135] w=0.0182 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)D243.CB) [> 4.1512 = 6.9186 < 8.9942] w=0.0182 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)Q134.CB) [> 4.5554 = 7.5923 < 9.8700] w=0.0182 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)L325.CB) [> 3.7345 = 6.2241 < 8.0914] w=0.0182 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)I215.CB) [> 3.9160 = 6.5266 < 8.4846] w=0.0182 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)I215.CB) [> 3.9536 = 6.5894 < 8.5661] w=0.0182 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)Q137.CB) [> 3.7027 = 6.1711 < 8.0224] w=0.0182 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)E172.CB) [> 3.7363 = 6.2272 < 8.0954] w=0.0182 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)P95.CB) [> 4.1211 = 6.8685 < 8.9291] w=0.0182 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)Q161.CB) [> 3.6978 = 6.1629 < 8.0118] w=0.0182 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V133.CB) [> 3.4367 = 5.7279 < 7.4462] w=0.0182 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)G267.CA) [> 4.1195 = 6.8658 < 8.9255] w=0.0182 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)Q161.CB) [> 4.0836 = 6.8061 < 8.8479] w=0.0182 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)L15.CB) [> 4.7231 = 7.8718 < 10.2333] w=0.0182 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)G218.CA) [> 3.4571 = 5.7618 < 7.4904] w=0.0182 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)I215.CB) [> 4.6364 = 7.7274 < 10.0456] w=0.0181 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)R261.CB) [> 3.4414 = 5.7357 < 7.4563] w=0.0181 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)N262.CB) [> 2.7062 = 4.5104 < 5.8635] w=0.0181 to align # Constraint # added constraint: constraint((T0333)N262.CB, (T0333)A280.CB) [> 4.4307 = 7.3846 < 9.5999] w=0.0181 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)H284.CB) [> 3.7962 = 6.3271 < 8.2252] w=0.0181 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)V282.CB) [> 2.5793 = 4.2989 < 5.5885] w=0.0181 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)V281.CB) [> 4.5002 = 7.5004 < 9.7505] w=0.0181 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V282.CB) [> 3.9263 = 6.5438 < 8.5070] w=0.0181 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)N262.CB) [> 4.6770 = 7.7949 < 10.1334] w=0.0181 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)A132.CB) [> 4.6670 = 7.7784 < 10.1119] w=0.0181 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)E115.CB) [> 3.2995 = 5.4992 < 7.1490] w=0.0181 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)A247.CB) [> 4.4815 = 7.4692 < 9.7099] w=0.0181 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)V290.CB) [> 3.7402 = 6.2336 < 8.1037] w=0.0180 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)G117.CA) [> 3.5181 = 5.8635 < 7.6225] w=0.0180 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)A34.CB) [> 4.6341 = 7.7234 < 10.0405] w=0.0180 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V213.CB) [> 2.9535 = 4.9225 < 6.3992] w=0.0180 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)A214.CB) [> 2.7385 = 4.5642 < 5.9335] w=0.0180 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)I215.CB) [> 3.4778 = 5.7964 < 7.5353] w=0.0180 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)I215.CB) [> 4.3166 = 7.1943 < 9.3526] w=0.0180 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)T216.CB) [> 2.9083 = 4.8472 < 6.3013] w=0.0180 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)M217.CB) [> 4.1243 = 6.8739 < 8.9361] w=0.0180 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)V120.CB) [> 3.5433 = 5.9056 < 7.6772] w=0.0180 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)E212.CB) [> 4.3378 = 7.2297 < 9.3986] w=0.0180 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)P260.CB) [> 4.7553 = 7.9254 < 10.3031] w=0.0180 to align # Constraint # added constraint: constraint((T0333)H283.CB, (T0333)I323.CB) [> 3.4792 = 5.7987 < 7.5384] w=0.0180 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)Q161.CB) [> 3.9734 = 6.6224 < 8.6091] w=0.0178 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V192.CB) [> 4.0513 = 6.7522 < 8.7778] w=0.0178 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)G196.CA) [> 3.2161 = 5.3601 < 6.9682] w=0.0178 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)V213.CB) [> 4.3773 = 7.2955 < 9.4842] w=0.0178 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)A247.CB) [> 3.4144 = 5.6907 < 7.3979] w=0.0178 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)Q137.CB) [> 3.4462 = 5.7437 < 7.4668] w=0.0177 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)Q161.CB) [> 4.0007 = 6.6678 < 8.6682] w=0.0176 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)A247.CB) [> 4.1921 = 6.9868 < 9.0828] w=0.0173 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)L248.CB) [> 4.6468 = 7.7447 < 10.0681] w=0.0173 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)G249.CA) [> 3.3394 = 5.5657 < 7.2354] w=0.0173 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)L246.CB) [> 4.5530 = 7.5883 < 9.8648] w=0.0173 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)L248.CB) [> 3.7758 = 6.2930 < 8.1809] w=0.0173 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)Q300.CB) [> 3.5401 = 5.9002 < 7.6703] w=0.0140 to align # Constraint # added constraint: constraint((T0333)R276.CB, (T0333)V290.CB) [> 4.3560 = 7.2600 < 9.4380] w=0.0134 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)A303.CB) [> 2.8528 = 4.7548 < 6.1812] w=0.0134 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)A303.CB) [> 3.7512 = 6.2520 < 8.1275] w=0.0134 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)N136.CB) [> 4.5281 = 7.5469 < 9.8110] w=0.0132 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)V29.CB) [> 4.6766 = 7.7944 < 10.1327] w=0.0128 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)L246.CB) [> 2.8385 = 4.7309 < 6.1501] w=0.0128 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)A303.CB) [> 3.1098 = 5.1830 < 6.7379] w=0.0127 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)L248.CB) [> 4.0172 = 6.6953 < 8.7039] w=0.0123 to align # Constraint # added constraint: constraint((T0333)G201.CA, (T0333)V213.CB) [> 4.4544 = 7.4240 < 9.6512] w=0.0122 to align # Constraint # added constraint: constraint((T0333)G201.CA, (T0333)D243.CB) [> 4.7217 = 7.8696 < 10.2304] w=0.0122 to align # Constraint # added constraint: constraint((T0333)G201.CA, (T0333)V245.CB) [> 4.1980 = 6.9967 < 9.0957] w=0.0122 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)R276.CB) [> 4.7147 = 7.8578 < 10.2151] w=0.0122 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)V192.CB) [> 3.6769 = 6.1282 < 7.9666] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)Y194.CB) [> 3.7835 = 6.3058 < 8.1976] w=0.0122 to align # Constraint # added constraint: constraint((T0333)P95.CB, (T0333)L123.CB) [> 4.2176 = 7.0293 < 9.1381] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)P193.CB) [> 4.0658 = 6.7763 < 8.8092] w=0.0122 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)Q161.CB) [> 2.8435 = 4.7392 < 6.1609] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)A198.CB) [> 3.3946 = 5.6577 < 7.3550] w=0.0122 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)A247.CB) [> 3.3414 = 5.5690 < 7.2397] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)A214.CB) [> 4.1795 = 6.9659 < 9.0557] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)W191.CB) [> 4.2721 = 7.1201 < 9.2562] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)A214.CB) [> 4.5398 = 7.5663 < 9.8362] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)I215.CB) [> 4.3236 = 7.2060 < 9.3678] w=0.0122 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)L302.CB) [> 4.6929 = 7.8214 < 10.1679] w=0.0122 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)Q300.CB) [> 4.2254 = 7.0423 < 9.1550] w=0.0122 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)A214.CB) [> 3.0779 = 5.1299 < 6.6688] w=0.0122 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)V213.CB) [> 3.3731 = 5.6219 < 7.3084] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)V290.CB) [> 4.0377 = 6.7294 < 8.7483] w=0.0122 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)T216.CB) [> 2.9309 = 4.8848 < 6.3502] w=0.0122 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)M217.CB) [> 4.4604 = 7.4340 < 9.6643] w=0.0122 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)G218.CA) [> 4.1651 = 6.9419 < 9.0245] w=0.0122 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)V290.CB) [> 3.3377 = 5.5628 < 7.2317] w=0.0122 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)H284.CB) [> 4.3151 = 7.1918 < 9.3493] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)I215.CB) [> 3.4277 = 5.7128 < 7.4267] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)A214.CB) [> 3.6069 = 6.0115 < 7.8150] w=0.0122 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)G218.CA) [> 3.8907 = 6.4845 < 8.4298] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)E115.CB) [> 4.1958 = 6.9929 < 9.0908] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)R135.CB) [> 4.2631 = 7.1052 < 9.2367] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)Y114.CB) [> 3.5672 = 5.9454 < 7.7290] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)A132.CB) [> 3.8590 = 6.4316 < 8.3611] w=0.0122 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)V192.CB) [> 4.2668 = 7.1114 < 9.2448] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)Y194.CB) [> 3.5854 = 5.9757 < 7.7684] w=0.0122 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)M217.CB) [> 3.7100 = 6.1833 < 8.0383] w=0.0122 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)G218.CA) [> 3.6679 = 6.1132 < 7.9472] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)P193.CB) [> 4.1254 = 6.8756 < 8.9383] w=0.0122 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)L248.CB) [> 3.9367 = 6.5612 < 8.5296] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)I323.CB) [> 4.4500 = 7.4166 < 9.6416] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)A303.CB) [> 4.3045 = 7.1741 < 9.3264] w=0.0122 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)L301.CB) [> 4.2478 = 7.0797 < 9.2036] w=0.0122 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)Q300.CB) [> 3.9794 = 6.6323 < 8.6220] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)L302.CB) [> 4.6447 = 7.7412 < 10.0636] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)L301.CB) [> 2.9884 = 4.9806 < 6.4748] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)Q300.CB) [> 4.7726 = 7.9544 < 10.3407] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)H283.CB) [> 4.3685 = 7.2809 < 9.4652] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)A198.CB) [> 3.4991 = 5.8319 < 7.5814] w=0.0122 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)A214.CB) [> 3.0635 = 5.1059 < 6.6377] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)I323.CB) [> 3.9626 = 6.6044 < 8.5857] w=0.0122 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)L325.CB) [> 3.9115 = 6.5192 < 8.4749] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)G218.CA) [> 4.6988 = 7.8314 < 10.1808] w=0.0122 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)E212.CB) [> 3.5851 = 5.9751 < 7.7676] w=0.0122 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)L246.CB) [> 4.1844 = 6.9739 < 9.0661] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)Q300.CB) [> 2.9704 = 4.9506 < 6.4358] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)L301.CB) [> 4.5360 = 7.5599 < 9.8279] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)Q300.CB) [> 4.4180 = 7.3634 < 9.5724] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)L302.CB) [> 3.0289 = 5.0483 < 6.5627] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)A303.CB) [> 4.0306 = 6.7177 < 8.7330] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)E212.CB) [> 3.1070 = 5.1783 < 6.7318] w=0.0122 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)A214.CB) [> 3.9592 = 6.5986 < 8.5782] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)A303.CB) [> 3.4717 = 5.7862 < 7.5221] w=0.0122 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)A214.CB) [> 4.3154 = 7.1924 < 9.3501] w=0.0122 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)E212.CB) [> 3.8070 = 6.3450 < 8.2485] w=0.0122 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)A247.CB) [> 4.6013 = 7.6688 < 9.9695] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)L325.CB) [> 4.4445 = 7.4075 < 9.6297] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)R108.CB) [> 3.3414 = 5.5690 < 7.2396] w=0.0122 to align # Constraint # added constraint: constraint((T0333)R108.CB, (T0333)E212.CB) [> 4.2391 = 7.0651 < 9.1846] w=0.0122 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)V213.CB) [> 3.9933 = 6.6556 < 8.6522] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)A214.CB) [> 4.0700 = 6.7833 < 8.8182] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)T216.CB) [> 4.4295 = 7.3824 < 9.5972] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)I215.CB) [> 3.0694 = 5.1157 < 6.6504] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)T216.CB) [> 4.0950 = 6.8250 < 8.8725] w=0.0122 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)V133.CB) [> 3.9585 = 6.5974 < 8.5767] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)L302.CB) [> 3.6514 = 6.0856 < 7.9113] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)A303.CB) [> 4.6593 = 7.7654 < 10.0951] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)G249.CA) [> 3.6996 = 6.1659 < 8.0157] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)A303.CB) [> 3.4869 = 5.8116 < 7.5550] w=0.0122 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)G249.CA) [> 4.0485 = 6.7475 < 8.7717] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)P299.CB) [> 3.8999 = 6.4998 < 8.4498] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)V290.CB) [> 4.7261 = 7.8768 < 10.2399] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)L302.CB) [> 3.7621 = 6.2702 < 8.1512] w=0.0122 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)L246.CB) [> 4.6758 = 7.7930 < 10.1309] w=0.0122 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)A247.CB) [> 3.8262 = 6.3769 < 8.2900] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)I215.CB) [> 3.4170 = 5.6950 < 7.4035] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)L246.CB) [> 2.9990 = 4.9984 < 6.4979] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)A247.CB) [> 4.3725 = 7.2876 < 9.4738] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)L246.CB) [> 4.7717 = 7.9528 < 10.3386] w=0.0122 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)L248.CB) [> 3.0291 = 5.0485 < 6.5631] w=0.0122 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)G249.CA) [> 3.7877 = 6.3129 < 8.2068] w=0.0122 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)V290.CB) [> 4.5261 = 7.5435 < 9.8066] w=0.0122 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)F244.CB) [> 4.6644 = 7.7740 < 10.1061] w=0.0122 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)G249.CA) [> 4.0726 = 6.7877 < 8.8239] w=0.0122 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)L248.CB) [> 4.6005 = 7.6675 < 9.9677] w=0.0122 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)L246.CB) [> 4.4485 = 7.4141 < 9.6383] w=0.0122 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)L302.CB) [> 3.6030 = 6.0049 < 7.8064] w=0.0122 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)W187.CB) [> 3.7367 = 6.2278 < 8.0961] w=0.0121 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)Y114.CB) [> 4.3978 = 7.3297 < 9.5286] w=0.0121 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)T119.CB) [> 3.6278 = 6.0463 < 7.8601] w=0.0121 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)T119.CB) [> 3.6700 = 6.1167 < 7.9517] w=0.0121 to align # Constraint # added constraint: constraint((T0333)I80.CB, (T0333)T119.CB) [> 3.2524 = 5.4207 < 7.0469] w=0.0121 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)Y194.CB) [> 4.2646 = 7.1077 < 9.2400] w=0.0121 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)N136.CB) [> 4.6299 = 7.7166 < 10.0315] w=0.0121 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)V290.CB) [> 4.3047 = 7.1745 < 9.3269] w=0.0121 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)F174.CB) [> 3.0421 = 5.0701 < 6.5911] w=0.0121 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)E172.CB) [> 3.6791 = 6.1319 < 7.9715] w=0.0121 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)P193.CB) [> 4.1552 = 6.9254 < 9.0030] w=0.0121 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)I80.CB) [> 4.5009 = 7.5015 < 9.7519] w=0.0121 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)M217.CB) [> 3.3626 = 5.6044 < 7.2857] w=0.0121 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)R135.CB) [> 3.9856 = 6.6427 < 8.6355] w=0.0121 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)Q161.CB) [> 4.4789 = 7.4648 < 9.7043] w=0.0121 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)P299.CB) [> 4.4095 = 7.3492 < 9.5540] w=0.0121 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)A280.CB) [> 3.5466 = 5.9110 < 7.6842] w=0.0121 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)L302.CB) [> 3.4842 = 5.8070 < 7.5491] w=0.0121 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)L301.CB) [> 4.0991 = 6.8318 < 8.8814] w=0.0121 to align # Constraint # added constraint: constraint((T0333)M217.CB, (T0333)Q300.CB) [> 3.5308 = 5.8847 < 7.6501] w=0.0121 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)L111.CB) [> 4.1911 = 6.9851 < 9.0806] w=0.0121 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)D110.CB) [> 3.6725 = 6.1209 < 7.9572] w=0.0121 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)H283.CB) [> 4.6990 = 7.8317 < 10.1813] w=0.0121 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)I215.CB) [> 3.8568 = 6.4281 < 8.3565] w=0.0121 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)V213.CB) [> 4.1491 = 6.9151 < 8.9896] w=0.0121 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)I215.CB) [> 4.3808 = 7.3014 < 9.4917] w=0.0121 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)M217.CB) [> 4.0563 = 6.7605 < 8.7887] w=0.0121 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)A214.CB) [> 3.8071 = 6.3452 < 8.2487] w=0.0121 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)T216.CB) [> 3.8227 = 6.3711 < 8.2825] w=0.0121 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)M217.CB) [> 2.6726 = 4.4543 < 5.7906] w=0.0121 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)G218.CA) [> 3.0934 = 5.1557 < 6.7024] w=0.0121 to align # Constraint # added constraint: constraint((T0333)W187.CB, (T0333)A198.CB) [> 2.9422 = 4.9037 < 6.3748] w=0.0121 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)I215.CB) [> 3.8824 = 6.4707 < 8.4119] w=0.0121 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)V282.CB) [> 4.6108 = 7.6847 < 9.9902] w=0.0121 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)H284.CB) [> 3.0645 = 5.1075 < 6.6398] w=0.0121 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)V290.CB) [> 3.6767 = 6.1277 < 7.9661] w=0.0121 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)W191.CB) [> 4.6395 = 7.7325 < 10.0523] w=0.0120 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)A132.CB) [> 4.1772 = 6.9619 < 9.0505] w=0.0120 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)I215.CB) [> 4.1623 = 6.9372 < 9.0184] w=0.0120 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)M217.CB) [> 3.2261 = 5.3768 < 6.9898] w=0.0120 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)A214.CB) [> 4.3957 = 7.3261 < 9.5240] w=0.0120 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)A214.CB) [> 4.0349 = 6.7249 < 8.7424] w=0.0120 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)E212.CB) [> 4.2491 = 7.0819 < 9.2064] w=0.0120 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)Q137.CB) [> 4.4490 = 7.4150 < 9.6395] w=0.0120 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)Y194.CB) [> 4.4984 = 7.4973 < 9.7465] w=0.0120 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)L246.CB) [> 4.0081 = 6.6802 < 8.6842] w=0.0120 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)V290.CB) [> 3.7439 = 6.2398 < 8.1118] w=0.0120 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)L246.CB) [> 4.5403 = 7.5672 < 9.8373] w=0.0120 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)A34.CB) [> 3.3845 = 5.6409 < 7.3331] w=0.0119 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)P193.CB) [> 4.2667 = 7.1112 < 9.2445] w=0.0117 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)Y194.CB) [> 3.4140 = 5.6900 < 7.3970] w=0.0117 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)G196.CA) [> 3.9478 = 6.5796 < 8.5535] w=0.0117 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)A247.CB) [> 3.7841 = 6.3068 < 8.1988] w=0.0117 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)T216.CB) [> 3.6960 = 6.1599 < 8.0079] w=0.0117 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)F174.CB) [> 3.9068 = 6.5113 < 8.4648] w=0.0117 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)W191.CB) [> 3.1751 = 5.2918 < 6.8794] w=0.0117 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)V192.CB) [> 3.7668 = 6.2780 < 8.1614] w=0.0117 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)W191.CB) [> 4.2661 = 7.1102 < 9.2433] w=0.0117 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)P193.CB) [> 3.6298 = 6.0497 < 7.8647] w=0.0117 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)Y194.CB) [> 4.3551 = 7.2585 < 9.4361] w=0.0117 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)P193.CB) [> 3.8625 = 6.4376 < 8.3688] w=0.0117 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)Y194.CB) [> 3.6734 = 6.1224 < 7.9591] w=0.0117 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)Y194.CB) [> 3.5244 = 5.8740 < 7.6362] w=0.0117 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)G196.CA) [> 4.7281 = 7.8802 < 10.2443] w=0.0117 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)G196.CA) [> 3.8641 = 6.4402 < 8.3722] w=0.0117 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)F244.CB) [> 3.7771 = 6.2952 < 8.1838] w=0.0117 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)V245.CB) [> 3.3032 = 5.5054 < 7.1569] w=0.0117 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)G249.CA) [> 3.0449 = 5.0749 < 6.5974] w=0.0117 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)Q161.CB) [> 4.6707 = 7.7844 < 10.1198] w=0.0116 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)L325.CB) [> 4.7441 = 7.9069 < 10.2789] w=0.0112 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)I323.CB) [> 4.4758 = 7.4597 < 9.6976] w=0.0112 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)L301.CB) [> 4.3351 = 7.2252 < 9.3928] w=0.0079 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)Q300.CB) [> 3.7259 = 6.2098 < 8.0728] w=0.0079 to align # Constraint # added constraint: constraint((T0333)L246.CB, (T0333)A303.CB) [> 2.6056 = 4.3426 < 5.6454] w=0.0079 to align # Constraint # added constraint: constraint((T0333)A247.CB, (T0333)L301.CB) [> 2.9132 = 4.8553 < 6.3119] w=0.0073 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)W187.CB) [> 3.8440 = 6.4066 < 8.3286] w=0.0067 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)Q161.CB) [> 4.4901 = 7.4835 < 9.7286] w=0.0067 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)E212.CB) [> 4.6924 = 7.8206 < 10.1668] w=0.0067 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)D243.CB) [> 2.6023 = 4.3372 < 5.6383] w=0.0067 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)L246.CB) [> 4.0209 = 6.7015 < 8.7120] w=0.0062 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V192.CB) [> 4.2194 = 7.0324 < 9.1420] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)W191.CB) [> 4.1712 = 6.9520 < 9.0376] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)Q161.CB) [> 4.3650 = 7.2751 < 9.4576] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)P193.CB) [> 4.3850 = 7.3083 < 9.5008] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)V133.CB) [> 4.0563 = 6.7604 < 8.7886] w=0.0061 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)P193.CB) [> 4.3092 = 7.1820 < 9.3366] w=0.0061 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)W191.CB) [> 4.3343 = 7.2239 < 9.3910] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)E172.CB) [> 3.5401 = 5.9001 < 7.6702] w=0.0061 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)V290.CB) [> 4.6915 = 7.8192 < 10.1650] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)V290.CB) [> 4.7127 = 7.8545 < 10.2108] w=0.0061 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)Q161.CB) [> 4.7576 = 7.9294 < 10.3082] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q134.CB, (T0333)F174.CB) [> 4.3152 = 7.1920 < 9.3496] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)F174.CB) [> 4.0189 = 6.6982 < 8.7077] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)E172.CB) [> 4.4530 = 7.4217 < 9.6482] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)Q161.CB) [> 4.7564 = 7.9273 < 10.3055] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)H283.CB) [> 4.4421 = 7.4035 < 9.6245] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)V281.CB) [> 4.3194 = 7.1990 < 9.3586] w=0.0061 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)G196.CA) [> 4.5877 = 7.6461 < 9.9399] w=0.0061 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)F174.CB) [> 4.2479 = 7.0798 < 9.2038] w=0.0061 to align # Constraint # added constraint: constraint((T0333)H284.CB, (T0333)Q300.CB) [> 3.7635 = 6.2726 < 8.1543] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V282.CB, (T0333)P299.CB) [> 4.4471 = 7.4118 < 9.6353] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)V213.CB) [> 4.7945 = 7.9908 < 10.3880] w=0.0061 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)W191.CB) [> 3.4720 = 5.7867 < 7.5227] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)D243.CB) [> 4.0332 = 6.7221 < 8.7387] w=0.0061 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)A132.CB) [> 4.3581 = 7.2635 < 9.4426] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)L248.CB) [> 2.2977 = 3.8296 < 4.9785] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)Y194.CB) [> 4.3511 = 7.2518 < 9.4273] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)L248.CB) [> 3.9668 = 6.6113 < 8.5947] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)G117.CA) [> 4.7116 = 7.8527 < 10.2085] w=0.0061 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)R135.CB) [> 4.7944 = 7.9907 < 10.3879] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)A198.CB) [> 3.7618 = 6.2697 < 8.1507] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G218.CA, (T0333)V245.CB) [> 4.6829 = 7.8049 < 10.1464] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)L246.CB) [> 4.4014 = 7.3357 < 9.5364] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)E212.CB) [> 3.1843 = 5.3071 < 6.8993] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)V213.CB) [> 3.4660 = 5.7767 < 7.5097] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)A214.CB) [> 3.8866 = 6.4776 < 8.4209] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)T216.CB) [> 3.3773 = 5.6288 < 7.3174] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)A214.CB) [> 3.1333 = 5.2222 < 6.7888] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)G218.CA) [> 4.7840 = 7.9733 < 10.3653] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)A198.CB) [> 4.3825 = 7.3042 < 9.4955] w=0.0061 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)A214.CB) [> 3.8298 = 6.3831 < 8.2980] w=0.0061 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)I215.CB) [> 3.8439 = 6.4064 < 8.3284] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)L302.CB) [> 4.4943 = 7.4905 < 9.7377] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)V213.CB) [> 3.0693 = 5.1156 < 6.6502] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)Q137.CB) [> 4.2668 = 7.1114 < 9.2448] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)V290.CB) [> 3.6614 = 6.1024 < 7.9331] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)P193.CB) [> 4.0193 = 6.6988 < 8.7085] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)V192.CB) [> 2.6607 = 4.4345 < 5.7648] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)V192.CB) [> 3.7551 = 6.2585 < 8.1361] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)M217.CB) [> 4.6347 = 7.7245 < 10.0418] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)M217.CB) [> 3.9517 = 6.5862 < 8.5621] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)M217.CB) [> 3.6437 = 6.0729 < 7.8948] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)W191.CB) [> 4.3478 = 7.2463 < 9.4203] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)P193.CB) [> 3.6841 = 6.1401 < 7.9822] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)E172.CB) [> 4.5443 = 7.5738 < 9.8459] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)E172.CB) [> 4.3523 = 7.2538 < 9.4300] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)E172.CB) [> 2.8254 = 4.7089 < 6.1216] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)W191.CB) [> 4.5840 = 7.6400 < 9.9321] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)F174.CB) [> 4.3955 = 7.3259 < 9.5236] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)W191.CB) [> 3.1758 = 5.2930 < 6.8808] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)W191.CB) [> 4.7110 = 7.8517 < 10.2072] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)V192.CB) [> 3.2709 = 5.4515 < 7.0869] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V213.CB, (T0333)I323.CB) [> 3.3825 = 5.6375 < 7.3288] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)I323.CB) [> 4.4545 = 7.4242 < 9.6515] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A214.CB, (T0333)L325.CB) [> 4.6057 = 7.6761 < 9.9790] w=0.0061 to align # Constraint # added constraint: constraint((T0333)I215.CB, (T0333)L325.CB) [> 3.4242 = 5.7071 < 7.4192] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)E172.CB) [> 4.0274 = 6.7123 < 8.7260] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)Y194.CB) [> 3.6079 = 6.0132 < 7.8171] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)A198.CB) [> 2.7281 = 4.5468 < 5.9109] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)Q300.CB) [> 3.7348 = 6.2247 < 8.0922] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)L301.CB) [> 4.3000 = 7.1666 < 9.3166] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)L302.CB) [> 3.8347 = 6.3911 < 8.3084] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)A303.CB) [> 3.3733 = 5.6222 < 7.3088] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)P299.CB) [> 4.7641 = 7.9401 < 10.3221] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)P299.CB) [> 3.1604 = 5.2674 < 6.8476] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)V192.CB) [> 3.2676 = 5.4460 < 7.0798] w=0.0061 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)V213.CB) [> 4.5771 = 7.6285 < 9.9170] w=0.0061 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)E212.CB) [> 3.7571 = 6.2619 < 8.1404] w=0.0061 to align # Constraint # added constraint: constraint((T0333)R135.CB, (T0333)E212.CB) [> 4.3412 = 7.2353 < 9.4059] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)M217.CB) [> 4.2677 = 7.1129 < 9.2467] w=0.0061 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)A214.CB) [> 2.4335 = 4.0559 < 5.2726] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)T119.CB) [> 4.4874 = 7.4790 < 9.7227] w=0.0061 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)A303.CB) [> 4.2043 = 7.0072 < 9.1094] w=0.0061 to align # Constraint # added constraint: constraint((T0333)S5.CB, (T0333)L302.CB) [> 3.6464 = 6.0774 < 7.9006] w=0.0061 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)A303.CB) [> 4.7561 = 7.9268 < 10.3048] w=0.0061 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)L302.CB) [> 2.7810 = 4.6349 < 6.0254] w=0.0061 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)L301.CB) [> 4.1880 = 6.9800 < 9.0740] w=0.0061 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)Q300.CB) [> 3.9294 = 6.5490 < 8.5136] w=0.0061 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)I31.CB) [> 2.9923 = 4.9872 < 6.4834] w=0.0061 to align # Constraint # added constraint: constraint((T0333)S6.CB, (T0333)L325.CB) [> 4.0938 = 6.8229 < 8.8698] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)M217.CB) [> 4.5890 = 7.6484 < 9.9429] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)V281.CB) [> 4.3374 = 7.2289 < 9.3976] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)H283.CB) [> 3.9305 = 6.5509 < 8.5162] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)H283.CB) [> 4.3058 = 7.1763 < 9.3292] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)L325.CB) [> 3.6839 = 6.1398 < 7.9818] w=0.0061 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)E212.CB) [> 3.8502 = 6.4170 < 8.3421] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)A198.CB) [> 2.4558 = 4.0930 < 5.3209] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)G249.CA) [> 4.0194 = 6.6989 < 8.7086] w=0.0061 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)T216.CB) [> 4.1117 = 6.8529 < 8.9088] w=0.0061 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)I215.CB) [> 4.7125 = 7.8541 < 10.2103] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)Q161.CB) [> 2.8679 = 4.7798 < 6.2137] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)G249.CA) [> 4.1443 = 6.9071 < 8.9793] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)G249.CA) [> 3.6071 = 6.0118 < 7.8154] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)F174.CB) [> 4.6958 = 7.8263 < 10.1741] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)M217.CB) [> 4.1435 = 6.9059 < 8.9777] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)A214.CB) [> 2.6810 = 4.4683 < 5.8088] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A198.CB, (T0333)V213.CB) [> 3.2100 = 5.3500 < 6.9549] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)V213.CB) [> 3.2930 = 5.4883 < 7.1348] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)F174.CB) [> 4.5188 = 7.5314 < 9.7908] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)P193.CB) [> 3.6040 = 6.0066 < 7.8086] w=0.0061 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)E115.CB) [> 4.3474 = 7.2457 < 9.4194] w=0.0061 to align # Constraint # added constraint: constraint((T0333)P193.CB, (T0333)D243.CB) [> 4.5002 = 7.5003 < 9.7504] w=0.0061 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)R135.CB) [> 3.6671 = 6.1118 < 7.9454] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)A198.CB) [> 4.5710 = 7.6182 < 9.9037] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)A198.CB) [> 4.2167 = 7.0278 < 9.1361] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)G196.CA) [> 4.7562 = 7.9270 < 10.3052] w=0.0061 to align # Constraint # added constraint: constraint((T0333)I16.CB, (T0333)V29.CB) [> 2.9780 = 4.9634 < 6.4524] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F244.CB, (T0333)H284.CB) [> 3.5483 = 5.9138 < 7.6880] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)T279.CB) [> 3.2016 = 5.3360 < 6.9368] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)A280.CB) [> 3.9933 = 6.6556 < 8.6522] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)T279.CB) [> 4.5862 = 7.6436 < 9.9367] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)V281.CB) [> 4.1778 = 6.9629 < 9.0518] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)H283.CB) [> 4.3971 = 7.3286 < 9.5271] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)H283.CB) [> 4.0007 = 6.6679 < 8.6682] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)H283.CB) [> 3.0110 = 5.0183 < 6.5237] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q137.CB, (T0333)A198.CB) [> 4.1020 = 6.8366 < 8.8876] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)V120.CB) [> 4.2568 = 7.0947 < 9.2232] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)V245.CB) [> 4.1226 = 6.8710 < 8.9323] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)L301.CB) [> 2.8999 = 4.8332 < 6.2832] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)L302.CB) [> 4.1663 = 6.9438 < 9.0269] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)L248.CB) [> 4.1866 = 6.9777 < 9.0711] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)L301.CB) [> 3.1147 = 5.1912 < 6.7486] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L111.CB, (T0333)A247.CB) [> 4.4407 = 7.4011 < 9.6215] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)A247.CB) [> 4.2252 = 7.0420 < 9.1546] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)L248.CB) [> 4.6842 = 7.8071 < 10.1492] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)A247.CB) [> 3.3908 = 5.6513 < 7.3467] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)A303.CB) [> 4.1120 = 6.8534 < 8.9094] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)L248.CB) [> 4.0890 = 6.8149 < 8.8594] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)L246.CB) [> 4.4642 = 7.4403 < 9.6724] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)A247.CB) [> 4.6975 = 7.8292 < 10.1779] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)L248.CB) [> 2.6470 = 4.4116 < 5.7351] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)A303.CB) [> 2.6688 = 4.4480 < 5.7824] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)L301.CB) [> 4.2229 = 7.0382 < 9.1497] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)A303.CB) [> 4.0918 = 6.8197 < 8.8656] w=0.0061 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)L246.CB) [> 4.1652 = 6.9420 < 9.0246] w=0.0061 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)L248.CB) [> 3.9299 = 6.5499 < 8.5148] w=0.0061 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)A303.CB) [> 3.9316 = 6.5526 < 8.5184] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)T216.CB) [> 3.0610 = 5.1017 < 6.6321] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)V245.CB) [> 4.5605 = 7.6008 < 9.8811] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)L246.CB) [> 3.5457 = 5.9096 < 7.6824] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L12.CB, (T0333)G249.CA) [> 3.1877 = 5.3128 < 6.9066] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)A247.CB) [> 4.4977 = 7.4962 < 9.7451] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)L248.CB) [> 4.6701 = 7.7836 < 10.1186] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)G249.CA) [> 3.7583 = 6.2638 < 8.1430] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)A303.CB) [> 4.6701 = 7.7835 < 10.1185] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)V112.CB) [> 3.2773 = 5.4622 < 7.1009] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)V113.CB) [> 4.7519 = 7.9197 < 10.2957] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)Q300.CB) [> 2.0349 = 3.3915 < 4.4089] w=0.0061 to align # Constraint # added constraint: constraint((T0333)D243.CB, (T0333)L301.CB) [> 4.4280 = 7.3800 < 9.5941] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)Q300.CB) [> 4.1604 = 6.9341 < 9.0143] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L248.CB, (T0333)L301.CB) [> 3.6341 = 6.0569 < 7.8740] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)L301.CB) [> 4.5361 = 7.5602 < 9.8283] w=0.0061 to align # Constraint # added constraint: constraint((T0333)G249.CA, (T0333)L302.CB) [> 4.4359 = 7.3931 < 9.6110] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)W191.CB) [> 3.8368 = 6.3946 < 8.3130] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)I215.CB) [> 4.5671 = 7.6119 < 9.8955] w=0.0061 to align # Constraint # added constraint: constraint((T0333)A132.CB, (T0333)T216.CB) [> 3.8337 = 6.3896 < 8.3064] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)T216.CB) [> 4.3784 = 7.2973 < 9.4865] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)F244.CB) [> 4.7006 = 7.8343 < 10.1846] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)N136.CB) [> 3.9454 = 6.5757 < 8.5484] w=0.0061 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)V213.CB) [> 4.2376 = 7.0626 < 9.1814] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V290.CB, (T0333)P299.CB) [> 3.6957 = 6.1594 < 8.0072] w=0.0061 to align # Constraint # added constraint: constraint((T0333)V245.CB, (T0333)A303.CB) [> 4.3460 = 7.2433 < 9.4163] w=0.0061 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)D243.CB) [> 4.6962 = 7.8270 < 10.1751] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)L325.CB) [> 4.1662 = 6.9436 < 9.0267] w=0.0061 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)Q300.CB) [> 3.7150 = 6.1916 < 8.0491] w=0.0061 to align # Constraint # added constraint: constraint((T0333)E212.CB, (T0333)L325.CB) [> 3.6876 = 6.1461 < 7.9899] w=0.0061 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)E35.CB) [> 4.7678 = 7.9463 < 10.3302] w=0.0060 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)W191.CB) [> 3.7747 = 6.2912 < 8.1785] w=0.0060 to align # Constraint # added constraint: constraint((T0333)S138.CB, (T0333)A198.CB) [> 4.0032 = 6.6720 < 8.6735] w=0.0060 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)V192.CB) [> 3.4704 = 5.7840 < 7.5192] w=0.0060 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)Y194.CB) [> 4.3967 = 7.3279 < 9.5263] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)V192.CB) [> 4.4449 = 7.4082 < 9.6306] w=0.0060 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)A247.CB) [> 3.3558 = 5.5931 < 7.2710] w=0.0060 to align # Constraint # added constraint: constraint((T0333)Y114.CB, (T0333)V245.CB) [> 2.6719 = 4.4532 < 5.7892] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)D243.CB) [> 4.2099 = 7.0165 < 9.1214] w=0.0060 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)V245.CB) [> 4.3710 = 7.2851 < 9.4706] w=0.0060 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)L246.CB) [> 3.2312 = 5.3854 < 7.0010] w=0.0060 to align # Constraint # added constraint: constraint((T0333)E115.CB, (T0333)L248.CB) [> 4.0698 = 6.7830 < 8.8179] w=0.0060 to align # Constraint # added constraint: constraint((T0333)D110.CB, (T0333)R135.CB) [> 3.6675 = 6.1125 < 7.9463] w=0.0060 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)A132.CB) [> 4.3959 = 7.3264 < 9.5244] w=0.0060 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)A132.CB) [> 3.5119 = 5.8532 < 7.6091] w=0.0060 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)Q161.CB) [> 3.4373 = 5.7289 < 7.4475] w=0.0060 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)A214.CB) [> 4.2881 = 7.1469 < 9.2909] w=0.0060 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)I215.CB) [> 4.7061 = 7.8434 < 10.1965] w=0.0060 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)T216.CB) [> 3.5226 = 5.8710 < 7.6323] w=0.0060 to align # Constraint # added constraint: constraint((T0333)A32.CB, (T0333)M217.CB) [> 4.2129 = 7.0216 < 9.1280] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)D110.CB) [> 3.4422 = 5.7370 < 7.4581] w=0.0060 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)Q161.CB) [> 4.4580 = 7.4301 < 9.6591] w=0.0060 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)A214.CB) [> 4.5557 = 7.5929 < 9.8708] w=0.0060 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)I215.CB) [> 3.2223 = 5.3706 < 6.9817] w=0.0060 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)M217.CB) [> 4.1529 = 6.9215 < 8.9979] w=0.0060 to align # Constraint # added constraint: constraint((T0333)A34.CB, (T0333)G196.CA) [> 4.3986 = 7.3310 < 9.5302] w=0.0060 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)Q137.CB) [> 4.4251 = 7.3751 < 9.5876] w=0.0060 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)G196.CA) [> 4.6178 = 7.6963 < 10.0052] w=0.0060 to align # Constraint # added constraint: constraint((T0333)E35.CB, (T0333)A198.CB) [> 4.7888 = 7.9813 < 10.3757] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)Q161.CB) [> 4.7121 = 7.8535 < 10.2096] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)E172.CB) [> 2.8364 = 4.7273 < 6.1455] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)T216.CB) [> 4.4239 = 7.3732 < 9.5852] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)M217.CB) [> 3.7197 = 6.1995 < 8.0594] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V33.CB, (T0333)G218.CA) [> 3.1938 = 5.3230 < 6.9199] w=0.0060 to align # Constraint # added constraint: constraint((T0333)L2.CB, (T0333)V120.CB) [> 4.7556 = 7.9260 < 10.3038] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)A132.CB) [> 3.5332 = 5.8887 < 7.6553] w=0.0060 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)Q161.CB) [> 3.8787 = 6.4645 < 8.4039] w=0.0060 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V213.CB) [> 4.1359 = 6.8932 < 8.9612] w=0.0060 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)A214.CB) [> 2.3574 = 3.9291 < 5.1078] w=0.0060 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)I215.CB) [> 4.3044 = 7.1740 < 9.3263] w=0.0060 to align # Constraint # added constraint: constraint((T0333)I31.CB, (T0333)V120.CB) [> 4.5686 = 7.6143 < 9.8985] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)E212.CB) [> 4.2856 = 7.1427 < 9.2855] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)V213.CB) [> 2.7750 = 4.6250 < 6.0125] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)A214.CB) [> 4.0926 = 6.8210 < 8.8672] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)I215.CB) [> 3.7397 = 6.2329 < 8.1027] w=0.0060 to align # Constraint # added constraint: constraint((T0333)L30.CB, (T0333)V120.CB) [> 4.6602 = 7.7670 < 10.0972] w=0.0060 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)M217.CB) [> 2.1126 = 3.5210 < 4.5773] w=0.0060 to align # Constraint # added constraint: constraint((T0333)Q116.CB, (T0333)G218.CA) [> 3.8200 = 6.3667 < 8.2767] w=0.0060 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)Q161.CB) [> 4.6571 = 7.7618 < 10.0903] w=0.0060 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)M217.CB) [> 3.6740 = 6.1233 < 7.9603] w=0.0060 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)G218.CA) [> 3.7534 = 6.2557 < 8.1323] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)Q161.CB) [> 3.7463 = 6.2438 < 8.1169] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)G218.CA) [> 3.7057 = 6.1762 < 8.0290] w=0.0060 to align # Constraint # added constraint: constraint((T0333)N136.CB, (T0333)G218.CA) [> 4.5528 = 7.5880 < 9.8644] w=0.0060 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)V213.CB) [> 4.7277 = 7.8795 < 10.2434] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)T216.CB) [> 4.1456 = 6.9094 < 8.9822] w=0.0060 to align # Constraint # added constraint: constraint((T0333)V4.CB, (T0333)V213.CB) [> 3.9338 = 6.5564 < 8.5233] w=0.0060 to align # Constraint # added constraint: constraint((T0333)F3.CB, (T0333)T216.CB) [> 3.4045 = 5.6742 < 7.3765] w=0.0060 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)A214.CB) [> 4.1249 = 6.8748 < 8.9373] w=0.0060 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)E212.CB) [> 3.0787 = 5.1312 < 6.6705] w=0.0060 to align # Constraint # added constraint: constraint((T0333)M1.CB, (T0333)S138.CB) [> 4.1716 = 6.9527 < 9.0385] w=0.0059 to align # Constraint # added constraint: constraint((T0333)V113.CB, (T0333)V290.CB) [> 4.6908 = 7.8179 < 10.1633] w=0.0059 to align # Constraint # added constraint: constraint((T0333)V133.CB, (T0333)V290.CB) [> 4.1110 = 6.8517 < 8.9073] w=0.0059 to align # Constraint # added constraint: constraint((T0333)L15.CB, (T0333)V120.CB) [> 4.7901 = 7.9834 < 10.3785] w=0.0059 to align # Constraint # added constraint: constraint((T0333)Q161.CB, (T0333)D243.CB) [> 4.0115 = 6.6858 < 8.6916] w=0.0059 to align # Constraint # added constraint: constraint((T0333)A118.CB, (T0333)G196.CA) [> 3.5017 = 5.8361 < 7.5869] w=0.0056 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)A198.CB) [> 4.5658 = 7.6097 < 9.8927] w=0.0056 to align # Constraint # added constraint: constraint((T0333)G117.CA, (T0333)G196.CA) [> 4.0833 = 6.8056 < 8.8472] w=0.0056 to align # Constraint # added constraint: constraint((T0333)V112.CB, (T0333)F174.CB) [> 3.2108 = 5.3514 < 6.9568] w=0.0056 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)F244.CB) [> 4.7725 = 7.9542 < 10.3405] w=0.0056 to align # Constraint # added constraint: constraint((T0333)L18.CB, (T0333)V33.CB) [> 4.7460 = 7.9099 < 10.2829] w=0.0018 to align # Constraint # added constraint: constraint((T0333)T119.CB, (T0333)I323.CB) [> 4.4320 = 7.3867 < 9.6028] w=0.0006 to align # Constraint # added constraint: constraint((T0333)V29.CB, (T0333)Y194.CB) [> 3.9409 = 6.5682 < 8.5387] w=0.0006 to align # Constraint # added constraint: constraint((T0333)V192.CB, (T0333)P299.CB) [> 3.1581 = 5.2634 < 6.8424] w=0.0006 to align # Constraint # added constraint: constraint((T0333)Y194.CB, (T0333)E212.CB) [> 2.9822 = 4.9704 < 6.4615] w=0.0006 to align # Constraint # added constraint: constraint((T0333)G196.CA, (T0333)A303.CB) [> 4.4399 = 7.3999 < 9.6199] w=0.0006 to align # Constraint # added constraint: constraint((T0333)V120.CB, (T0333)I323.CB) [> 3.3973 = 5.6622 < 7.3609] w=0.0006 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)L301.CB) [> 3.2747 = 5.4579 < 7.0953] w=0.0006 to align # Constraint # added constraint: constraint((T0333)W191.CB, (T0333)L325.CB) [> 4.5679 = 7.6133 < 9.8972] w=0.0006 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)P299.CB) [> 2.8577 = 4.7628 < 6.1917] w=0.0006 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)Q300.CB) [> 4.7372 = 7.8953 < 10.2639] w=0.0006 to align # Constraint # added constraint: constraint((T0333)E172.CB, (T0333)L325.CB) [> 4.2898 = 7.1496 < 9.2944] w=0.0006 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)P299.CB) [> 3.3267 = 5.5445 < 7.2079] w=0.0006 to align # Constraint # added constraint: constraint((T0333)F174.CB, (T0333)L325.CB) [> 2.9917 = 4.9862 < 6.4821] w=0.0006 to align Unrecognized cost function all for SetCost Unrecognized cost function 1 for SetCost # SetCost created cost = # ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0333/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0333/decoys/ # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # choosing archetypes in rotamer library # Found a chain break before 340 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # Found a chain break before 361 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # Found a chain break before 354 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # Found a chain break before 361 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # Found a chain break before 361 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # Found a chain break before 362 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # Found a chain break before 363 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 359 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 360 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 260 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 306 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 361 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 327 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 339 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 344 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 360 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 307 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 360 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 361 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 307 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 358 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 362 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # Found a chain break before 362 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 366 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # Found a chain break before 362 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # Found a chain break before 363 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CPHmodels_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation CPHmodels_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 363 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # Found a chain break before 367 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 362 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # Found a chain break before 362 # copying to AlignedFragments data structure # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # Found a chain break before 363 # copying to AlignedFragments data structure # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # Found a chain break before 363 # copying to AlignedFragments data structure # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 367 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 360 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 358 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 260 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 306 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0333 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 297 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 364 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 347 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 DYSAVKVFEQVAKDNPRFAETVATRP 1v71A 129 :YKDDREKMAKEISEREGLTIIPPYDHP T0333 90 :AAVNRPLV 1v71A 156 :HVLAGQGT T0333 99 :GTMALVDDYR 1v71A 164 :AAKELFEEVG T0333 109 :PDLVVY 1v71A 175 :LDALFV T0333 115 :EQGA 1v71A 183 :GGGG T0333 119 :TVGLLAADRA 1v71A 189 :SGSALAARHF T0333 129 :GVPAVQRNQSA 1v71A 201 :NCEVYGVEPEA T0333 140 :WRTRGMHRSIASFLTDLMDKHQVSLP 1v71A 237 :AQTQHLGNYTFSIIKEKVDDILTVSD T0333 228 :GAVEPIIAAAGEV 1v71A 263 :EELIDCLKFYAAR T0333 241 :DADF 1v71A 277 :KIVV T0333 250 :DLDI 1v71A 281 :EPTG T0333 254 :SPLGTL 1v71A 296 :EKLKNK T0333 279 :TAVVHHGGGGT 1v71A 302 :RIGIIISGGNV T0333 343 :DESLRTAA 1v71A 313 :DIERYAHF Number of specific fragments extracted= 18 number of extra gaps= 0 total=2427 Number of alignments=122 # 1v71A read from 1v71A/merged-good-all-a2m # found chain 1v71A in template set T0333 3 :FVSSPGI 1v71A 77 :VLTFSSG T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1v71A 84 :NHAQAIALSAKILGIPAKIIM T0333 34 :A 1v71A 106 :L T0333 35 :EHADRAAAAGLEVVDVAPDYSAVKVF 1v71A 111 :AKVAATKGYGGQVIMYDRYKDDREKM T0333 61 :EQVAKDNPRFAETVATR 1v71A 138 :KEISEREGLTIIPPYDH T0333 83 :EEWGVQIAAVNRPLVDGT 1v71A 155 :PHVLAGQGTAAKELFEEV T0333 108 :RPDLVVYEQGAT 1v71A 174 :PLDALFVCLGGG T0333 120 :VGLLAADRA 1v71A 190 :GSALAARHF T0333 129 :GVPAVQRNQSAWRTRGMHRSIASFLT 1v71A 201 :NCEVYGVEPEAGNDGQQSFRKGSIVH T0333 202 :DRLPPVPARPEVAITMGTIEL 1v71A 292 :RAMKEKLKNKRIGIIISGGNV T0333 226 :GIGAVEPII 1v71A 313 :DIERYAHFL Number of specific fragments extracted= 11 number of extra gaps= 0 total=2438 Number of alignments=123 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oi7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0333 read from 1oi7A/merged-good-all-a2m # 1oi7A read from 1oi7A/merged-good-all-a2m # found chain 1oi7A in training set Warning: unaligning (T0333)G195 because of BadResidue code BAD_PEPTIDE in next template residue (1oi7A)G121 Warning: unaligning (T0333)G196 because of BadResidue code BAD_PEPTIDE at template residue (1oi7A)G121 Warning: unaligning (T0333)R307 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1oi7A)V255 T0333 2 :LFVSSPGI 1oi7A 10 :VLVQGITG T0333 14 :PLIQLAWGFRTAGHDVLIAV 1oi7A 19 :EGQFHTKQMLTYGTKIVAGV T0333 34 :AEHADR 1oi7A 40 :PGKGGM T0333 41 :AAAGLEVVD 1oi7A 46 :EVLGVPVYD T0333 81 :DLE 1oi7A 55 :TVK T0333 99 :GT 1oi7A 58 :EA T0333 104 :VDDYRPDLVVYEQGAT 1oi7A 60 :VAHHEVDASIIFVPAP T0333 120 :VGLLAAD 1oi7A 80 :AALEAAH T0333 128 :AGVPAVQRNQS 1oi7A 87 :AGIPLIVLITE T0333 144 :GMHR 1oi7A 98 :GIPT T0333 148 :SIASFLTDLMDKHQ 1oi7A 103 :DMVRAVEEIKALGS T0333 192 :VPY 1oi7A 117 :RLI T0333 197 :GAV 1oi7A 122 :NCP T0333 200 :LGDRL 1oi7A 138 :PGHVF T0333 209 :ARPEVAITMG 1oi7A 143 :KRGRVGIISR T0333 226 :GIGAVEPIIAAAGEVDADF 1oi7A 153 :SGTLTYEAAAALSQAGLGT T0333 245 :VLALGDLDI 1oi7A 174 :TVGIGGDPV T0333 256 :L 1oi7A 183 :I T0333 268 :WTPLHTLLRT 1oi7A 184 :GTTFKDLLPL T0333 278 :CTAVVHHG 1oi7A 200 :TEAVVLIG T0333 286 :GGGTVMTAIDA 1oi7A 210 :GGSDEEEAAAW T0333 297 :GIPQLLAPDP 1oi7A 226 :KKPVVGFIGG T0333 327 :STS 1oi7A 256 :GTP T0333 344 :ESLRTAAREV 1oi7A 259 :ESKLRAFAEA T0333 360 :LP 1oi7A 273 :AD T0333 363 :PAETVRRIVERI 1oi7A 275 :TIDEIVELVKKA Number of specific fragments extracted= 26 number of extra gaps= 1 total=2464 Number of alignments=124 # 1oi7A read from 1oi7A/merged-good-all-a2m # found chain 1oi7A in training set Warning: unaligning (T0333)V162 because of BadResidue code BAD_PEPTIDE in next template residue (1oi7A)G121 Warning: unaligning (T0333)S163 because of BadResidue code BAD_PEPTIDE at template residue (1oi7A)G121 Warning: unaligning (T0333)R307 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1oi7A)V255 Warning: unaligning (T0333)S329 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1oi7A)V255 T0333 11 :HLFPLIQLAWGFRTAGHDVLIAVAEHADRAAAAGLEVVD 1oi7A 16 :TGREGQFHTKQMLTYGTKIVAGVTPGKGGMEVLGVPVYD T0333 99 :GTMALVDDYRPDLVVYEQGA 1oi7A 55 :TVKEAVAHHEVDASIIFVPA T0333 119 :TVGLLAADRAGVPAVQRNQSA 1oi7A 78 :ADAALEAAHAGIPLIVLITEG T0333 141 :RTRGMHRSIASFLTDLMDKHQ 1oi7A 99 :IPTLDMVRAVEEIKALGSRLI T0333 164 :LPE 1oi7A 122 :NCP T0333 191 :WVP 1oi7A 133 :KIG T0333 198 :AVLGDRLP 1oi7A 136 :IMPGHVFK T0333 211 :PEVAITMGTIE 1oi7A 144 :RGRVGIISRSG T0333 228 :GAVEPIIAAAGEV 1oi7A 155 :TLTYEAAAALSQA T0333 241 :DADFVLALGDLDI 1oi7A 170 :GTTTTVGIGGDPV T0333 271 :LHTLLR 1oi7A 187 :FKDLLP T0333 277 :TCTAVVHHG 1oi7A 199 :ETEAVVLIG T0333 286 :GGGTVMTAIDA 1oi7A 210 :GGSDEEEAAAW T0333 297 :GIPQLLAPDP 1oi7A 226 :KKPVVGFIGG T0333 330 :DKVD 1oi7A 257 :TPES T0333 334 :ADLLRRL 1oi7A 262 :LRAFAEA T0333 361 :PTPAETVRRIVERI 1oi7A 274 :DTIDEIVELVKKAL Number of specific fragments extracted= 17 number of extra gaps= 1 total=2481 Number of alignments=125 # 1oi7A read from 1oi7A/merged-good-all-a2m # found chain 1oi7A in training set Warning: unaligning (T0333)P193 because of BadResidue code BAD_PEPTIDE in next template residue (1oi7A)G121 Warning: unaligning (T0333)Y194 because of BadResidue code BAD_PEPTIDE at template residue (1oi7A)G121 Warning: unaligning (T0333)S327 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1oi7A)V255 T0333 2 :LFVSSPGI 1oi7A 10 :VLVQGITG T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1oi7A 18 :REGQFHTKQMLTYGTKIVAGV T0333 34 :AEHAD 1oi7A 40 :PGKGG T0333 43 :AGLEVV 1oi7A 48 :LGVPVY T0333 52 :PDY 1oi7A 54 :DTV T0333 101 :MALVDDYRPDLVVYEQGAT 1oi7A 57 :KEAVAHHEVDASIIFVPAP T0333 120 :VGLLAA 1oi7A 80 :AALEAA T0333 127 :RAGVPAVQRNQSAWRTRGMHRSIASFLT 1oi7A 86 :HAGIPLIVLITEGIPTLDMVRAVEEIKA T0333 187 :WFMRWV 1oi7A 114 :LGSRLI T0333 195 :GGGA 1oi7A 122 :NCPG T0333 199 :VLGDR 1oi7A 137 :MPGHV T0333 208 :PARPEVAITM 1oi7A 142 :FKRGRVGIIS T0333 225 :FGIGAVEPIIAAAGEVDADF 1oi7A 152 :RSGTLTYEAAAALSQAGLGT T0333 245 :VLALGDLDI 1oi7A 174 :TVGIGGDPV T0333 256 :L 1oi7A 183 :I T0333 268 :WTPLHTLL 1oi7A 184 :GTTFKDLL T0333 276 :RTCTAVVH 1oi7A 198 :PETEAVVL T0333 303 :AP 1oi7A 206 :IG T0333 305 :DPRDQFQHTAREAV 1oi7A 210 :GGSDEEEAAAWVKD T0333 323 :I 1oi7A 229 :V T0333 328 :TSDKVDADLLRRL 1oi7A 256 :GTPESKLRAFAEA T0333 360 :LPTPAETVRRIVERI 1oi7A 273 :ADTIDEIVELVKKAL Number of specific fragments extracted= 22 number of extra gaps= 1 total=2503 Number of alignments=126 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vgvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vgvA expands to /projects/compbio/data/pdb/1vgv.pdb.gz 1vgvA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 92, because occupancy 0.500 <= existing 0.500 in 1vgvA Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 1vgvA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 1vgvA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 1vgvA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 1vgvA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0333 read from 1vgvA/merged-good-all-a2m # 1vgvA read from 1vgvA/merged-good-all-a2m # adding 1vgvA to template set # found chain 1vgvA in template set T0333 1 :M 1vgvA 1 :M T0333 2 :LFVSSPGIGHLFPLIQLAWGFRTAG 1vgvA 3 :VLTVFGTRPEAIKMAPLVHALAKDP T0333 27 :HDVLIAV 1vgvA 29 :FEAKVCV T0333 34 :AEHADRAAAA 1vgvA 37 :AQHREMLDQV T0333 44 :GL 1vgvA 51 :SI T0333 55 :SAVKVFEQ 1vgvA 53 :VPDYDLNI T0333 76 :TRPAIDLEEWGVQIAAVNRP 1vgvA 61 :MQPGQGLTEITCRILEGLKP T0333 103 :LVDDYRPDLVVYEQGA 1vgvA 81 :ILAEFKPDVVLVHGDT T0333 119 :TVGLLAADRAGVPAVQRNQSAW 1vgvA 100 :LATSLAAFYQRIPVGHVEAGLR T0333 141 :RTRGMHRSIASFLTDLMD 1vgvA 123 :GDLYSPWPEEANRTLTGH T0333 166 :EPVATIESFPPSLLLEAEPE 1vgvA 141 :LAMYHFSPTETSRQNLLREN T0333 187 :WFMRWVPYGGGAV 1vgvA 161 :VADSRIFITGNTV T0333 200 :LGDRLPP 1vgvA 197 :NYPFIDP T0333 209 :ARPEVAITMGTIELQA 1vgvA 204 :DKKMILVTGHRRESFG T0333 225 :FGIGAVEPIIAAAGEVD 1vgvA 221 :GFEEICHALADIATTHQ T0333 242 :ADFVLALG 1vgvA 239 :IQIVYPVH T0333 251 :L 1vgvA 248 :N T0333 254 :SPLGT 1vgvA 249 :PNVRE T0333 259 :LPRNVRAVGWT 1vgvA 261 :HVKNVILIDPQ T0333 270 :PLHTLLRTCTAVVHHGG 1vgvA 275 :PFVWLMNHAWLILTDSG T0333 288 :GTVMTAIDAGIPQLLAPDPRDQFQ 1vgvA 292 :GIQEEAPSLGKPVLVMRDTTERPE T0333 318 :VSRRGIG 1vgvA 316 :AVTAGTV T0333 325 :LV 1vgvA 324 :LV T0333 327 :STSDKV 1vgvA 327 :TDKQRI T0333 334 :ADLLRRLIGDESLRTAAR 1vgvA 333 :VEEVTRLLKDENEYQAMS T0333 358 :VALP 1vgvA 357 :GDGQ T0333 363 :PAETVRRIVERI 1vgvA 361 :ACSRILEALKNN Number of specific fragments extracted= 27 number of extra gaps= 0 total=2530 Number of alignments=127 # 1vgvA read from 1vgvA/merged-good-all-a2m # found chain 1vgvA in template set T0333 1 :M 1vgvA 1 :M T0333 2 :LFVSSPGIGHLFPLIQLAWGFRTAG 1vgvA 3 :VLTVFGTRPEAIKMAPLVHALAKDP T0333 27 :HDVLIAVAE 1vgvA 29 :FEAKVCVTA T0333 52 :PDYSAVKVFEQV 1vgvA 38 :QHREMLDQVLKL T0333 65 :KDNPRFAETVATRPAIDLEEWGVQIAA 1vgvA 50 :FSIVPDYDLNIMQPGQGLTEITCRILE T0333 99 :GTMALVDDYRPDLVVYE 1vgvA 77 :GLKPILAEFKPDVVLVH T0333 117 :GA 1vgvA 95 :DT T0333 119 :TVGLLAADRAGVPAVQRNQSA 1vgvA 100 :LATSLAAFYQRIPVGHVEAGL T0333 140 :WRTRGMHRSIASF 1vgvA 124 :DLYSPWPEEANRT T0333 153 :LTDLMDKHQVSLPEPVATIE 1vgvA 138 :TGHLAMYHFSPTETSRQNLL T0333 173 :SFPPS 1vgvA 160 :NVADS T0333 191 :WVPYGGGAV 1vgvA 165 :RIFITGNTV T0333 200 :LGDRLPPVPARPEVAITMG 1vgvA 194 :LAANYPFIDPDKKMILVTG T0333 219 :TIELQAFGIGAVEPIIAAAGEV 1vgvA 214 :RRESFGRGFEEICHALADIATT T0333 241 :DADFVLALG 1vgvA 238 :DIQIVYPVH T0333 250 :DLDI 1vgvA 248 :NPNV T0333 254 :SPLGTL 1vgvA 257 :RILGHV T0333 261 :RNVRAVGWTP 1vgvA 263 :KNVILIDPQE T0333 271 :LHTLLRTCTAVVHHGGGG 1vgvA 276 :FVWLMNHAWLILTDSGGI T0333 290 :VMTAIDAGIPQLLAPDPRDQF 1vgvA 294 :QEEAPSLGKPVLVMRDTTERP T0333 313 :T 1vgvA 315 :E T0333 318 :VSRRGIGLVSTSDKVD 1vgvA 316 :AVTAGTVRLVGTDKQR T0333 334 :ADLLRRLIGDESLRTAAR 1vgvA 333 :VEEVTRLLKDENEYQAMS T0333 365 :ETVRRIVERIS 1vgvA 360 :QACSRILEALK Number of specific fragments extracted= 24 number of extra gaps= 0 total=2554 Number of alignments=128 # 1vgvA read from 1vgvA/merged-good-all-a2m # found chain 1vgvA in template set T0333 2 :LFVSSPGIGHLFPLIQLAWGFRTAG 1vgvA 3 :VLTVFGTRPEAIKMAPLVHALAKDP T0333 27 :HDVLIAV 1vgvA 31 :AKVCVTA T0333 34 :AEHADRAAA 1vgvA 40 :REMLDQVLK T0333 43 :AGLEVVDVAPDYSAVK 1vgvA 50 :FSIVPDYDLNIMQPGQ T0333 78 :PA 1vgvA 66 :GL T0333 83 :EEWGV 1vgvA 68 :TEITC T0333 95 :PLVDGTMALVDDYRPDLVVYEQGATVGL 1vgvA 73 :RILEGLKPILAEFKPDVVLVHGDTTTTL T0333 123 :LAADRAGVPAVQRNQSAWRTRGMHRSIASFLT 1vgvA 104 :LAAFYQRIPVGHVEAGLRTGDLYSPWPEEANR T0333 184 :PEGWFMRWVPYGGGA 1vgvA 161 :VADSRIFITGNTVID T0333 199 :VLGDRL 1vgvA 193 :ELAANY T0333 205 :PPVPARPEVAITMGTIELQ 1vgvA 200 :FIDPDKKMILVTGHRRESF T0333 226 :G 1vgvA 219 :G T0333 228 :GAVEPIIAAAGEV 1vgvA 220 :RGFEEICHALADI T0333 241 :DADFVLALGD 1vgvA 238 :DIQIVYPVHL T0333 251 :LDISPLGTLPRNVRAVGWTPLHTLL 1vgvA 253 :EPVNRILGHVKNVILIDPQEYLPFV T0333 276 :RTCTAVVHHGG 1vgvA 281 :NHAWLILTDSG T0333 293 :AIDAGIPQLLAPDPRDQF 1vgvA 297 :APSLGKPVLVMRDTTERP T0333 315 :REAVSRRGIGLV 1vgvA 315 :EAVTAGTVRLVG T0333 329 :SDKVDADLLRRLIGDESL 1vgvA 328 :DKQRIVEEVTRLLKDENE T0333 354 :REEMVALPTPA 1vgvA 346 :YQAMSRAHNPY T0333 365 :ETVRRIVERIS 1vgvA 360 :QACSRILEALK Number of specific fragments extracted= 21 number of extra gaps= 0 total=2575 Number of alignments=129 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1keeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1keeA expands to /projects/compbio/data/pdb/1kee.pdb.gz 1keeA:Skipped atom 218, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 220, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 442, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 444, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 446, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 448, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 450, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 625, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 627, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 629, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 631, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 633, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 4284, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 4286, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 4288, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 4290, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 7611, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 7613, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 7615, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 7617, because occupancy 0.500 <= existing 0.500 in 1keeA Skipped atom 7619, because occupancy 0.500 <= existing 0.500 in 1keeA # T0333 read from 1keeA/merged-good-all-a2m # 1keeA read from 1keeA/merged-good-all-a2m # adding 1keeA to template set # found chain 1keeA in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeA)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeA)D558 T0333 2 :LFVSSPGI 1keeA 10 :ILILGAGP T0333 10 :GHL 1keeA 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1keeA 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHA 1keeA 51 :PATI T0333 39 :RAAAAGLEVVDVAP 1keeA 55 :MTDPEMADATYIEP T0333 94 :RPL 1keeA 71 :WEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1keeA 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeA 112 :GVT T0333 136 :NQSAW 1keeA 115 :MIGAT T0333 141 :RTRGMHRSIASFLTDL 1keeA 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATIESFPPSLL 1keeA 521 :DLHPVYKRVDTCAAE T0333 184 :PEGWFMRWVPYGGGAV 1keeA 536 :FATDTAYMYSTYEEEC T0333 204 :LPPV 1keeA 553 :ANPS T0333 210 :RPEVAITMGT 1keeA 559 :REKIMVLGGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLAL 1keeA 572 :IGQGIEFDYCCVHASLALREDGYETIMVN T0333 277 :T 1keeA 611 :D T0333 278 :CTAVVHHG 1keeA 613 :SDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1keeA 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1keeA 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1keeA 647 :PLKLARA T0333 318 :VSRRGIG 1keeA 654 :LEAAGVP T0333 325 :LVST 1keeA 662 :IGTS T0333 334 :ADLLRRLIG 1keeA 666 :PDAIDRAED T0333 347 :RTAAREVREE 1keeA 675 :RERFQHAVER T0333 363 :PAETVRRIVERI 1keeA 697 :AIEMAVEKAKEI Number of specific fragments extracted= 25 number of extra gaps= 1 total=2600 Number of alignments=130 # 1keeA read from 1keeA/merged-good-all-a2m # found chain 1keeA in template set T0333 1 :M 1keeA 1 :M T0333 2 :LFVSSPGI 1keeA 12 :ILGAGPIV T0333 10 :GHL 1keeA 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAAAAG 1keeA 28 :YSGAQACKALREEGYRVILVNSNPATIMTDPE T0333 45 :LEVVDVAPDYSA 1keeA 61 :ADATYIEPIHWE T0333 99 :GTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeA 73 :VVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeA 112 :GVT T0333 135 :RNQSA 1keeA 115 :MIGAT T0333 140 :WRTRGMHRSIASFLT 1keeA 800 :TLSQEIQDVMRQQVQ Number of specific fragments extracted= 9 number of extra gaps= 0 total=2609 Number of alignments=131 # 1keeA read from 1keeA/merged-good-all-a2m # found chain 1keeA in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeA)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeA)D558 T0333 1 :MLFVSSPGI 1keeA 10 :ILILGAGPI T0333 10 :GH 1keeA 21 :GQ T0333 12 :LFPLIQLAWGFRTAGHDVLIAV 1keeA 27 :DYSGAQACKALREEGYRVILVN T0333 34 :AEH 1keeA 51 :PAT T0333 39 :RAAAAG 1keeA 54 :IMTDPE T0333 45 :LEVVDVAPDY 1keeA 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeA 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1keeA 112 :GV T0333 137 :QSAWRTRGMHRSIASFLT 1keeA 114 :TMIGATADAIDKAEDRRR T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1keeA 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 203 :RLPPV 1keeA 552 :EANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPII 1keeA 559 :REKIMVLGGGPNRIGQGIEFDYCCV T0333 235 :AAAGEVDADFVLALGD 1keeA 587 :LALREDGYETIMVNCN T0333 279 :TAVVHHGGGGTVMTAIDAGIP 1keeA 615 :RLYFEPVTLEDVLEIVRIEKP T0333 300 :QLLAP 1keeA 637 :GVIVQ T0333 305 :DPRDQFQHTAREAVSRRGIGL 1keeA 643 :GGQTPLKLARALEAAGVPVIG T0333 329 :SD 1keeA 665 :SP T0333 335 :DLLRRLIGDESLRTAAREV 1keeA 667 :DAIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1keeA 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 19 number of extra gaps= 1 total=2628 Number of alignments=132 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1keeC/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1keeC expands to /projects/compbio/data/pdb/1kee.pdb.gz 1keeC:Skipped atom 11370, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 11372, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 11374, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 11376, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 11378, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 11380, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 11382, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 18754, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 18756, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 18758, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 18760, because occupancy 0.500 <= existing 0.500 in 1keeC Skipped atom 18762, because occupancy 0.500 <= existing 0.500 in 1keeC # T0333 read from 1keeC/merged-good-all-a2m # 1keeC read from 1keeC/merged-good-all-a2m # adding 1keeC to template set # found chain 1keeC in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeC)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeC)D558 T0333 2 :LFVSSPGI 1keeC 10 :ILILGAGP T0333 10 :GHL 1keeC 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1keeC 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHADRAAAA 1keeC 51 :PATIMTDPEM T0333 45 :LEVVDVAP 1keeC 61 :ADATYIEP T0333 93 :NRPL 1keeC 70 :HWEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1keeC 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeC 112 :GVT T0333 135 :RNQSA 1keeC 115 :MIGAT T0333 141 :RTRGMHRSIASFLTDL 1keeC 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATIESFPPSLL 1keeC 521 :DLHPVYKRVDTCAAE T0333 199 :V 1keeC 536 :F T0333 200 :LGDR 1keeC 547 :YEEE T0333 204 :LPPV 1keeC 553 :ANPS T0333 210 :RPEVAITMGT 1keeC 559 :REKIMVLGGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLALGDLD 1keeC 572 :IGQGIEFDYCCVHASLALREDGYETIMVNCNPE T0333 275 :LRTCTAVVHHG 1keeC 610 :YDTSDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1keeC 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1keeC 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1keeC 647 :PLKLARA T0333 318 :VSRRGIG 1keeC 654 :LEAAGVP T0333 325 :LVST 1keeC 662 :IGTS T0333 334 :ADLLRRLIG 1keeC 666 :PDAIDRAED T0333 347 :RTAAREVREE 1keeC 675 :RERFQHAVER T0333 363 :PAETVRRIVERI 1keeC 697 :AIEMAVEKAKEI Number of specific fragments extracted= 25 number of extra gaps= 1 total=2653 Number of alignments=133 # 1keeC read from 1keeC/merged-good-all-a2m # found chain 1keeC in template set T0333 2 :LF 1keeC 12 :IL T0333 6 :SPGI 1keeC 16 :GPIV T0333 10 :GHL 1keeC 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAAAAG 1keeC 28 :YSGAQACKALREEGYRVILVNSNPATIMTDPE T0333 45 :LEVVDVAPDYS 1keeC 61 :ADATYIEPIHW T0333 98 :DGTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeC 72 :EVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeC 112 :GVT T0333 135 :RNQSA 1keeC 115 :MIGAT T0333 140 :WRTRGMHRSIASFLTDLM 1keeC 800 :TLSQEIQDVMRQQVQKLA T0333 168 :VATI 1keeC 874 :LAEQ T0333 173 :SFPPSLLL 1keeC 878 :GVTKEVIP T0333 186 :GWFMRWVPYGGGAVLGDRLPPVP 1keeC 886 :PYYSVKEVVLPFNKFPGVDPLLG T0333 209 :ARPEVAITM 1keeC 941 :KHGRALLSV T0333 223 :QAFGIGAVEPIIAAAGEVDADFVL 1keeC 950 :REGDKERVVDLAAKLLKQGFELDA T0333 250 :D 1keeC 985 :G T0333 261 :RNVRAVGWT 1keeC 986 :INPRLVNKV T0333 271 :LHTLLR 1keeC 1001 :IQDRIK T0333 277 :TCTAVVHHG 1keeC 1009 :EYTYIINTT T0333 286 :GGGT 1keeC 1019 :GRRA T0333 308 :DQF 1keeC 1025 :DSR T0333 313 :TAREAVSRRGIGLV 1keeC 1028 :VIRRSALQYKVHYD Number of specific fragments extracted= 21 number of extra gaps= 0 total=2674 Number of alignments=134 # 1keeC read from 1keeC/merged-good-all-a2m # found chain 1keeC in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeC)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeC)D558 T0333 1 :MLFVSSPGI 1keeC 10 :ILILGAGPI T0333 10 :GH 1keeC 21 :GQ T0333 12 :LFPLIQLAWGFRTAGHDVLIAV 1keeC 27 :DYSGAQACKALREEGYRVILVN T0333 34 :AEHA 1keeC 51 :PATI T0333 40 :A 1keeC 55 :M T0333 45 :LEVVDVAPDY 1keeC 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeC 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1keeC 112 :GV T0333 137 :QSAWRTRGMHRSIAS 1keeC 114 :TMIGATADAIDKAED T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1keeC 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 203 :RLPPV 1keeC 552 :EANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPIIA 1keeC 559 :REKIMVLGGGPNRIGQGIEFDYCCVH T0333 236 :AAGEVDADFVLALGD 1keeC 588 :ALREDGYETIMVNCN T0333 251 :LDISPL 1keeC 608 :TDYDTS T0333 264 :RAVGWTPLHTLL 1keeC 616 :LYFEPVTLEDVL T0333 276 :RTCTAVVHHGGGGTV 1keeC 633 :EKPKGVIVQYGGQTP T0333 310 :FQHTAREAVSRRGIGL 1keeC 648 :LKLARALEAAGVPVIG T0333 329 :SDK 1keeC 665 :SPD T0333 336 :LLRRLIGDESLRTAAREV 1keeC 668 :AIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1keeC 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 20 number of extra gaps= 1 total=2694 Number of alignments=135 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1keeE/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1keeE expands to /projects/compbio/data/pdb/1kee.pdb.gz 1keeE:Skipped atom 23343, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23345, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23347, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23349, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23351, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23705, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23707, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23709, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23711, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 23713, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 27244, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 27246, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 27248, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 27250, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 27252, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29428, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29430, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29432, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29434, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29436, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29527, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29529, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29531, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29533, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29535, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29760, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29762, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29764, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29766, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29768, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29770, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29772, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29820, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29822, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29824, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29826, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29828, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29830, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29832, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29867, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29869, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29871, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29873, because occupancy 0.500 <= existing 0.500 in 1keeE Skipped atom 29875, because occupancy 0.500 <= existing 0.500 in 1keeE # T0333 read from 1keeE/merged-good-all-a2m # 1keeE read from 1keeE/merged-good-all-a2m # adding 1keeE to template set # found chain 1keeE in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeE)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeE)D558 T0333 2 :LFVSSPGI 1keeE 10 :ILILGAGP T0333 10 :GHL 1keeE 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1keeE 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHADRAAAA 1keeE 51 :PATIMTDPEM T0333 45 :LEVVDVAP 1keeE 61 :ADATYIEP T0333 94 :RPL 1keeE 71 :WEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1keeE 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeE 112 :GVT T0333 135 :RNQSAW 1keeE 115 :MIGATA T0333 141 :RTRGMHRSIASFLTDL 1keeE 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATIESFPPSLL 1keeE 521 :DLHPVYKRVDTCAAE T0333 183 :EPE 1keeE 536 :FAT T0333 187 :WFMRWVPYGGGAV 1keeE 539 :DTAYMYSTYEEEC T0333 203 :RLPPV 1keeE 552 :EANPS T0333 210 :RPEVAITMG 1keeE 559 :REKIMVLGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLALGDLD 1keeE 572 :IGQGIEFDYCCVHASLALREDGYETIMVNCNPE T0333 275 :LRTCTAVVHHG 1keeE 610 :YDTSDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1keeE 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1keeE 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1keeE 647 :PLKLARA T0333 318 :VSRRGIG 1keeE 654 :LEAAGVP T0333 325 :LVST 1keeE 662 :IGTS T0333 334 :ADLLRRLIG 1keeE 666 :PDAIDRAED T0333 347 :RTAAREVREE 1keeE 675 :RERFQHAVER T0333 362 :TPAETVRRIVERI 1keeE 696 :TAIEMAVEKAKEI Number of specific fragments extracted= 25 number of extra gaps= 1 total=2719 Number of alignments=136 # 1keeE read from 1keeE/merged-good-all-a2m # found chain 1keeE in template set T0333 1 :M 1keeE 1 :M T0333 2 :LFVSSPGI 1keeE 12 :ILGAGPIV T0333 10 :GHL 1keeE 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAAAAG 1keeE 28 :YSGAQACKALREEGYRVILVNSNPATIMTDPE T0333 45 :LEVVDVAPDYSA 1keeE 61 :ADATYIEPIHWE T0333 99 :GTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeE 73 :VVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeE 112 :GVT T0333 135 :RNQSA 1keeE 115 :MIGAT T0333 362 :TPAETVRRIVER 1keeE 697 :AIEMAVEKAKEI Number of specific fragments extracted= 9 number of extra gaps= 0 total=2728 Number of alignments=137 # 1keeE read from 1keeE/merged-good-all-a2m # found chain 1keeE in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeE)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeE)D558 T0333 1 :MLFVSSPGI 1keeE 10 :ILILGAGPI T0333 10 :GHL 1keeE 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1keeE 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHA 1keeE 51 :PATI T0333 45 :LEVVDVAPDY 1keeE 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeE 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1keeE 112 :GV T0333 137 :QSAWRTRGMHRSIASFLT 1keeE 114 :TMIGATADAIDKAEDRRR T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1keeE 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 203 :RLPPV 1keeE 552 :EANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPIIA 1keeE 559 :REKIMVLGGGPNRIGQGIEFDYCCVH T0333 236 :AAGEVDADFVLALGD 1keeE 588 :ALREDGYETIMVNCN T0333 251 :LDISPLGTLPR 1keeE 604 :ETVSTDYDTSD T0333 279 :TAVVHHGGGGTVMTAIDAGIP 1keeE 615 :RLYFEPVTLEDVLEIVRIEKP T0333 300 :QLLAP 1keeE 637 :GVIVQ T0333 305 :DPRDQFQHTAREAVSRRGIGL 1keeE 643 :GGQTPLKLARALEAAGVPVIG T0333 329 :SDK 1keeE 665 :SPD T0333 336 :LLRRLIGDESLRTAAREV 1keeE 668 :AIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1keeE 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 19 number of extra gaps= 1 total=2747 Number of alignments=138 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1keeG/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1keeG expands to /projects/compbio/data/pdb/1kee.pdb.gz 1keeG:# T0333 read from 1keeG/merged-good-all-a2m # 1keeG read from 1keeG/merged-good-all-a2m # adding 1keeG to template set # found chain 1keeG in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeG)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeG)D558 T0333 2 :LFVSSPGI 1keeG 10 :ILILGAGP T0333 10 :GHL 1keeG 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1keeG 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHADRAAAA 1keeG 51 :PATIMTDPEM T0333 45 :LEVVDVAP 1keeG 61 :ADATYIEP T0333 94 :RPL 1keeG 71 :WEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1keeG 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeG 112 :GVT T0333 136 :NQSAW 1keeG 115 :MIGAT T0333 141 :RTRGMHRSIASFLTDL 1keeG 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATIESFPPSLL 1keeG 521 :DLHPVYKRVDTCAAE T0333 184 :PEGWFMRWVPYGGGAV 1keeG 536 :FATDTAYMYSTYEEEC T0333 203 :RLPPV 1keeG 552 :EANPS T0333 210 :RPEVAITMGT 1keeG 559 :REKIMVLGGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLALGDLD 1keeG 572 :IGQGIEFDYCCVHASLALREDGYETIMVNCNPE T0333 275 :LRTCTAVVHHG 1keeG 610 :YDTSDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1keeG 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1keeG 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1keeG 647 :PLKLARA T0333 318 :VSRRGIG 1keeG 654 :LEAAGVP T0333 325 :LVST 1keeG 662 :IGTS T0333 334 :ADLLRRLIG 1keeG 666 :PDAIDRAED T0333 347 :RTAAREVREE 1keeG 675 :RERFQHAVER T0333 363 :PAETVRRIVERI 1keeG 697 :AIEMAVEKAKEI Number of specific fragments extracted= 24 number of extra gaps= 1 total=2771 Number of alignments=139 # 1keeG read from 1keeG/merged-good-all-a2m # found chain 1keeG in template set Warning: unaligning (T0333)L271 because of BadResidue code BAD_PEPTIDE in next template residue (1keeG)Q1002 Warning: unaligning (T0333)H272 because of BadResidue code BAD_PEPTIDE at template residue (1keeG)Q1002 T0333 2 :LFVSSPGI 1keeG 12 :ILGAGPIV T0333 10 :GHL 1keeG 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAAAAG 1keeG 28 :YSGAQACKALREEGYRVILVNSNPATIMTDPE T0333 45 :LEVVDVAPDYSA 1keeG 61 :ADATYIEPIHWE T0333 99 :GTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeG 73 :VVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1keeG 112 :GVT T0333 135 :RNQSA 1keeG 115 :MIGAT T0333 140 :WRTRGMHRSIASFLTDLM 1keeG 800 :TLSQEIQDVMRQQVQKLA T0333 172 :E 1keeG 875 :A T0333 173 :SFPPSLLL 1keeG 878 :GVTKEVIP T0333 186 :GWFMRWVPYGGGAVLGDRLPPVP 1keeG 886 :PYYSVKEVVLPFNKFPGVDPLLG T0333 209 :ARPEVAITM 1keeG 941 :KHGRALLSV T0333 223 :QAFGIGAVEPIIAAAGEVDADFVL 1keeG 950 :REGDKERVVDLAAKLLKQGFELDA T0333 261 :RNVRAVGWT 1keeG 986 :INPRLVNKV T0333 270 :P 1keeG 997 :G T0333 273 :TLLR 1keeG 1003 :DRIK T0333 277 :TCTAVVHHG 1keeG 1009 :EYTYIINTT T0333 286 :GGGT 1keeG 1019 :GRRA T0333 308 :DQF 1keeG 1025 :DSR T0333 313 :TAREAVSRRGIGLV 1keeG 1028 :VIRRSALQYKVHYD Number of specific fragments extracted= 20 number of extra gaps= 1 total=2791 Number of alignments=140 # 1keeG read from 1keeG/merged-good-all-a2m # found chain 1keeG in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1keeG)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1keeG)D558 T0333 1 :MLFVSSPGI 1keeG 10 :ILILGAGPI T0333 10 :GHL 1keeG 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1keeG 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHADRAAA 1keeG 51 :PATIMTDPE T0333 45 :LEVVDVAPDY 1keeG 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1keeG 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1keeG 112 :GV T0333 136 :NQ 1keeG 114 :TM T0333 139 :AWRTRGMHRSIASFLT 1keeG 116 :IGATADAIDKAEDRRR T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1keeG 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 203 :RLPPV 1keeG 552 :EANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPII 1keeG 559 :REKIMVLGGGPNRIGQGIEFDYCCV T0333 235 :AAAGEVDADFVLALGD 1keeG 587 :LALREDGYETIMVNCN T0333 251 :LDIS 1keeG 608 :TDYD T0333 277 :TC 1keeG 612 :TS T0333 279 :TAVVHHGGGGTVMTAIDAGIP 1keeG 615 :RLYFEPVTLEDVLEIVRIEKP T0333 300 :QLLAP 1keeG 637 :GVIVQ T0333 305 :DPRDQFQHTAREAVSRRGIGL 1keeG 643 :GGQTPLKLARALEAAGVPVIG T0333 329 :SD 1keeG 665 :SP T0333 335 :DLLRRLIGDESLRTAAREV 1keeG 667 :DAIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1keeG 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 21 number of extra gaps= 1 total=2812 Number of alignments=141 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihuA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ihuA expands to /projects/compbio/data/pdb/1ihu.pdb.gz 1ihuA:# T0333 read from 1ihuA/merged-good-all-a2m # 1ihuA read from 1ihuA/merged-good-all-a2m # adding 1ihuA to template set # found chain 1ihuA in template set Warning: unaligning (T0333)E185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihuA)Q308 Warning: unaligning (T0333)G197 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihuA)Q308 Warning: unaligning (T0333)D252 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihuA)N378 Warning: unaligning (T0333)C278 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihuA)T480 T0333 2 :LFVSS 1ihuA 11 :LFFTG T0333 7 :PGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAAA 1ihuA 17 :GGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQV T0333 44 :GLEVVDVAP 1ihuA 59 :GNTIQAIAS T0333 53 :DYS 1ihuA 70 :GLS T0333 56 :AVKVFEQVAKDNP 1ihuA 150 :IRLLQLPGAWSSF T0333 141 :RTRGMHRSIASFLTDLMDKHQVSLPEPV 1ihuA 244 :ANDTLAAAIWEREQEALANLPADLAGLP T0333 169 :ATIESFPPSLL 1ihuA 273 :DTLFLQPVNMV T0333 180 :LEAEP 1ihuA 291 :LLSTQ T0333 198 :AV 1ihuA 309 :RP T0333 200 :LGD 1ihuA 322 :IAR T0333 209 :ARPEVAITMGTIELQ 1ihuA 325 :NEHGLIMLMGKGGVG T0333 226 :GIGAVEPIIAAAGEVDADFVLALGDL 1ihuA 340 :KTTMAAAIAVRLADMGFDVHLTTSDP T0333 253 :ISPLG 1ihuA 436 :IREAG T0333 261 :RNVRAVGWTP 1ihuA 441 :KRFVVMDTAP T0333 271 :LHTLLRT 1ihuA 454 :TLLLLDA T0333 297 :GIPQLLAPDP 1ihuA 490 :RTKVLLVTLP T0333 308 :DQFQHTAR 1ihuA 506 :EAANLQAD T0333 318 :VSRRGIG 1ihuA 514 :LERAGIH T0333 325 :LV 1ihuA 522 :WG T0333 327 :STSDKV 1ihuA 535 :TRSPLL T0333 338 :RRL 1ihuA 541 :RMR T0333 347 :RTAAREVREEMVA 1ihuA 544 :AQQELPQIESVKR T0333 360 :LPTPAETVRRIV 1ihuA 571 :EPTGIDKLKQLA Number of specific fragments extracted= 23 number of extra gaps= 0 total=2835 Number of alignments=142 # 1ihuA read from 1ihuA/merged-good-all-a2m # found chain 1ihuA in template set Warning: unaligning (T0333)D252 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihuA)N378 T0333 2 :LFVSSPGI 1ihuA 11 :LFFTGKGG T0333 10 :GHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAA 1ihuA 20 :GKTSISCATAIRLAEQGKRVLLVSTDPASNVGQ T0333 43 :AGLEVVDVAPDYSAVKVFEQVAKDNP 1ihuA 69 :PGLSALEIDPQAAAQQYRARIVDPIK T0333 78 :PAIDLEEWGVQ 1ihuA 95 :GVLPDDVVSSI T0333 89 :IAAVNRPLVD 1ihuA 120 :FDEFTGLLTD T0333 99 :GTMA 1ihuA 131 :SLLT T0333 106 :D 1ihuA 135 :R T0333 109 :PDLVVYEQGA 1ihuA 136 :FDHIIFDTAP T0333 119 :TVGLLAAD 1ihuA 147 :GHTIRLLQ T0333 136 :NQ 1ihuA 155 :LP T0333 140 :WRTRGMHRSIASFLTD 1ihuA 180 :EKQREQYAYAVEALSD T0333 156 :LMDKHQVSLPE 1ihuA 198 :RTRLVLVARLQ T0333 167 :PVATIE 1ihuA 211 :TLQEVA T0333 173 :SFP 1ihuA 226 :GLK T0333 191 :WVPYGGGAVLGDRLPPVP 1ihuA 229 :NQYLVINGVLPKTEAAND T0333 209 :ARPEVAITMGTIE 1ihuA 325 :NEHGLIMLMGKGG T0333 223 :QAF 1ihuA 338 :VGK T0333 228 :GAVEPIIAAAGEV 1ihuA 341 :TTMAAAIAVRLAD T0333 241 :DADFVLALGDL 1ihuA 355 :GFDVHLTTSDP T0333 254 :SPLGTLP 1ihuA 437 :REAGKRF T0333 271 :LHTLLR 1ihuA 481 :PMMLLQ T0333 277 :TCTAVVHHG 1ihuA 490 :RTKVLLVTL T0333 286 :GGGTVMTAIDAGI 1ihuA 507 :AANLQADLERAGI T0333 299 :PQLLAPDPR 1ihuA 523 :GWIINNSLS T0333 308 :DQFQHTAREAVSRRGI 1ihuA 544 :AQQELPQIESVKRQHA T0333 324 :GLVSTS 1ihuA 562 :VALVPV T0333 330 :DKVD 1ihuA 570 :SEPT T0333 334 :ADLLRRLI 1ihuA 575 :IDKLKQLA Number of specific fragments extracted= 28 number of extra gaps= 0 total=2863 Number of alignments=143 # 1ihuA read from 1ihuA/merged-good-all-a2m # found chain 1ihuA in template set Warning: unaligning (T0333)A150 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihuA)A170 Warning: unaligning (T0333)A169 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihuA)Q308 Warning: unaligning (T0333)E181 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihuA)Q308 Warning: unaligning (T0333)D252 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihuA)N378 Warning: unaligning (T0333)R261 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihuA)N378 T0333 1 :MLFVSSPGIGHLFPLIQLAWGFRTAGHDVLIAV 1ihuA 11 :LFFTGKGGVGKTSISCATAIRLAEQGKRVLLVS T0333 34 :A 1ihuA 46 :P T0333 37 :ADRAAA 1ihuA 47 :ASNVGQ T0333 43 :AGLEVVDVAPDYSAVKVFEQVAKDNPRFAETVATRPAIDLEEWGVQIAAVNRPLVDGTMA 1ihuA 69 :PGLSALEIDPQAAAQQYRARIVDPIKGVLPDDVVSSINEQLSGACTTEIAAFDEFTGLLT T0333 103 :LVD 1ihuA 132 :LLT T0333 108 :RPDLVVYEQGAT 1ihuA 135 :RFDHIIFDTAPT T0333 120 :VGLLAA 1ihuA 149 :TIRLLQ T0333 130 :V 1ihuA 155 :L T0333 143 :RGMHRSI 1ihuA 156 :PGAWSSF T0333 155 :DLMDKHQVSLPEPV 1ihuA 282 :MVGVSALSRLLSTQ T0333 182 :AEPEGW 1ihuA 309 :RPDIPS T0333 203 :RLPPVPARPEVAITMGTIELQ 1ihuA 319 :VDDIARNEHGLIMLMGKGGVG T0333 226 :GIGAVEPIIAAAGEVDADFVLALGDL 1ihuA 340 :KTTMAAAIAVRLADMGFDVHLTTSDP T0333 262 :NV 1ihuA 379 :NL Number of specific fragments extracted= 14 number of extra gaps= 0 total=2877 Number of alignments=144 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i24A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i24A expands to /projects/compbio/data/pdb/1i24.pdb.gz 1i24A:Skipped atom 200, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 269, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 271, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 273, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 275, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 277, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 302, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 304, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 306, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 308, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 310, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 312, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 376, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 378, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 380, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 382, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 384, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 386, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 388, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 390, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 392, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 394, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 396, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 398, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 400, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 402, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 404, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 406, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 408, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 410, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 412, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 414, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 416, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 487, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 519, because occupancy 0.200 <= existing 0.800 in 1i24A Skipped atom 521, because occupancy 0.200 <= existing 0.800 in 1i24A Skipped atom 563, because occupancy 0.300 <= existing 0.700 in 1i24A Skipped atom 687, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 699, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 701, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 703, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 705, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 707, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 709, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 711, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 727, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 747, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 749, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 916, because occupancy 0.200 <= existing 0.600 in 1i24A Skipped atom 917, because occupancy 0.200 <= existing 0.600 in 1i24A Skipped atom 1313, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 1317, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 1319, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 1321, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 1323, because occupancy 0.350 <= existing 0.650 in 1i24A Skipped atom 1392, because occupancy 0.450 <= existing 0.550 in 1i24A Skipped atom 1394, because occupancy 0.450 <= existing 0.550 in 1i24A Skipped atom 1396, because occupancy 0.450 <= existing 0.550 in 1i24A Skipped atom 1642, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 1644, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 1646, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 1648, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 1907, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 1909, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 1911, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 1913, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 1915, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 1917, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 2153, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2215, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2217, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2219, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2221, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2299, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2301, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2303, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2305, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2307, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2309, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2452, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 2721, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 2802, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2883, because occupancy 0.400 <= existing 0.600 in 1i24A Skipped atom 2968, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2970, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2972, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2974, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 2976, because occupancy 0.500 <= existing 0.500 in 1i24A Skipped atom 3143, because occupancy 0.400 <= existing 0.600 in 1i24A # T0333 read from 1i24A/merged-good-all-a2m # 1i24A read from 1i24A/merged-good-all-a2m # adding 1i24A to template set # found chain 1i24A in template set T0333 2 :LFVSS 1i24A 4 :VMVIG T0333 10 :GHLFPLIQLAWGFRTAGHDVLIAV 1i24A 9 :GDGYCGWATALHLSKKNYEVCIVD T0333 34 :AEHADRAAAAGLEV 1i24A 34 :LVRRLFDHQLGLES T0333 77 :RPAIDLEEWGVQIAAV 1i24A 49 :TPIASIHDRISRWKAL T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLA 1i24A 79 :FEFLAESFKSFEPDSVVHFGEQRSAPYS T0333 143 :RGMHRSIASF 1i24A 110 :RSRAVYTQHN T0333 153 :LTDLMDKHQVSLPEPVATIESFPPSLL 1i24A 124 :TLNVLFAIKEFGEECHLVKLGTMGEYG T0333 184 :PEGWFMRWVPYGGGAV 1i24A 153 :NIDIEEGYITITHNGR T0333 204 :LPPV 1i24A 174 :YPKQ T0333 218 :GTIELQAFGIGAVEPIIAAAGEVDADFV 1i24A 178 :ASSFYHLSKVHDSHNIAFTCKAWGIRAT T0333 246 :LAL 1i24A 212 :VYG T0333 250 :DLD 1i24A 216 :KTD T0333 253 :ISPLG 1i24A 223 :HEELR T0333 286 :GGGTVMTAIDAGIPQLLA 1i24A 239 :ALNRFCVQAAVGHPLTVY T0333 304 :PDPRDQFQHTAR 1i24A 266 :LDIRDTVQCVEI T0333 318 :VSR 1i24A 278 :AIA T0333 321 :RGIGLV 1i24A 285 :AGEFRV T0333 327 :STSDKV 1i24A 298 :FSVNEL T0333 347 :RTAAREVREE 1i24A 304 :ASLVTKAGSK T0333 357 :MVA 1i24A 342 :LME T0333 360 :LPT 1i24A 349 :PHY T0333 363 :PAETVRRIVERI 1i24A 353 :SDSLLDSLLNFA Number of specific fragments extracted= 22 number of extra gaps= 0 total=2899 Number of alignments=145 # 1i24A read from 1i24A/merged-good-all-a2m # found chain 1i24A in template set T0333 9 :IGHLFPLIQLAWGFRTAGHDVLIAVAEHADRA 1i24A 8 :GGDGYCGWATALHLSKKNYEVCIVDNLVRRLF T0333 41 :AAAGLEVVD 1i24A 41 :HQLGLESLT T0333 52 :PDYSAVKVFEQVAKDNPRFAETVATRPAIDL 1i24A 50 :PIASIHDRISRWKALTGKSIELYVGDICDFE T0333 99 :GTMALVDDYRPDLVVY 1i24A 81 :FLAESFKSFEPDSVVH T0333 115 :EQGA 1i24A 99 :EQRS T0333 119 :TVG 1i24A 104 :PYS T0333 123 :L 1i24A 107 :M T0333 141 :RTRGMHRSIASFLTDLM 1i24A 108 :IDRSRAVYTQHNNVIGT T0333 158 :DKHQVSLPEPVATIE 1i24A 139 :HLVKLGTMGEYGTPN T0333 173 :SFPPSLLLEAEPEGWFMRW 1i24A 155 :DIEEGYITITHNGRTDTLP T0333 205 :PPVP 1i24A 174 :YPKQ T0333 217 :MGTIE 1i24A 178 :ASSFY T0333 223 :QAFGIGAVEPIIAAAGEVDADFVLAL 1i24A 183 :HLSKVHDSHNIAFTCKAWGIRATDLN T0333 249 :G 1i24A 214 :G T0333 250 :DLDI 1i24A 216 :KTDE T0333 254 :SPLGTLP 1i24A 224 :EELRNRL T0333 286 :GGGTVMTAIDAGIPQLLAPDPR 1i24A 239 :ALNRFCVQAAVGHPLTVYGKGG T0333 308 :DQFQ 1i24A 270 :DTVQ T0333 313 :TAREAVSR 1i24A 274 :CVEIAIAN T0333 321 :RGIGLVSTS 1i24A 285 :AGEFRVFNQ T0333 347 :RTAAREVREEMVAL 1i24A 300 :VNELASLVTKAGSK T0333 361 :PTPAETVRRIVERI 1i24A 351 :YLSDSLLDSLLNFA Number of specific fragments extracted= 22 number of extra gaps= 0 total=2921 Number of alignments=146 # 1i24A read from 1i24A/merged-good-all-a2m # found chain 1i24A in template set T0333 1 :MLFV 1i24A 4 :VMVI T0333 9 :IGHLFPLIQLAWGFRTAGHDVLIAV 1i24A 8 :GGDGYCGWATALHLSKKNYEVCIVD T0333 34 :AEHADRAAAAGLEVV 1i24A 34 :LVRRLFDHQLGLESL T0333 51 :APDYSAVKVFEQVAKDNPRF 1i24A 49 :TPIASIHDRISRWKALTGKS T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLA 1i24A 79 :FEFLAESFKSFEPDSVVHFGEQRSAPYS T0333 140 :WRTRGMHRSIASFLT 1i24A 107 :MIDRSRAVYTQHNNV T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1i24A 126 :NVLFAIKEFGEECHLVKLGTMGEYGTPNIDIEEGYITITHNGRT T0333 218 :GTIELQAFGIGAVEPIIAAAGEVDADFVLALGD 1i24A 178 :ASSFYHLSKVHDSHNIAFTCKAWGIRATDLNQG T0333 251 :LDISPLGT 1i24A 217 :TDETEMHE T0333 259 :LP 1i24A 226 :LR T0333 267 :GWTPLHTLL 1i24A 228 :NRLDYDAVF T0333 286 :GGGTVMTAIDAGIPQLLAP 1i24A 239 :ALNRFCVQAAVGHPLTVYG T0333 305 :DPRDQFQHTAREAV 1i24A 267 :DIRDTVQCVEIAIA T0333 319 :SRRGIGLV 1i24A 285 :AGEFRVFN T0333 327 :STSDKVDADLLRRLIG 1i24A 297 :QFSVNELASLVTKAGS Number of specific fragments extracted= 15 number of extra gaps= 0 total=2936 Number of alignments=147 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ff9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ff9A expands to /projects/compbio/data/pdb/1ff9.pdb.gz 1ff9A:# T0333 read from 1ff9A/merged-good-all-a2m # 1ff9A read from 1ff9A/merged-good-all-a2m # adding 1ff9A to template set # found chain 1ff9A in template set Warning: unaligning (T0333)G117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ff9A)F80 T0333 2 :LFVSSPGI 1ff9A 6 :VLMLGSGF T0333 15 :LIQLAWGFRTAGHDVLIAV 1ff9A 15 :TRPTLDVLTDSGIKVTVAC T0333 35 :EHADRAAAA 1ff9A 34 :RTLESAKKL T0333 44 :GLEVVDVAPDYS 1ff9A 48 :HSTPISLDVNDD T0333 98 :DGTMALVDDY 1ff9A 60 :AALDAEVAKH T0333 110 :DLVVYE 1ff9A 70 :DLVISL T0333 118 :ATVGLLAADRAGVPAVQRNQSAW 1ff9A 81 :HATVIKSAIRQKKHVVTTSYVSP T0333 141 :RTRGMHRSIASFLTDLMDKHQVSL 1ff9A 168 :LGYKFSWSSRGVLLALRNAASFYK T0333 168 :VATIESFPPSLL 1ff9A 192 :DGKVTNVAGPEL T0333 180 :LEAEPEGWFMR 1ff9A 210 :YFIYPGFAFVA T0333 192 :VPYGGGAVLGDRLPPVPARPEVAITMGTIELQ 1ff9A 221 :YPNRDSTPYKERYQIPEADNIVRGTLRYQGFP T0333 232 :PIIAAAGEVD 1ff9A 253 :QFIKVLVDIG T0333 248 :LGDLDISPLGT 1ff9A 264 :LSDEEQPFLKE T0333 269 :TPLHTLLRT 1ff9A 276 :IPWKEATQK T0333 318 :V 1ff9A 285 :I T0333 321 :RGIG 1ff9A 286 :VKAS T0333 327 :ST 1ff9A 291 :AS T0333 334 :ADLLRRLI 1ff9A 293 :EQDIVSTI T0333 342 :GDESLRTAAREVREEMV 1ff9A 307 :ESTEEQKRIVAGLKWLG T0333 360 :LPTPAETVRRIVERI 1ff9A 333 :RGNALDTLCATLEEK Number of specific fragments extracted= 20 number of extra gaps= 0 total=2956 Number of alignments=148 # 1ff9A read from 1ff9A/merged-good-all-a2m # found chain 1ff9A in template set Warning: unaligning (T0333)G117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ff9A)F80 T0333 10 :GHLFPLIQLAWGFRTAGHDVLIAV 1ff9A 10 :GSGFVTRPTLDVLTDSGIKVTVAC T0333 35 :EHADRAAA 1ff9A 34 :RTLESAKK T0333 43 :AGLEVVDVAPDYSA 1ff9A 47 :QHSTPISLDVNDDA T0333 99 :GTMALVDD 1ff9A 61 :ALDAEVAK T0333 109 :PDLVVY 1ff9A 69 :HDLVIS T0333 118 :ATVGLLAADRAGV 1ff9A 81 :HATVIKSAIRQKK T0333 132 :AVQRNQSA 1ff9A 94 :HVVTTSYV T0333 140 :WRTRGMHRSIASFLTDL 1ff9A 128 :GIDHLYAIKTIEEVHAA T0333 185 :EGWFMRWVPYGGGAVLGDRLPPVP 1ff9A 145 :GGKIKTFLSYCGGLPAPESSDNPL T0333 209 :ARPEVAITM 1ff9A 238 :ADNIVRGTL T0333 223 :QAFGIGAVEPIIAAAGE 1ff9A 247 :RYQGFPQFIKVLVDIGF T0333 248 :LGDLDISPLGTLP 1ff9A 264 :LSDEEQPFLKEAI T0333 270 :PLHTL 1ff9A 277 :PWKEA T0333 314 :AREAV 1ff9A 282 :TQKIV T0333 322 :GI 1ff9A 287 :KA T0333 328 :TS 1ff9A 289 :SS T0333 330 :DKVD 1ff9A 292 :SEQD T0333 334 :ADLLRRLIG 1ff9A 297 :VSTIVSNAT T0333 343 :DESLRTAAREVREEMV 1ff9A 308 :STEEQKRIVAGLKWLG T0333 361 :PTPAETVRRIVERIS 1ff9A 423 :PMNSKINDPLMKELK T0333 376 :G 1ff9A 441 :G Number of specific fragments extracted= 21 number of extra gaps= 0 total=2977 Number of alignments=149 # 1ff9A read from 1ff9A/merged-good-all-a2m # found chain 1ff9A in template set Warning: unaligning (T0333)G117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ff9A)F80 T0333 1 :MLFVSSPG 1ff9A 6 :VLMLGSGF T0333 14 :PLIQLAWGFRTAGHDVLIAV 1ff9A 14 :VTRPTLDVLTDSGIKVTVAC T0333 36 :HADRAAAAG 1ff9A 35 :TLESAKKLS T0333 45 :LEVVDVAPDYS 1ff9A 49 :STPISLDVNDD T0333 98 :DGTMALVD 1ff9A 60 :AALDAEVA T0333 108 :RPDLVVYEQ 1ff9A 68 :KHDLVISLI T0333 120 :VGLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLT 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGI T0333 181 :EAEPEGWFMRWVPYGGGA 1ff9A 209 :PYFIYPGFAFVAYPNRDS T0333 199 :VLGDRLPPVPARPEVAITMGTIEL 1ff9A 228 :PYKERYQIPEADNIVRGTLRYQGF T0333 227 :IGAVEPIIA 1ff9A 252 :PQFIKVLVD T0333 240 :VD 1ff9A 261 :IG T0333 248 :LGDLDISPLGTLPR 1ff9A 264 :LSDEEQPFLKEAIP T0333 309 :QFQHTAREA 1ff9A 278 :WKEATQKIV T0333 327 :STSDKVDADLLRR 1ff9A 290 :SASEQDIVSTIVS T0333 342 :GDESLRTAAREVREEM 1ff9A 307 :ESTEEQKRIVAGLKWL Number of specific fragments extracted= 15 number of extra gaps= 0 total=2992 Number of alignments=150 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bisA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0333/2bisA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0333/2bisA/merged-good-all-a2m.gz for input Trying 2bisA/merged-good-all-a2m Error: Couldn't open file 2bisA/merged-good-all-a2m or 2bisA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f6dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f6dA expands to /projects/compbio/data/pdb/1f6d.pdb.gz 1f6dA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 92, because occupancy 0.500 <= existing 0.500 in 1f6dA Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 1f6dA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 1f6dA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 1f6dA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 1f6dA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0333 read from 1f6dA/merged-good-all-a2m # 1f6dA read from 1f6dA/merged-good-all-a2m # adding 1f6dA to template set # found chain 1f6dA in template set T0333 1 :M 1f6dA 1 :M T0333 2 :LFVSSPGIGHLFPLIQLAWGFRTAG 1f6dA 3 :VLTVFGTRPEAIKMAPLVHALAKDP T0333 27 :HDVLIAV 1f6dA 29 :FEAKVCV T0333 34 :AEHADRAAAA 1f6dA 37 :AQHREMLDQV T0333 66 :DNPRFAETVATRPAIDLEEWGVQIAAVNRPL 1f6dA 51 :SIVPDYDLNIMQPGQGLTEITCRILEGLKPI T0333 104 :VDDYRPDLVVYEQGA 1f6dA 82 :LAEFKPDVVLVHGDT T0333 119 :TVGLLAADRAGVPAVQRNQSAW 1f6dA 100 :LATSLAAFYQRIPVGHVEAGLR T0333 141 :RTRGMHRSIASFLTDLMD 1f6dA 123 :GDLYSPWPEEANRTLTGH T0333 166 :EPVATIESFPPSLLLEAEPE 1f6dA 141 :LAMYHFSPTETSRQNLLREN T0333 187 :WFMRWVPYGGGAV 1f6dA 161 :VADSRIFITGNTV T0333 200 :LGDRLPP 1f6dA 197 :NYPFIDP T0333 209 :ARPEVAITMGTIELQ 1f6dA 204 :DKKMILVTGHRRESF T0333 224 :AFGIGAVEPIIAAAGEVD 1f6dA 220 :RGFEEICHALADIATTHQ T0333 242 :ADFVLALG 1f6dA 239 :IQIVYPVH T0333 251 :L 1f6dA 248 :N T0333 254 :SPLGT 1f6dA 249 :PNVRE T0333 259 :LPRNVRAVGWT 1f6dA 261 :HVKNVILIDPQ T0333 270 :PLHTLLRTCTAVVHHGG 1f6dA 275 :PFVWLMNHAWLILTDSG T0333 288 :GTVMTAIDAGIPQLLAPDPRDQFQ 1f6dA 292 :GIQEEAPSLGKPVLVMRDTTERPE T0333 318 :VSRRGIG 1f6dA 316 :AVTAGTV T0333 325 :LV 1f6dA 324 :LV T0333 327 :STSDKV 1f6dA 327 :TDKQRI T0333 334 :ADLLRRLIGDESLRTAARE 1f6dA 333 :VEEVTRLLKDENEYQAMSR T0333 357 :MVALP 1f6dA 356 :YGDGQ T0333 363 :PAETVRRIVER 1f6dA 361 :ACSRILEALKN Number of specific fragments extracted= 25 number of extra gaps= 0 total=3017 Number of alignments=151 # 1f6dA read from 1f6dA/merged-good-all-a2m # found chain 1f6dA in template set T0333 1 :M 1f6dA 1 :M T0333 2 :LFVSSPGIGHLFPLIQLAWGFRTAG 1f6dA 3 :VLTVFGTRPEAIKMAPLVHALAKDP T0333 27 :HDVLIAVAE 1f6dA 29 :FEAKVCVTA T0333 52 :PDYSAVKVFEQV 1f6dA 38 :QHREMLDQVLKL T0333 65 :KDNPRFAETVATRPAIDLEEWGVQIAA 1f6dA 50 :FSIVPDYDLNIMQPGQGLTEITCRILE T0333 99 :GTMALVDDYRPDLVVYEQGA 1f6dA 77 :GLKPILAEFKPDVVLVHGDT T0333 119 :TVGLLAADRAGVPAVQRNQSA 1f6dA 100 :LATSLAAFYQRIPVGHVEAGL T0333 140 :WRTRGMHRSIASF 1f6dA 124 :DLYSPWPEEANRT T0333 153 :LTDLMDKHQVSLPEPVATIE 1f6dA 138 :TGHLAMYHFSPTETSRQNLL T0333 173 :SFPPS 1f6dA 160 :NVADS T0333 191 :WVPYGGGAV 1f6dA 165 :RIFITGNTV T0333 200 :LGDRLPPVPARPEVAITMG 1f6dA 194 :LAANYPFIDPDKKMILVTG T0333 219 :TIELQAFGIGAVEPIIAAAGEV 1f6dA 214 :RRESFGRGFEEICHALADIATT T0333 241 :DADFVLALG 1f6dA 238 :DIQIVYPVH T0333 250 :DLDI 1f6dA 248 :NPNV T0333 254 :SPLGTL 1f6dA 257 :RILGHV T0333 261 :RNVRAVGWTP 1f6dA 263 :KNVILIDPQE T0333 271 :LHTLLRTCTAVVHHGGGG 1f6dA 276 :FVWLMNHAWLILTDSGGI T0333 290 :VMTAIDAGIPQLLAPDPRDQF 1f6dA 294 :QEEAPSLGKPVLVMRDTTERP T0333 313 :TAR 1f6dA 315 :EAV T0333 320 :RRGIGLVSTSDKVD 1f6dA 318 :TAGTVRLVGTDKQR T0333 334 :ADLLRRLIGDESLRTAARE 1f6dA 333 :VEEVTRLLKDENEYQAMSR T0333 360 :LPTP 1f6dA 352 :AHNP T0333 366 :TVRRIVERISG 1f6dA 361 :ACSRILEALKN Number of specific fragments extracted= 24 number of extra gaps= 0 total=3041 Number of alignments=152 # 1f6dA read from 1f6dA/merged-good-all-a2m # found chain 1f6dA in template set T0333 2 :LFVSSPGIGHLFPLIQLAWGFRTAG 1f6dA 3 :VLTVFGTRPEAIKMAPLVHALAKDP T0333 27 :HDVLIAV 1f6dA 31 :AKVCVTA T0333 34 :AEHADRAAA 1f6dA 40 :REMLDQVLK T0333 43 :AGLEVVDVAPDYS 1f6dA 50 :FSIVPDYDLNIMQ T0333 66 :DNPRF 1f6dA 63 :PGQGL T0333 83 :E 1f6dA 68 :T T0333 91 :AVNRPLVDGTMALVDDYRPDLVVYEQGATVGL 1f6dA 69 :EITCRILEGLKPILAEFKPDVVLVHGDTTTTL T0333 123 :LAADRAGVPAVQRNQSAWRTRGMHRSIASFLT 1f6dA 104 :LAAFYQRIPVGHVEAGLRTGDLYSPWPEEANR T0333 185 :EGWFMRWVPYGGGA 1f6dA 162 :ADSRIFITGNTVID T0333 200 :LGDRL 1f6dA 194 :LAANY T0333 205 :PPVPARPEVAITMGTIELQ 1f6dA 200 :FIDPDKKMILVTGHRRESF T0333 226 :G 1f6dA 219 :G T0333 228 :GAVEPIIAAAGEV 1f6dA 220 :RGFEEICHALADI T0333 241 :DADFVLALGD 1f6dA 238 :DIQIVYPVHL T0333 251 :LDISPLGTLPRNVRAVGWTPLHTLL 1f6dA 253 :EPVNRILGHVKNVILIDPQEYLPFV T0333 276 :RTCTAVVHHGG 1f6dA 281 :NHAWLILTDSG T0333 293 :AIDAGIPQLLAPDPRDQF 1f6dA 297 :APSLGKPVLVMRDTTERP T0333 315 :REAVSRRGIGLV 1f6dA 315 :EAVTAGTVRLVG T0333 329 :SDKVDADLLRRLIGDESLR 1f6dA 328 :DKQRIVEEVTRLLKDENEY T0333 355 :EEMVALPTPA 1f6dA 347 :QAMSRAHNPY T0333 365 :ETVRRIVERIS 1f6dA 360 :QACSRILEALK Number of specific fragments extracted= 21 number of extra gaps= 0 total=3062 Number of alignments=153 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bfwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bfwA expands to /projects/compbio/data/pdb/2bfw.pdb.gz 2bfwA:Skipped atom 22, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 24, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 26, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 28, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 30, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 32, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 73, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 75, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 77, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 213, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 215, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 221, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 223, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 257, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 259, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 261, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 263, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 265, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 267, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 269, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 271, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 311, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 313, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 315, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 317, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 319, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 321, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 323, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 325, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 342, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 344, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 346, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 348, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 350, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 352, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 358, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 360, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 362, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 364, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 366, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 368, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 370, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 372, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 374, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 376, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 378, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 399, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 415, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 417, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 419, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 434, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 436, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 438, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 440, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 442, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 444, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 446, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 448, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 450, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 647, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 649, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 651, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 653, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 763, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 765, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 769, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 771, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 773, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 879, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 881, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 883, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 885, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 887, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 889, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 891, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 893, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 940, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 942, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 944, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 946, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 948, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 950, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 952, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1030, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1032, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1034, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1036, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1038, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1040, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1042, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1183, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1185, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1187, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1189, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1191, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1193, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1195, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1197, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1473, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1475, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1477, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1479, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1481, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1483, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1485, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1487, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1489, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1632, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1634, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1636, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1638, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1640, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1642, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1644, because occupancy 0.500 <= existing 0.500 in 2bfwA Skipped atom 1646, because occupancy 0.500 <= existing 0.500 in 2bfwA # T0333 read from 2bfwA/merged-good-all-a2m # 2bfwA read from 2bfwA/merged-good-all-a2m # adding 2bfwA to template set # found chain 2bfwA in template set Warning: unaligning (T0333)G196 because first residue in template chain is (2bfwA)G218 T0333 197 :GAV 2bfwA 219 :IDC T0333 200 :LGDRLPPV 2bfwA 225 :NESYLTGS T0333 209 :ARPEVAITMGTIELQAFGIGAVEPIIAAAGEVD 2bfwA 247 :DEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKK T0333 242 :ADFVLALGDLD 2bfwA 284 :MRFIIIGKGDP T0333 259 :LPRNVRAV 2bfwA 306 :KHGNVKVI T0333 267 :GWTP 2bfwA 315 :EMLS T0333 271 :LHTLLRTCTAVVHHG 2bfwA 322 :VRELYGSVDFVIIPS T0333 286 :G 2bfwA 342 :G T0333 288 :GTVMTAIDAGIPQLLAPDPR 2bfwA 343 :LVALEAMCLGAIPIASAVGG T0333 318 :VSR 2bfwA 363 :LRD T0333 321 :RGIG 2bfwA 369 :NETG T0333 325 :LV 2bfwA 374 :LV T0333 327 :STSDKV 2bfwA 378 :GDPGEL T0333 334 :ADLLRRLIG 2bfwA 384 :ANAILKALE T0333 343 :DES 2bfwA 394 :SRS T0333 346 :LRTAAREVREE 2bfwA 401 :FRENCKKRAMS Number of specific fragments extracted= 16 number of extra gaps= 0 total=3078 Number of alignments=154 # 2bfwA read from 2bfwA/merged-good-all-a2m # found chain 2bfwA in template set Warning: unaligning (T0333)A198 because first residue in template chain is (2bfwA)G218 T0333 199 :VLGDRLPPVP 2bfwA 219 :IDCSFWNESY T0333 209 :ARPEVAITMGTIELQAFGIGAVEPIIAAAGEV 2bfwA 247 :DEGVTFMFIGRFDRGQKGVDVLLKAIEILSSK T0333 241 :DADFVLALGDLDI 2bfwA 283 :EMRFIIIGKGDPE T0333 255 :PLGTLPRNVRAVGWT 2bfwA 302 :SLEEKHGNVKVITEM T0333 270 :P 2bfwA 318 :S T0333 271 :LHTLLRTCTAVVHHG 2bfwA 322 :VRELYGSVDFVIIPS T0333 286 :GGGTVMTAIDAGIPQLLAPDPR 2bfwA 341 :FGLVALEAMCLGAIPIASAVGG T0333 314 :AREAVSR 2bfwA 363 :LRDIITN T0333 322 :GIGLVSTS 2bfwA 370 :ETGILVKA T0333 330 :DKVD 2bfwA 379 :DPGE T0333 334 :ADLLRRLIG 2bfwA 384 :ANAILKALE T0333 343 :DESLRTAAREVREEMVA 2bfwA 394 :SRSDLSKFRENCKKRAM Number of specific fragments extracted= 12 number of extra gaps= 0 total=3090 Number of alignments=155 # 2bfwA read from 2bfwA/merged-good-all-a2m # found chain 2bfwA in template set Warning: unaligning (T0333)P361 because last residue in template chain is (2bfwA)S413 T0333 207 :VPARPEVAITMGTIELQAFGIGAVEPIIAAAGEVD 2bfwA 245 :GMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKK T0333 242 :ADFVLALGD 2bfwA 284 :MRFIIIGKG T0333 255 :PL 2bfwA 295 :EL T0333 257 :GTLPRNVRAVGWTP 2bfwA 304 :EEKHGNVKVITEML T0333 271 :LHTLLRTCTAVVHHG 2bfwA 322 :VRELYGSVDFVIIPS T0333 287 :GGTVMTAIDAGIPQLLAPD 2bfwA 342 :GLVALEAMCLGAIPIASAV T0333 311 :QHTARE 2bfwA 361 :GGLRDI T0333 319 :SRRGIGLVSTSDKVDADLLRRLIG 2bfwA 369 :NETGILVKAGDPGELANAILKALE T0333 343 :DESLRTAAREVREEMVAL 2bfwA 395 :RSDLSKFRENCKKRAMSF Number of specific fragments extracted= 9 number of extra gaps= 0 total=3099 Number of alignments=156 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cs0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cs0A expands to /projects/compbio/data/pdb/1cs0.pdb.gz 1cs0A:Skipped atom 218, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 220, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 442, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 444, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 446, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 448, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 450, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 4294, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 4296, because occupancy 0.500 <= existing 0.500 in 1cs0A Skipped atom 7661, because occupancy 0.500 <= existing 1.000 in 1cs0A Skipped atom 7663, because occupancy 0.500 <= existing 1.000 in 1cs0A Skipped atom 7665, because occupancy 0.500 <= existing 1.000 in 1cs0A Skipped atom 7667, because occupancy 0.500 <= existing 1.000 in 1cs0A Skipped atom 7669, because occupancy 0.500 <= existing 1.000 in 1cs0A # T0333 read from 1cs0A/merged-good-all-a2m # 1cs0A read from 1cs0A/merged-good-all-a2m # adding 1cs0A to template set # found chain 1cs0A in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1cs0A)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1cs0A)D558 T0333 2 :LFVSSPGI 1cs0A 10 :ILILGAGP T0333 10 :GHL 1cs0A 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1cs0A 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHADRAAAA 1cs0A 51 :PATIMTDPEM T0333 45 :LEVVDVAP 1cs0A 61 :ADATYIEP T0333 93 :NRPL 1cs0A 70 :HWEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1cs0A 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1cs0A 112 :GVT T0333 136 :NQSAW 1cs0A 115 :MIGAT T0333 141 :RTRGMHRSIASFLTDL 1cs0A 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATI 1cs0A 521 :DLHPVYK T0333 172 :ESFPPSLL 1cs0A 529 :VDTCAAEF T0333 185 :EGWFMRWVPYGG 1cs0A 537 :ATDTAYMYSTYE T0333 202 :DR 1cs0A 549 :EE T0333 204 :LPPV 1cs0A 553 :ANPS T0333 210 :RPEVAITMGT 1cs0A 559 :REKIMVLGGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLALGDLD 1cs0A 572 :IGQGIEFDYCCVHASLALREDGYETIMVNCNPE T0333 277 :T 1cs0A 611 :D T0333 278 :CTAVVHHG 1cs0A 613 :SDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1cs0A 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1cs0A 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1cs0A 647 :PLKLARA T0333 318 :VSRRGIGLV 1cs0A 654 :LEAAGVPVI T0333 327 :ST 1cs0A 664 :TS T0333 334 :ADLLRRLIG 1cs0A 666 :PDAIDRAED T0333 347 :RTAAREVREE 1cs0A 675 :RERFQHAVER T0333 363 :PAETVRRIVERIS 1cs0A 697 :AIEMAVEKAKEIG Number of specific fragments extracted= 27 number of extra gaps= 1 total=3126 Number of alignments=157 # 1cs0A read from 1cs0A/merged-good-all-a2m # found chain 1cs0A in template set Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1cs0A)D558 Warning: unaligning (T0333)R354 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cs0A)V750 Warning: unaligning (T0333)E355 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cs0A)V750 T0333 2 :LFVSSPGI 1cs0A 12 :ILGAGPIV T0333 10 :GHL 1cs0A 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAAAAG 1cs0A 28 :YSGAQACKALREEGYRVILVNSNPATIMTDPE T0333 45 :LEVVDVAPDYS 1cs0A 61 :ADATYIEPIHW T0333 98 :DGTMALVDDYRPDLVVYEQGATVGLLAADRA 1cs0A 72 :EVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1cs0A 112 :GVT T0333 135 :RNQSA 1cs0A 115 :MIGAT T0333 140 :WRTRGMHRSIASFLTDLM 1cs0A 479 :VGITGLNADFLRQLKRKG T0333 188 :FMRWVP 1cs0A 525 :VYKRVD T0333 198 :AVLGDR 1cs0A 531 :TCAAEF T0333 205 :PPVP 1cs0A 537 :ATDT T0333 210 :RPEVAITMGTIELQAFGIGA 1cs0A 559 :REKIMVLGGGPNRIGQGIEF T0333 230 :VEPIIAAAGEVDADFVLALGDLDI 1cs0A 582 :CVHASLALREDGYETIMVNCNPET T0333 261 :RNVRAVGWT 1cs0A 614 :DRLYFEPVT T0333 271 :LHTLLR 1cs0A 626 :VLEIVR T0333 277 :TCTAVVHHGGGGTVM 1cs0A 634 :KPKGVIVQYGGQTPL T0333 292 :TAIDAGIPQLLAPDPR 1cs0A 653 :ALEAAGVPVIGTSPDA T0333 308 :DQF 1cs0A 674 :DRE T0333 313 :TAREAVSRRG 1cs0A 677 :RFQHAVERLK T0333 323 :IGLVST 1cs0A 691 :ANATVT T0333 330 :DKVD 1cs0A 697 :AIEM T0333 334 :ADLLRRL 1cs0A 702 :VEKAKEI T0333 342 :GDESLRTAAREV 1cs0A 729 :YDEADLRRYFQT T0333 361 :P 1cs0A 799 :Y T0333 362 :TPAETVRRIVERIS 1cs0A 801 :LSQEIQDVMRQQVQ Number of specific fragments extracted= 25 number of extra gaps= 2 total=3151 Number of alignments=158 # 1cs0A read from 1cs0A/merged-good-all-a2m # found chain 1cs0A in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1cs0A)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1cs0A)D558 T0333 1 :MLFVSSPGI 1cs0A 10 :ILILGAGPI T0333 10 :GH 1cs0A 21 :GQ T0333 12 :LFPLIQLAWGFRTAGHDVLIAV 1cs0A 27 :DYSGAQACKALREEGYRVILVN T0333 34 :AEHA 1cs0A 51 :PATI T0333 40 :A 1cs0A 55 :M T0333 45 :LEVVDVAPDY 1cs0A 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1cs0A 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1cs0A 112 :GV T0333 137 :QSAWRTRGMHRSIASFL 1cs0A 114 :TMIGATADAIDKAEDRR T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1cs0A 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 203 :RLPPV 1cs0A 552 :EANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPIIA 1cs0A 559 :REKIMVLGGGPNRIGQGIEFDYCCVH T0333 236 :AAGEVDADFVLALGD 1cs0A 588 :ALREDGYETIMVNCN T0333 251 :LDISPLGTLPR 1cs0A 604 :ETVSTDYDTSD T0333 279 :TAVVHHGGGGTVMTAIDAGIP 1cs0A 615 :RLYFEPVTLEDVLEIVRIEKP T0333 300 :QLLAP 1cs0A 637 :GVIVQ T0333 305 :DPRDQFQHTAREAVSRRGIGL 1cs0A 643 :GGQTPLKLARALEAAGVPVIG T0333 329 :SD 1cs0A 665 :SP T0333 335 :DLLRRLIGDESLRTAAREV 1cs0A 667 :DAIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1cs0A 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 20 number of extra gaps= 1 total=3171 Number of alignments=159 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1uqtA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1uqtA expands to /projects/compbio/data/pdb/1uqt.pdb.gz 1uqtA:# T0333 read from 1uqtA/merged-good-all-a2m # 1uqtA read from 1uqtA/merged-good-all-a2m # adding 1uqtA to template set # found chain 1uqtA in template set Warning: unaligning (T0333)P7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uqtA)S19 Warning: unaligning (T0333)F22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1uqtA)G35 Warning: unaligning (T0333)D28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1uqtA)G35 Warning: unaligning (T0333)E115 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1uqtA)D130 Warning: unaligning (T0333)G218 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1uqtA)R262 Warning: unaligning (T0333)T219 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1uqtA)R262 T0333 8 :GIGHLFPLIQLAWG 1uqtA 20 :AGGLAVGILGALKA T0333 29 :VLIAV 1uqtA 36 :GLWFG T0333 34 :AEH 1uqtA 45 :TGN T0333 41 :AAAGLEVVD 1uqtA 48 :EDQPLKKVK T0333 51 :APDYSAVKVF 1uqtA 57 :KGNITWASFN T0333 61 :EQVAKDNP 1uqtA 69 :EQDLDEYY T0333 69 :RFAETVA 1uqtA 90 :YRLDLVQ T0333 81 :DLEEWGVQIAAVNRP 1uqtA 97 :FQRPAWDGYLRVNAL T0333 100 :TMALVDDY 1uqtA 112 :LADKLLPL T0333 108 :R 1uqtA 123 :D T0333 110 :DLVVY 1uqtA 124 :DIIWI T0333 116 :QGATVGLLAADRAGV 1uqtA 131 :YHLLPFAHELRKRGV T0333 131 :PAVQRNQSAW 1uqtA 148 :RIGFFLHIPF T0333 145 :MHRSIASFLTDLMDKHQVSL 1uqtA 185 :QTENDRLAFLDCLSNLTRVT T0333 165 :P 1uqtA 206 :R T0333 176 :PSLLLEAEPEGWFMR 1uqtA 207 :SAKSHTAWGKAFRTE T0333 192 :VPYGGGAV 1uqtA 222 :VYPIGIEP T0333 200 :LGDRL 1uqtA 247 :LKAEL T0333 209 :ARPEVAITM 1uqtA 252 :KNVQNIFSV T0333 220 :IELQAFGIGAVEPIIAAAGEV 1uqtA 263 :LDYSKGLPERFLAYEALLEKY T0333 242 :ADFVLALGDLD 1uqtA 290 :IRYTQIAPTSR T0333 254 :SPL 1uqtA 327 :LGW T0333 261 :RNVRAV 1uqtA 330 :TPLYYL T0333 267 :GWTPLHTLLRT 1uqtA 337 :QHFDRKLLMKI T0333 278 :CTAVVHHG 1uqtA 351 :SDVGLVTP T0333 286 :GG 1uqtA 362 :GM T0333 288 :GTVMTAIDAG 1uqtA 365 :LVAKEYVAAQ T0333 298 :IPQLLAPDPRDQFQHTAR 1uqtA 379 :PGVLVLSQFAGAANELTS T0333 324 :G 1uqtA 397 :A T0333 325 :LV 1uqtA 399 :IV T0333 327 :STSDKV 1uqtA 403 :YDRDEV T0333 334 :ADLLRRLIG 1uqtA 409 :AAALDRALT T0333 344 :ESLRTAAREVREEMVALP 1uqtA 421 :AERISRHAEMLDVIVKND T0333 364 :AETVRR 1uqtA 439 :INHWQE T0333 370 :IVERI 1uqtA 446 :FISDL Number of specific fragments extracted= 35 number of extra gaps= 3 total=3206 Number of alignments=160 # 1uqtA read from 1uqtA/merged-good-all-a2m # found chain 1uqtA in template set Warning: unaligning (T0333)P7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uqtA)S19 Warning: unaligning (T0333)F22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1uqtA)G35 Warning: unaligning (T0333)D28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1uqtA)G35 Warning: unaligning (T0333)Y114 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1uqtA)D130 Warning: unaligning (T0333)E115 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1uqtA)D130 Warning: unaligning (T0333)G218 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1uqtA)R262 Warning: unaligning (T0333)T219 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1uqtA)R262 T0333 8 :GIGHLFPLIQLAWG 1uqtA 20 :AGGLAVGILGALKA T0333 29 :VLIAV 1uqtA 36 :GLWFG T0333 34 :AEHADRA 1uqtA 45 :TGNEDQP T0333 41 :AAAGLEVVDVAPDYSAVK 1uqtA 56 :KKGNITWASFNLSEQDLD T0333 59 :VFEQVAKDNPRFAETVATRPAIDLEEWGVQIAAVNR 1uqtA 75 :YYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNA T0333 99 :GTMALVDD 1uqtA 111 :LLADKLLP T0333 107 :YRPDLVV 1uqtA 122 :DDDIIWI T0333 116 :QGATVGLLAADRAGVP 1uqtA 131 :YHLLPFAHELRKRGVN T0333 132 :AVQRNQSA 1uqtA 149 :IGFFLHIP T0333 140 :WRTRGMHRSIASFLTDL 1uqtA 163 :FNALPTYDTLLEQLCDY T0333 158 :DKHQVSLPEPVATIE 1uqtA 180 :DLLGFQTENDRLAFL T0333 173 :SFPP 1uqtA 199 :NLTR T0333 180 :LEAEPE 1uqtA 203 :VTTRSA T0333 186 :GWFMRWVPYGGGAVLG 1uqtA 214 :WGKAFRTEVYPIGIEP T0333 205 :PPVP 1uqtA 238 :GPLP T0333 209 :ARPEVAITM 1uqtA 252 :KNVQNIFSV T0333 220 :IE 1uqtA 263 :LD T0333 223 :QAFGIGAVEPIIAAAGEV 1uqtA 265 :YSKGLPERFLAYEALLEK T0333 241 :DADFVLALG 1uqtA 289 :KIRYTQIAP T0333 250 :DLDI 1uqtA 300 :RGDV T0333 254 :SP 1uqtA 328 :GW T0333 261 :RNVRAVGWT 1uqtA 330 :TPLYYLNQH T0333 270 :PLHTLLR 1uqtA 340 :DRKLLMK T0333 277 :TCTAVVHHG 1uqtA 350 :YSDVGLVTP T0333 286 :GGGTVMTAIDA 1uqtA 363 :MNLVAKEYVAA T0333 297 :GIPQLLAPDPR 1uqtA 378 :NPGVLVLSQFA T0333 308 :DQF 1uqtA 392 :NEL T0333 322 :GIGLVSTS 1uqtA 395 :TSALIVNP T0333 330 :DKVD 1uqtA 404 :DRDE T0333 334 :ADLLRRLIG 1uqtA 409 :AAALDRALT T0333 343 :DESLRTAAREVREEMVAL 1uqtA 420 :LAERISRHAEMLDVIVKN T0333 362 :TPAETVRRIVERIS 1uqtA 438 :DINHWQECFISDLK Number of specific fragments extracted= 32 number of extra gaps= 3 total=3238 Number of alignments=161 # 1uqtA read from 1uqtA/merged-good-all-a2m # found chain 1uqtA in template set Warning: unaligning (T0333)Y114 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1uqtA)D130 Warning: unaligning (T0333)E115 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1uqtA)D130 Warning: unaligning (T0333)G218 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1uqtA)R262 Warning: unaligning (T0333)T219 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1uqtA)R262 T0333 48 :VDVAPDYSAVKVF 1uqtA 63 :ASFNLSEQDLDEY T0333 64 :AKDNPRFA 1uqtA 88 :FHYRLDLV T0333 73 :TVATRPAIDLEEWGVQIAAVNRPLVD 1uqtA 96 :QFQRPAWDGYLRVNALLADKLLPLLQ T0333 107 :YRPDLVV 1uqtA 122 :DDDIIWI T0333 116 :QGATVGLLAADRAGV 1uqtA 131 :YHLLPFAHELRKRGV T0333 131 :PAVQRNQSAWRTRGMHRSIASFLT 1uqtA 148 :RIGFFLHIPFPTPEIFNALPTYDT T0333 185 :EGWFMRWVPYGGGA 1uqtA 214 :WGKAFRTEVYPIGI T0333 199 :VLGDRL 1uqtA 239 :PLPPKL T0333 205 :PP 1uqtA 249 :AE T0333 208 :PARPEVAITM 1uqtA 251 :LKNVQNIFSV T0333 220 :IELQAFGIGAVEPIIAAAGEVD 1uqtA 263 :LDYSKGLPERFLAYEALLEKYP T0333 242 :ADFVLALGDLD 1uqtA 290 :IRYTQIAPTSR T0333 254 :SPL 1uqtA 301 :GDV T0333 264 :RAVGWTPLHTLL 1uqtA 333 :YYLNQHFDRKLL T0333 276 :RTCTAVVHH 1uqtA 349 :RYSDVGLVT T0333 285 :GGGGTVMTAIDA 1uqtA 362 :GMNLVAKEYVAA T0333 298 :IPQLLAPDP 1uqtA 379 :PGVLVLSQF T0333 318 :VSRRGIGLVSTSDKVDADLLRRLIG 1uqtA 393 :ELTSALIVNPYDRDEVAAALDRALT T0333 344 :ESLRTAAREVREEMVAL 1uqtA 421 :AERISRHAEMLDVIVKN T0333 362 :TPAETVRRIVERI 1uqtA 438 :DINHWQECFISDL Number of specific fragments extracted= 20 number of extra gaps= 2 total=3258 Number of alignments=162 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jixA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0333 read from 1jixA/merged-good-all-a2m # 1jixA read from 1jixA/merged-good-all-a2m # found chain 1jixA in training set T0333 1 :M 1jixA 1 :M T0333 2 :LFVSSPGI 1jixA 3 :IAIINMGN T0333 11 :HLFPLIQLAWGFRTAGHDVLIAVAEH 1jixA 19 :PSSETIYLFKVISEMGLNVDIISLKN T0333 45 :LEVVDVAPDYSAVKVF 1jixA 45 :GVYTKSFDEVDVNDYD T0333 110 :DLVVYEQGA 1jixA 61 :RLIVVNSSI T0333 120 :VGLLAADRAGVPAVQRNQSAW 1jixA 82 :SAQKFMAKYKSKIYYLFTDIR T0333 143 :RGMH 1jixA 138 :GINL T0333 151 :SFLTDLMDK 1jixA 142 :DIAKAAHKK T0333 164 :LPEPVATIESFPPSLLLEAEPEGWFMR 1jixA 151 :VDNVIEFEYFPIEQYKIHMNDFQLSKP T0333 209 :ARPEVAITMGTIELQAFGIGAV 1jixA 178 :TKKTLDVIYGGSFRSGQRESKM T0333 234 :IAAAGEVDADFVLA 1jixA 200 :VEFLFDTGLNIEFF T0333 249 :GDLDISPLGT 1jixA 214 :GNAREKQFKN T0333 259 :LPRNVRAVGWTPLHTLLRT 1jixA 228 :WTKAPVFTGKIPMNMVSEK T0333 278 :CTAVVHHG 1jixA 250 :AIAALIIG T0333 288 :GTVMTAIDAGIPQLLA 1jixA 268 :LRVWETMASDAVMLID T0333 315 :R 1jixA 291 :R T0333 325 :LV 1jixA 292 :II T0333 327 :STSDKV 1jixA 301 :NNRAEL T0333 334 :ADLLRRLIGDES 1jixA 307 :IDRVNELKHSDV T0333 346 :LRTAAREVREEMVALPTPAETVRRIVERI 1jixA 320 :RKEMLSIQHDILNKTRAKKAEWQDAFKKA Number of specific fragments extracted= 20 number of extra gaps= 0 total=3278 Number of alignments=163 # 1jixA read from 1jixA/merged-good-all-a2m # found chain 1jixA in training set T0333 10 :GHLFPLIQLAWGFRTAGHDVLIAVAE 1jixA 18 :VPSSETIYLFKVISEMGLNVDIISLK T0333 65 :KD 1jixA 44 :NG T0333 72 :ETVATRPAIDLEE 1jixA 46 :VYTKSFDEVDVND T0333 109 :P 1jixA 59 :Y T0333 110 :DLVVYE 1jixA 61 :RLIVVN T0333 117 :GA 1jixA 77 :NL T0333 119 :TVGLLAADRAGVPAVQRNQSA 1jixA 81 :LSAQKFMAKYKSKIYYLFTDI T0333 140 :WRTRGM 1jixA 116 :PWAYLY T0333 158 :DKHQVSLPEPVATIE 1jixA 131 :PIKVISQGINLDIAK T0333 173 :SFPPS 1jixA 149 :KKVDN T0333 191 :WVPYGGGAVLG 1jixA 154 :VIEFEYFPIEQ T0333 202 :DRLPPVP 1jixA 170 :NDFQLSK T0333 209 :ARPEVAITMGTIE 1jixA 179 :KKTLDVIYGGSFR T0333 223 :QAFGIGAVEPIIAAA 1jixA 192 :SGQRESKMVEFLFDT T0333 241 :DADFVLALG 1jixA 207 :GLNIEFFGN T0333 250 :DLDISPLGTLP 1jixA 217 :REKQFKNPKYP T0333 261 :RNVRAVGWTPLHTLLR 1jixA 230 :KAPVFTGKIPMNMVSE T0333 277 :TCTAVVHHG 1jixA 249 :QAIAALIIG T0333 286 :GGGTVMTAIDAGIPQLLA 1jixA 266 :ITLRVWETMASDAVMLID T0333 304 :PDPR 1jixA 294 :NDAR T0333 325 :LVST 1jixA 298 :FYVN T0333 330 :DKVD 1jixA 302 :NRAE T0333 334 :ADLLRRLIGDESLRTAAREVREEMVALP 1jixA 307 :IDRVNELKHSDVLRKEMLSIQHDILNKT T0333 362 :TPAETVRRIVERIS 1jixA 337 :KKAEWQDAFKKAID Number of specific fragments extracted= 24 number of extra gaps= 0 total=3302 Number of alignments=164 # 1jixA read from 1jixA/merged-good-all-a2m # found chain 1jixA in training set T0333 1 :MLFVSSPG 1jixA 3 :IAIINMGN T0333 11 :HLFPLIQLAWGFRTAGHDVLIAV 1jixA 19 :PSSETIYLFKVISEMGLNVDIIS T0333 44 :GLEVVDVAPDYSAVKVF 1jixA 44 :NGVYTKSFDEVDVNDYD T0333 110 :DLVVYEQ 1jixA 61 :RLIVVNS T0333 117 :GATVGLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLT 1jixA 79 :AILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRP T0333 155 :DLMDKHQVSLPEPVATIESFPP 1jixA 119 :YLYTEEELLIKSPIKVISQGIN T0333 182 :AEPEGWFMRWVPYGGGA 1jixA 148 :HKKVDNVIEFEYFPIEQ T0333 199 :VLGDRLPPVPARPEVAITMGTIELQAFGIGA 1jixA 168 :HMNDFQLSKPTKKTLDVIYGGSFRSGQRESK T0333 233 :IIAAAGEVDADFVLA 1jixA 199 :MVEFLFDTGLNIEFF T0333 249 :GDLDISPL 1jixA 214 :GNAREKQF T0333 257 :GTLPRNVRAVGWTPLHTLL 1jixA 226 :YPWTKAPVFTGKIPMNMVS T0333 276 :RTCTAVVHHGG 1jixA 248 :SQAIAALIIGD T0333 287 :GGTVMTAIDAGIPQLLA 1jixA 267 :TLRVWETMASDAVMLID T0333 324 :GL 1jixA 291 :RI T0333 327 :STSDKVDADLLRRLIGD 1jixA 300 :VNNRAELIDRVNELKHS T0333 344 :ESLRTAAREVREEMVALP 1jixA 318 :VLRKEMLSIQHDILNKTR T0333 362 :TPAETVRRIVERIS 1jixA 337 :KKAEWQDAFKKAID Number of specific fragments extracted= 17 number of extra gaps= 0 total=3319 Number of alignments=165 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzuA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzuA expands to /projects/compbio/data/pdb/1rzu.pdb.gz 1rzuA:# T0333 read from 1rzuA/merged-good-all-a2m # 1rzuA read from 1rzuA/merged-good-all-a2m # adding 1rzuA to template set # found chain 1rzuA in template set T0333 1 :M 1rzuA 1 :M T0333 2 :LFVSS 1rzuA 3 :VLSVS T0333 8 :GIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAAA 1rzuA 16 :TGGLADVVGALPIALEAHGVRTRTLIPGYPAVKAAV T0333 51 :APDYSAVKVFEQVAKDNPRFAETVATRP 1rzuA 75 :HERLDLLILDAPAYYERSGGPYLGQTGK T0333 81 :DLEEWGVQIAAVNRPLV 1rzuA 103 :DYPDNWKRFAALSLAAA T0333 102 :ALVDDY 1rzuA 120 :RIGAGV T0333 108 :RPDLVVYE 1rzuA 130 :RPDMVHAH T0333 116 :QGATVGLLAADRAG 1rzuA 139 :WQAAMTPVYMRYAE T0333 130 :VPAVQRNQSAW 1rzuA 156 :IPSLLTIHNIA T0333 141 :RTRGMHRSIASFLTDL 1rzuA 222 :LTAEFGMGLEGVIGSR T0333 161 :Q 1rzuA 238 :A T0333 166 :EPVATIESFPPSLLLEAEPEGWFMRWVPYGGGAV 1rzuA 239 :HVLHGIVNGIDADVWNPATDHLIHDNYSAANLKN T0333 200 :LGDRLPPVPARPEVAITMGTIELQAF 1rzuA 280 :VAEHFRIDDDGSPLFCVISRLTWQKG T0333 230 :VEPIIAAAG 1rzuA 306 :IDLMAEAVD T0333 239 :EVDADFVLALGDLD 1rzuA 318 :SLGGRLVVLGAGDV T0333 253 :ISPLG 1rzuA 341 :ASRHH T0333 261 :RNVRAV 1rzuA 346 :GRVGVA T0333 267 :GWT 1rzuA 353 :GYN T0333 270 :PLHTLLRT 1rzuA 357 :PLSHLMQA T0333 278 :CTAVVHHG 1rzuA 366 :CDAIIIPS T0333 286 :G 1rzuA 379 :G T0333 288 :GTVMTAIDAGIPQLLAPDPR 1rzuA 380 :LTQLYALRYGCIPVVARTGG T0333 308 :DQFQHTAREAVSRRGIG 1rzuA 402 :DTVIDANHAALASKAAT T0333 325 :LV 1rzuA 420 :VQ T0333 327 :STSDKV 1rzuA 425 :VTLDGL T0333 334 :ADLLRRLI 1rzuA 431 :KQAIRRTV T0333 342 :GDESLRTAA 1rzuA 442 :HDPKLWTQM T0333 354 :REEMVALPTPAETVRRIVERI 1rzuA 451 :QKLGMKSDVSWEKSAGLYAAL Number of specific fragments extracted= 28 number of extra gaps= 0 total=3347 Number of alignments=166 # 1rzuA read from 1rzuA/merged-good-all-a2m # found chain 1rzuA in template set T0333 1 :M 1rzuA 1 :M T0333 2 :LFV 1rzuA 3 :VLS T0333 5 :SSPGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAA 1rzuA 13 :LIKTGGLADVVGALPIALEAHGVRTRTLIPGYPAVKAA T0333 43 :AGLEVVDVAPDY 1rzuA 76 :ERLDLLILDAPA T0333 65 :KDNPRFAETVATRPAIDLEEWGVQIAAVN 1rzuA 88 :YYERSGGPYLGQTGKDYPDNWKRFAALSL T0333 99 :GTMALVDD 1rzuA 117 :AAARIGAG T0333 107 :YRPDLVVYE 1rzuA 129 :WRPDMVHAH T0333 116 :QGATVGLLAADRAG 1rzuA 139 :WQAAMTPVYMRYAE T0333 130 :VPAVQRNQSA 1rzuA 156 :IPSLLTIHNI T0333 149 :IASFLTDLMDKHQVSLPEPVATIE 1rzuA 199 :FLKGGLQTATALSTVSPSYAEEIL T0333 173 :SFPPS 1rzuA 235 :GSRAH T0333 191 :WVPYGGGAVLGDRLPPVP 1rzuA 240 :VLHGIVNGIDADVWNPAT T0333 209 :ARPEVAITMGTIE 1rzuA 289 :DGSPLFCVISRLT T0333 223 :QAFGIGAVEPIIAAAGEVDADFVLALGDLDI 1rzuA 302 :WQKGIDLMAEAVDEIVSLGGRLVVLGAGDVA T0333 254 :SPLG 1rzuA 342 :SRHH T0333 261 :RNVRA 1rzuA 346 :GRVGV T0333 266 :VGWT 1rzuA 352 :IGYN T0333 270 :PLHTLLR 1rzuA 357 :PLSHLMQ T0333 277 :TCTAVVHHG 1rzuA 365 :GCDAIIIPS T0333 286 :GGGTVMTAIDAGIPQLLAPDPR 1rzuA 378 :CGLTQLYALRYGCIPVVARTGG T0333 314 :AREAVSR 1rzuA 400 :LADTVID T0333 323 :IGLVSTS 1rzuA 418 :TGVQFSP T0333 330 :DKVD 1rzuA 426 :TLDG T0333 334 :ADLLRRLIG 1rzuA 431 :KQAIRRTVR T0333 343 :DESLRTAAREVR 1rzuA 443 :DPKLWTQMQKLG T0333 358 :VALP 1rzuA 455 :MKSD T0333 362 :TPAETVRRIVERIS 1rzuA 460 :SWEKSAGLYAALYS Number of specific fragments extracted= 27 number of extra gaps= 0 total=3374 Number of alignments=167 # 1rzuA read from 1rzuA/merged-good-all-a2m # found chain 1rzuA in template set T0333 1 :MLFVSSPGI 1rzuA 3 :VLSVSSEIY T0333 10 :GHLFPLIQLAWGFRTAGHDVLIAV 1rzuA 18 :GLADVVGALPIALEAHGVRTRTLI T0333 34 :AEHADRA 1rzuA 45 :PAVKAAV T0333 65 :KDNPRFAETVATRPAIDLEEWGVQIAAVNRPLVD 1rzuA 94 :GPYLGQTGKDYPDNWKRFAALSLAAARIGAGVLP T0333 106 :DYRPDLVVYEQGAT 1rzuA 128 :GWRPDMVHAHDWQA T0333 120 :VGLLAADRAG 1rzuA 143 :MTPVYMRYAE T0333 130 :VPAVQRNQSAWRTRGMHRSIASFLT 1rzuA 156 :IPSLLTIHNIAFQGQFGANIFSKLA T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPY 1rzuA 228 :MGLEGVIGSRAHVLHGIVNGIDADVWNPATDHLIHDNYSA T0333 199 :VLGDRLPPVPARPEVAITMGTIELQ 1rzuA 279 :AVAEHFRIDDDGSPLFCVISRLTWQ T0333 225 :FGIGAVEPIIAAAGEVDADFVLALGD 1rzuA 304 :KGIDLMAEAVDEIVSLGGRLVVLGAG T0333 256 :L 1rzuA 333 :L T0333 257 :GTLPRNVRAVGWTP 1rzuA 342 :SRHHGRVGVAIGYN T0333 271 :LHTLL 1rzuA 358 :LSHLM T0333 276 :RTCTAVVHH 1rzuA 364 :AGCDAIIIP T0333 285 :GG 1rzuA 378 :CG T0333 288 :GTVMTAIDAGIPQLLAP 1rzuA 380 :LTQLYALRYGCIPVVAR T0333 317 :AVSRRGIGLV 1rzuA 412 :LASKAATGVQ T0333 327 :STSDKVDADLLRRLIG 1rzuA 424 :PVTLDGLKQAIRRTVR T0333 343 :DESL 1rzuA 443 :DPKL T0333 350 :AREVREEMVALP 1rzuA 447 :WTQMQKLGMKSD T0333 362 :TPAETVRRIVERI 1rzuA 460 :SWEKSAGLYAALY Number of specific fragments extracted= 21 number of extra gaps= 0 total=3395 Number of alignments=168 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cs0C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cs0C expands to /projects/compbio/data/pdb/1cs0.pdb.gz 1cs0C:Skipped atom 15065, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 15067, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 15069, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 15071, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 15073, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18590, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18592, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18594, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18740, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18742, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18744, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18746, because occupancy 0.500 <= existing 0.500 in 1cs0C Skipped atom 18748, because occupancy 0.500 <= existing 0.500 in 1cs0C # T0333 read from 1cs0C/merged-good-all-a2m # 1cs0C read from 1cs0C/merged-good-all-a2m # adding 1cs0C to template set # found chain 1cs0C in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1cs0C)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1cs0C)D558 T0333 2 :LFVSSPGI 1cs0C 10 :ILILGAGP T0333 10 :GHL 1cs0C 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1cs0C 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHADRAAAA 1cs0C 51 :PATIMTDPEM T0333 45 :LEVVDVAP 1cs0C 61 :ADATYIEP T0333 93 :NRPL 1cs0C 70 :HWEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1cs0C 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1cs0C 112 :GVT T0333 135 :RNQSA 1cs0C 115 :MIGAT T0333 141 :RTRGMHRSIASFLTDL 1cs0C 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATI 1cs0C 521 :DLHPVYK T0333 172 :ESFPPSLL 1cs0C 529 :VDTCAAEF T0333 200 :LGDR 1cs0C 547 :YEEE T0333 204 :LPPV 1cs0C 553 :ANPS T0333 210 :RPEVAITMG 1cs0C 559 :REKIMVLGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLALGDLD 1cs0C 572 :IGQGIEFDYCCVHASLALREDGYETIMVNCNPE T0333 275 :LRTCTAVVHHG 1cs0C 610 :YDTSDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1cs0C 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1cs0C 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1cs0C 647 :PLKLARA T0333 318 :VSRRGIGLV 1cs0C 654 :LEAAGVPVI T0333 327 :ST 1cs0C 664 :TS T0333 334 :ADLLRRLIG 1cs0C 666 :PDAIDRAED T0333 347 :RTAAREVREE 1cs0C 675 :RERFQHAVER T0333 363 :PAETVRRIVERIS 1cs0C 697 :AIEMAVEKAKEIG Number of specific fragments extracted= 25 number of extra gaps= 1 total=3420 Number of alignments=169 # 1cs0C read from 1cs0C/merged-good-all-a2m # found chain 1cs0C in template set Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1cs0C)D558 Warning: unaligning (T0333)R354 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cs0C)V750 Warning: unaligning (T0333)E355 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cs0C)V750 T0333 2 :LFVSSPGI 1cs0C 12 :ILGAGPIV T0333 10 :GHL 1cs0C 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAAAAG 1cs0C 28 :YSGAQACKALREEGYRVILVNSNPATIMTDPE T0333 45 :LEVVDVAPDY 1cs0C 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1cs0C 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1cs0C 112 :GVT T0333 135 :RNQSA 1cs0C 115 :MIGAT T0333 140 :WRTRGMHRSIASFLTDLM 1cs0C 479 :VGITGLNADFLRQLKRKG T0333 198 :AVLGDR 1cs0C 531 :TCAAEF T0333 205 :PPVP 1cs0C 537 :ATDT T0333 210 :RPEVAITMG 1cs0C 559 :REKIMVLGG T0333 219 :TIE 1cs0C 571 :RIG T0333 225 :FGIGA 1cs0C 574 :QGIEF T0333 230 :VEPIIAAAGEVDADFVLALGDLDI 1cs0C 582 :CVHASLALREDGYETIMVNCNPET T0333 261 :RNVRAVGWT 1cs0C 614 :DRLYFEPVT T0333 271 :LHTLLR 1cs0C 626 :VLEIVR T0333 277 :TCTAVVHHGGGGTVM 1cs0C 634 :KPKGVIVQYGGQTPL T0333 292 :TAIDAGIPQLLAPDPR 1cs0C 653 :ALEAAGVPVIGTSPDA T0333 308 :DQF 1cs0C 674 :DRE T0333 313 :TAREAVSRRG 1cs0C 677 :RFQHAVERLK T0333 323 :IGLVST 1cs0C 691 :ANATVT T0333 330 :DKVD 1cs0C 697 :AIEM T0333 334 :ADLLRRL 1cs0C 702 :VEKAKEI T0333 342 :GDESLRTAAREV 1cs0C 729 :YDEADLRRYFQT T0333 361 :P 1cs0C 799 :Y T0333 362 :TPAETVRRIVERIS 1cs0C 801 :LSQEIQDVMRQQVQ Number of specific fragments extracted= 26 number of extra gaps= 2 total=3446 Number of alignments=170 # 1cs0C read from 1cs0C/merged-good-all-a2m # found chain 1cs0C in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1cs0C)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1cs0C)D558 T0333 1 :MLFVSSPGI 1cs0C 10 :ILILGAGPI T0333 10 :GH 1cs0C 21 :GQ T0333 12 :LFPLIQLAWGFRTAGHDVLIAV 1cs0C 27 :DYSGAQACKALREEGYRVILVN T0333 34 :AEHA 1cs0C 51 :PATI T0333 45 :LEVVDVAPDY 1cs0C 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1cs0C 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1cs0C 112 :GV T0333 136 :N 1cs0C 114 :T T0333 138 :SAWRTRGMHRSIASFLT 1cs0C 115 :MIGATADAIDKAEDRRR T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1cs0C 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 203 :RLPPV 1cs0C 552 :EANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPII 1cs0C 559 :REKIMVLGGGPNRIGQGIEFDYCCV T0333 235 :AAAGEVDADFVLALGD 1cs0C 587 :LALREDGYETIMVNCN T0333 252 :DISPLG 1cs0C 605 :TVSTDY T0333 276 :RTC 1cs0C 611 :DTS T0333 279 :TAVVHHGGGGTVMTAIDAGIP 1cs0C 615 :RLYFEPVTLEDVLEIVRIEKP T0333 300 :QLLAP 1cs0C 637 :GVIVQ T0333 305 :DPRDQFQHTAREAVSRRGIGL 1cs0C 643 :GGQTPLKLARALEAAGVPVIG T0333 329 :SD 1cs0C 665 :SP T0333 335 :DLLRRLIGDESLRTAAREV 1cs0C 667 :DAIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1cs0C 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 21 number of extra gaps= 1 total=3467 Number of alignments=171 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p3dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0333 read from 1p3dA/merged-good-all-a2m # 1p3dA read from 1p3dA/merged-good-all-a2m # found chain 1p3dA in training set Warning: unaligning (T0333)A132 because of BadResidue code BAD_PEPTIDE in next template residue (1p3dA)T148 Warning: unaligning (T0333)V133 because of BadResidue code BAD_PEPTIDE at template residue (1p3dA)T148 T0333 3 :FVSSPGIGHL 1p3dA 21 :IHFIGIGGAG T0333 15 :LIQLAWGFRTAGHDVLIAV 1p3dA 31 :MSGIAEILLNEGYQISGSD T0333 34 :AEHADRAAAAGLEVVD 1p3dA 53 :GVVTQRLAQAGAKIYI T0333 50 :VAPDYSAVKVFEQVAKDN 1p3dA 74 :HIEGASVVVVSSAIKDDN T0333 84 :EWGVQIAAV 1p3dA 92 :PELVTSKQK T0333 93 :NRPLVDGT 1p3dA 107 :RAQMLAEI T0333 104 :VDDYR 1p3dA 115 :MRFRH T0333 110 :DLVVYEQGA 1p3dA 120 :GIAVAGTHG T0333 119 :TVGLLAADRAGVP 1p3dA 134 :AMISMIYTQAKLD T0333 134 :QRNQSAW 1p3dA 149 :FVNGGLV T0333 200 :LGDRLP 1p3dA 360 :AREGWG T0333 209 :ARPEVAITMGTIELQ 1p3dA 366 :DKRIVMIFQPHRYSR T0333 226 :GIGAVEPIIAAAGEVDADFVLALGDLDISP 1p3dA 381 :TRDLFDDFVQVLSQVDALIMLDVYAAGEAP T0333 305 :DPR 1p3dA 411 :IVG T0333 308 :DQFQHTAR 1p3dA 415 :DSKSLCRS T0333 318 :VSRRGIG 1p3dA 423 :IRNLGKV T0333 325 :LV 1p3dA 432 :IL T0333 327 :STSDKV 1p3dA 435 :SDTSQL T0333 334 :ADLLRRLI 1p3dA 441 :GDVLDQII T0333 346 :LRTAAREVREE 1p3dA 462 :VSKISRGLAES Number of specific fragments extracted= 20 number of extra gaps= 1 total=3487 Number of alignments=172 # 1p3dA read from 1p3dA/merged-good-all-a2m # found chain 1p3dA in training set Warning: unaligning (T0333)A132 because of BadResidue code BAD_PEPTIDE in next template residue (1p3dA)T148 Warning: unaligning (T0333)V133 because of BadResidue code BAD_PEPTIDE at template residue (1p3dA)T148 T0333 7 :PGIGHL 1p3dA 25 :GIGGAG T0333 15 :LIQLAWGFRTAGHDVLIAV 1p3dA 31 :MSGIAEILLNEGYQISGSD T0333 34 :AE 1p3dA 51 :AD T0333 38 :DRAAAAGLEVVDVAPDY 1p3dA 57 :QRLAQAGAKIYIGHAEE T0333 56 :AV 1p3dA 74 :HI T0333 65 :KDNPRFAETVATRPAIDLEEWGVQ 1p3dA 76 :EGASVVVVSSAIKDDNPELVTSKQ T0333 89 :IAA 1p3dA 107 :RAQ T0333 99 :GTMALVDDYR 1p3dA 110 :MLAEIMRFRH T0333 110 :DLVVYEQGA 1p3dA 120 :GIAVAGTHG T0333 119 :TVGLLAADRAGVP 1p3dA 134 :AMISMIYTQAKLD T0333 134 :QRNQSA 1p3dA 149 :FVNGGL T0333 140 :WRTRGMHRSIASFLTDLM 1p3dA 200 :DTYEGDFEKMKATYVKFL T0333 158 :DKHQVSLPEPVATIE 1p3dA 225 :LAVMCADDPVLMELV T0333 173 :SFPP 1p3dA 241 :KVGR T0333 191 :WVPYGGGA 1p3dA 245 :QVITYGFS T0333 205 :PPVP 1p3dA 253 :EQAD T0333 209 :ARPE 1p3dA 336 :PNGK T0333 213 :VAITMGTIE 1p3dA 341 :RLVDDYGHH T0333 223 :Q 1p3dA 350 :P T0333 225 :FGIGAVEPIIAAAGE 1p3dA 351 :TEVGVTIKAAREGWG T0333 241 :DADFVLALGDLDI 1p3dA 366 :DKRIVMIFQPHRY T0333 271 :LHTLLRTCTAVVHHG 1p3dA 388 :FVQVLSQVDALIMLD T0333 286 :GG 1p3dA 407 :GE T0333 304 :PDPR 1p3dA 410 :PIVG T0333 308 :DQF 1p3dA 415 :DSK T0333 313 :TAREAVSRRGIG 1p3dA 418 :SLCRSIRNLGKV T0333 325 :LVST 1p3dA 432 :ILVS T0333 330 :DKVD 1p3dA 436 :DTSQ T0333 334 :ADLLRRLIG 1p3dA 441 :GDVLDQIIQ T0333 359 :AL 1p3dA 450 :DG T0333 361 :PTPAETVRRIVER 1p3dA 460 :GSVSKISRGLAES Number of specific fragments extracted= 31 number of extra gaps= 1 total=3518 Number of alignments=173 # 1p3dA read from 1p3dA/merged-good-all-a2m # found chain 1p3dA in training set Warning: unaligning (T0333)A132 because of BadResidue code BAD_PEPTIDE in next template residue (1p3dA)T148 Warning: unaligning (T0333)V133 because of BadResidue code BAD_PEPTIDE at template residue (1p3dA)T148 Warning: unaligning (T0333)I374 because last residue in template chain is (1p3dA)W473 T0333 1 :MLFVSSPGIG 1p3dA 21 :IHFIGIGGAG T0333 15 :LIQLAWGFRTAGHDVLIAV 1p3dA 31 :MSGIAEILLNEGYQISGSD T0333 34 :AEHADRAAAAGLEVVDVAPDYSAVKVF 1p3dA 53 :GVVTQRLAQAGAKIYIGHAEEHIEGAS T0333 61 :EQVAKDNPRF 1p3dA 95 :VTSKQKRIPV T0333 96 :LVDGTMALVDDYRPDLVVYEQGATVGL 1p3dA 107 :RAQMLAEIMRFRHGIAVAGTHGKTTTT T0333 123 :LAADRAGVP 1p3dA 138 :MIYTQAKLD T0333 134 :QRNQSAWRTRGMHRSIASFLT 1p3dA 149 :FVNGGLVKSAGKNAHLGASRY T0333 155 :DLMDKHQVSLPEPVATIESFPPSL 1p3dA 311 :EAILEALADFQGAGRRFDQLGEFI T0333 184 :PEGWFMRWVPYGGGA 1p3dA 335 :RPNGKVRLVDDYGHH T0333 207 :VPARPEVAITMGTIELQ 1p3dA 364 :WGDKRIVMIFQPHRYSR T0333 226 :GIGAVEPIIAAAGEVDADFVLALGDLDISPLG 1p3dA 381 :TRDLFDDFVQVLSQVDALIMLDVYAAGEAPIV T0333 306 :PRDQFQHTAREAVSRRGIGLVSTSDKVDADLLRRLIGD 1p3dA 413 :GADSKSLCRSIRNLGKVDPILVSDTSQLGDVLDQIIQD T0333 360 :LPTPAETVRRIVER 1p3dA 459 :AGSVSKISRGLAES Number of specific fragments extracted= 13 number of extra gaps= 1 total=3531 Number of alignments=174 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f48A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f48A expands to /projects/compbio/data/pdb/1f48.pdb.gz 1f48A:# T0333 read from 1f48A/merged-good-all-a2m # 1f48A read from 1f48A/merged-good-all-a2m # adding 1f48A to template set # found chain 1f48A in template set Warning: unaligning (T0333)E185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f48A)R309 Warning: unaligning (T0333)A198 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f48A)R309 Warning: unaligning (T0333)C278 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f48A)T480 T0333 2 :LFVSS 1f48A 11 :LFFTG T0333 7 :PGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAAA 1f48A 17 :GGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQV T0333 44 :GLEVVDVAP 1f48A 59 :GNTIQAIAS T0333 53 :DYS 1f48A 70 :GLS T0333 58 :KVFEQVAKDNP 1f48A 152 :LLQLPGAWSSF T0333 69 :RFAETVATRPAIDL 1f48A 168 :EGASCLGPMAGLEK T0333 94 :RPLVDGTMALVD 1f48A 183 :REQYAYAVEALS T0333 106 :DYRPDLVVYEQGA 1f48A 196 :PKRTRLVLVARLQ T0333 119 :TVGLLAADRA 1f48A 210 :STLQEVARTH T0333 129 :GVP 1f48A 226 :GLK T0333 132 :AVQRNQSAW 1f48A 231 :YLVINGVLP T0333 141 :RTRGMHRSIASFLTDLMDKHQVSLPEPVATIESFPPSLL 1f48A 244 :ANDTLAAAIWEREQEALANLPADLAGLPTDTLFLQPVNM T0333 180 :LEAEP 1f48A 291 :LLSTQ T0333 199 :V 1f48A 310 :P T0333 200 :LGD 1f48A 322 :IAR T0333 209 :ARPEVAITMGTIELQ 1f48A 325 :NEHGLIMLMGKGGVG T0333 226 :GIGAVEPIIAAAGEVDADFVLALGDLD 1f48A 340 :KTTMAAAIAVRLADMGFDVHLTTSDPA T0333 253 :ISPLG 1f48A 436 :IREAG T0333 261 :RNVRAVGWTP 1f48A 441 :KRFVVMDTAP T0333 271 :LHTLLRT 1f48A 454 :TLLLLDA T0333 297 :GIPQLLAPDP 1f48A 490 :RTKVLLVTLP T0333 308 :DQFQHTAR 1f48A 506 :EAANLQAD T0333 318 :VSRRGIG 1f48A 514 :LERAGIH T0333 325 :LV 1f48A 522 :WG T0333 327 :STSDKV 1f48A 535 :TRSPLL T0333 334 :ADLLRRL 1f48A 541 :RMRAQQE T0333 347 :RTAAREVREE 1f48A 548 :LPQIESVKRQ T0333 357 :MVALPTPAETVRRIV 1f48A 568 :LASEPTGIDKLKQLA Number of specific fragments extracted= 28 number of extra gaps= 0 total=3559 Number of alignments=175 # 1f48A read from 1f48A/merged-good-all-a2m # found chain 1f48A in template set T0333 2 :LFVSSPGI 1f48A 11 :LFFTGKGG T0333 10 :GHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAA 1f48A 20 :GKTSISCATAIRLAEQGKRVLLVSTDPASNVGQ T0333 43 :AGLEVVDVAPDYSAVKVFEQVAKDNP 1f48A 69 :PGLSALEIDPQAAAQQYRARIVDPIK T0333 78 :PAIDLEEWGVQ 1f48A 95 :GVLPDDVVSSI T0333 89 :IAAVNRPLVD 1f48A 120 :FDEFTGLLTD T0333 99 :GTMAL 1f48A 131 :SLLTR T0333 109 :PDLVVYEQGA 1f48A 136 :FDHIIFDTAP T0333 119 :TVGLLAAD 1f48A 147 :GHTIRLLQ T0333 136 :NQ 1f48A 155 :LP T0333 140 :WRTRGMHRSIASFLTD 1f48A 180 :EKQREQYAYAVEALSD T0333 156 :LMDKHQVSLPE 1f48A 198 :RTRLVLVARLQ T0333 167 :PVATIE 1f48A 211 :TLQEVA T0333 173 :SFP 1f48A 226 :GLK T0333 191 :WVPYGGGAVLGDRLPPVP 1f48A 229 :NQYLVINGVLPKTEAAND T0333 209 :ARPEVAITMGTIE 1f48A 325 :NEHGLIMLMGKGG T0333 223 :QAF 1f48A 338 :VGK T0333 228 :GAVEPIIAAAGEV 1f48A 341 :TTMAAAIAVRLAD T0333 241 :DADFVLALGDLDI 1f48A 355 :GFDVHLTTSDPAA T0333 254 :SPLGTLP 1f48A 437 :REAGKRF T0333 271 :LHTLLR 1f48A 481 :PMMLLQ T0333 277 :TCTAVVHHG 1f48A 490 :RTKVLLVTL T0333 286 :GGGTVMTAI 1f48A 500 :ETTPVLEAA T0333 313 :TAREAVSRRG 1f48A 509 :NLQADLERAG T0333 323 :IGLVSTS 1f48A 561 :RVALVPV T0333 330 :DKVD 1f48A 570 :SEPT T0333 334 :ADLLRRLI 1f48A 575 :IDKLKQLA Number of specific fragments extracted= 26 number of extra gaps= 0 total=3585 Number of alignments=176 # 1f48A read from 1f48A/merged-good-all-a2m # found chain 1f48A in template set Warning: unaligning (T0333)E185 because of BadResidue code BAD_PEPTIDE in next template residue (1f48A)P167 Warning: unaligning (T0333)G186 because of BadResidue code BAD_PEPTIDE at template residue (1f48A)P167 T0333 1 :MLFVSSPGIGHLFPLIQLAWGFRTAGHDVLIAV 1f48A 11 :LFFTGKGGVGKTSISCATAIRLAEQGKRVLLVS T0333 34 :AEHADRAAA 1f48A 47 :ASNVGQVFS T0333 43 :AGLEVVDVAPDYSAVKVF 1f48A 69 :PGLSALEIDPQAAAQQYR T0333 61 :EQVAKDNPRFAETVATRPAIDLEEWGVQIAAVNRPLVDGTMA 1f48A 88 :RIVDPIKGVLPDDVVSSINEQLSGACTTEIAAFDEFTGLLTD T0333 103 :LVD 1f48A 132 :LLT T0333 108 :RPDLVVYEQGAT 1f48A 135 :RFDHIIFDTAPT T0333 120 :VGLLAA 1f48A 149 :TIRLLQ T0333 174 :FPPSLLLEAEP 1f48A 155 :LPGAWSSFIDS T0333 187 :WFMRWVPYGGGA 1f48A 168 :EGASCLGPMAGL T0333 199 :VLGDRLPPVPARPEVAITMGTIE 1f48A 187 :AYAVEALSDPKRTRLVLVARLQK T0333 222 :LQAFGIGAVEPIIAA 1f48A 211 :TLQEVARTHLELAAI T0333 239 :EVDADFVLALGDLDISPL 1f48A 226 :GLKNQYLVINGVLPKTEA T0333 257 :GTLPRNV 1f48A 261 :ANLPADL T0333 267 :GWTPLHTLL 1f48A 311 :DIPSLSALV T0333 276 :RTCTAVVHHG 1f48A 325 :NEHGLIMLMG T0333 286 :GGGTVMTAI 1f48A 339 :GKTTMAAAI T0333 313 :TAREAVSRRGIGL 1f48A 348 :AVRLADMGFDVHL T0333 327 :STSDKVDADL 1f48A 384 :RIDPHEETER T0333 346 :LRTAA 1f48A 394 :YRQHV T0333 351 :REVREEMVALPTPAETV 1f48A 411 :KRLLEEDLRSPCTEEIA Number of specific fragments extracted= 20 number of extra gaps= 1 total=3605 Number of alignments=177 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l2lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l2lA expands to /projects/compbio/data/pdb/1l2l.pdb.gz 1l2lA:# T0333 read from 1l2lA/merged-good-all-a2m # 1l2lA read from 1l2lA/merged-good-all-a2m # adding 1l2lA to template set # found chain 1l2lA in template set Warning: unaligning (T0333)H160 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1l2lA)E175 Warning: unaligning (T0333)P165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1l2lA)E175 T0333 14 :PLIQLAWGFRTA 1l2lA 10 :LYEKALDKVEAS T0333 26 :GHD 1l2lA 24 :KVR T0333 29 :VLIAV 1l2lA 28 :VLLAY T0333 35 :EHADRAAAAG 1l2lA 46 :DLEKRIEKVG T0333 57 :VKVFEQVAKDNPRFAE 1l2lA 56 :KEEVLRYSEELPKEIE T0333 81 :DLEEWGVQIAAVNRP 1l2lA 72 :TIPQLLGSILWSIKR T0333 98 :DGTMALVDDYRPD 1l2lA 97 :REVREYMRKWGWD T0333 119 :TVGLLAADRA 1l2lA 115 :GQVGIMANLL T0333 129 :GVPAVQRNQSAW 1l2lA 129 :GIPVIAHVPQLS T0333 149 :IA 1l2lA 167 :PR T0333 159 :K 1l2lA 169 :E T0333 166 :EPVATIESFPPSLLLEAEPEGW 1l2lA 176 :DCIHYIYEFPRNFKVLDFEAPR T0333 200 :LG 1l2lA 225 :IA T0333 209 :ARPEVAITMGTIELQA 1l2lA 227 :KRSELAIISGLHPLTQ T0333 225 :FGIGAVEPIIAAAGEVDADFVLALGDLDISPLG 1l2lA 247 :KPIKLVREHLKILNDLGIRAHLEFAFTPDEVVR T0333 269 :TPLHTLLRTCTAVVHH 1l2lA 280 :LEIVKLLKHFYSVGLN T0333 334 :ADLLRRLI 1l2lA 296 :EVELASVV T0333 342 :GDESLRTAARE 1l2lA 307 :GEKELAERIIS T0333 358 :VALP 1l2lA 318 :KDPA T0333 363 :PAETVRRIVERI 1l2lA 322 :DPIAVIEGLLKL Number of specific fragments extracted= 20 number of extra gaps= 0 total=3625 Number of alignments=178 # 1l2lA read from 1l2lA/merged-good-all-a2m # found chain 1l2lA in template set T0333 13 :FPLIQLAWGFRTA 1l2lA 9 :SLYEKALDKVEAS T0333 26 :GHDVLIAVAEHA 1l2lA 24 :KVRGVLLAYNTN T0333 50 :VAPDYSAVKVFEQVAKDNP 1l2lA 41 :YLKREDLEKRIEKVGKEEV T0333 69 :RFAETVATRPAIDLEEWGVQIAAVNR 1l2lA 61 :RYSEELPKEIETIPQLLGSILWSIKR T0333 95 :PLVDGTMALVDDYRPD 1l2lA 94 :VVSREVREYMRKWGWD T0333 115 :EQGATVGLLAADRAGVPAVQRNQSA 1l2lA 115 :GQVGIMANLLGGVYGIPVIAHVPQL T0333 142 :TRGMHRSIASF 1l2lA 212 :LYVREEWIERF T0333 153 :LTDLMDKHQVS 1l2lA 225 :IAKRSELAIIS T0333 195 :GGGAVLGDR 1l2lA 236 :GLHPLTQEN T0333 223 :QAFGIGAVEPIIAAAGEVDADFVLALGDLDI 1l2lA 245 :HGKPIKLVREHLKILNDLGIRAHLEFAFTPD T0333 271 :LHTLLRTCTAVVHH 1l2lA 282 :IVKLLKHFYSVGLN T0333 306 :PR 1l2lA 296 :EV T0333 313 :TAREAVSRRGI 1l2lA 298 :ELASVVSVMGE T0333 344 :ESLRTAARE 1l2lA 309 :KELAERIIS T0333 358 :VALPTPAETVR 1l2lA 318 :KDPADPIAVIE T0333 369 :RIVERI 1l2lA 332 :KLIKET Number of specific fragments extracted= 16 number of extra gaps= 0 total=3641 Number of alignments=179 # 1l2lA read from 1l2lA/merged-good-all-a2m # found chain 1l2lA in template set Warning: unaligning (T0333)H160 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1l2lA)E175 Warning: unaligning (T0333)P165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1l2lA)E175 T0333 2 :LFVSSPG 1l2lA 28 :VLLAYNT T0333 28 :DVLIAV 1l2lA 35 :NIDAIK T0333 34 :AEHADRAAAAG 1l2lA 45 :EDLEKRIEKVG T0333 57 :VKVFEQVAKDNPRFAETV 1l2lA 56 :KEEVLRYSEELPKEIETI T0333 83 :EEWGVQIAAVNRPL 1l2lA 74 :PQLLGSILWSIKRG T0333 98 :DGTMALVDDYRPD 1l2lA 97 :REVREYMRKWGWD T0333 115 :EQGATVGLLAADRAGVPAVQR 1l2lA 115 :GQVGIMANLLGGVYGIPVIAH T0333 138 :SA 1l2lA 136 :VP T0333 141 :RTRGMHRSIASFLT 1l2lA 138 :QLSELQASLFLDGP T0333 155 :DLMDK 1l2lA 165 :IHPRE T0333 166 :EPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1l2lA 176 :DCIHYIYEFPRNFKVLDFEAPRENRFIGAADDY T0333 199 :VLGDRLPPVPARPEVAITMGTIE 1l2lA 217 :EWIERFEEIAKRSELAIISGLHP T0333 222 :LQAFGIGAVEPIIAAAGEVDADFVLALGDLDISPL 1l2lA 244 :NHGKPIKLVREHLKILNDLGIRAHLEFAFTPDEVV T0333 272 :HTLLRTCTAVVH 1l2lA 283 :VKLLKHFYSVGL T0333 329 :SDKVDADLL 1l2lA 295 :NEVELASVV T0333 339 :RLIGDESLRTAARE 1l2lA 304 :SVMGEKELAERIIS T0333 358 :VALPTPAETVR 1l2lA 318 :KDPADPIAVIE T0333 369 :RIVERIS 1l2lA 332 :KLIKETG Number of specific fragments extracted= 18 number of extra gaps= 0 total=3659 Number of alignments=180 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jbwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jbwA expands to /projects/compbio/data/pdb/1jbw.pdb.gz 1jbwA:Bad short name: CX for alphabet: pdb_atoms Bad short name: OQ1 for alphabet: pdb_atoms Bad short name: OQ2 for alphabet: pdb_atoms # T0333 read from 1jbwA/merged-good-all-a2m # 1jbwA read from 1jbwA/merged-good-all-a2m # adding 1jbwA to template set # found chain 1jbwA in template set Warning: unaligning (T0333)W268 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbwA)R386 T0333 3 :FVSSPGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAAA 1jbwA 42 :IHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNER T0333 57 :VKVFEQVAKDN 1jbwA 83 :IMIDHEPIPDA T0333 81 :DLEEWGVQIAAVNRPLVDG 1jbwA 94 :ALVNAVAFVRAALERLQQQ T0333 105 :DDYRPD 1jbwA 114 :ADFNVT T0333 117 :GATVGLLAADRAGVPAVQRNQSAW 1jbwA 124 :ITALAYWYFRQRQVDVAVIEVGIG T0333 141 :RTRGMHRSIASFLTD 1jbwA 280 :EWPLTPQNIRQGLAA T0333 167 :P 1jbwA 295 :S T0333 184 :PEGWFMRWVP 1jbwA 296 :HWPARLEKIS T0333 209 :ARPEVAITMGT 1jbwA 306 :DTPLIVIDGAH T0333 226 :GIGAVEPIIAAAGEV 1jbwA 317 :NPDGINGLITALKQL T0333 241 :DADFVLALGDLD 1jbwA 335 :PITVIAGILADK T0333 269 :T 1jbwA 387 :L T0333 270 :PLHTLLRT 1jbwA 390 :SWQEALAA T0333 278 :CTAVVHHG 1jbwA 405 :QPIVITGS T0333 306 :PR 1jbwA 413 :LY T0333 312 :HTAR 1jbwA 415 :LASA T0333 318 :VS 1jbwA 419 :VR Number of specific fragments extracted= 17 number of extra gaps= 0 total=3676 Number of alignments=181 # 1jbwA read from 1jbwA/merged-good-all-a2m # found chain 1jbwA in template set Warning: unaligning (T0333)F152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jbwA)A186 Warning: unaligning (T0333)T154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbwA)A186 Warning: unaligning (T0333)V358 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbwA)R386 T0333 3 :FVSSPGIGHLFPLIQLAWGFRTAGHDVLIAVAE 1jbwA 42 :IHVTGTNGKGSAANAIAHVLEASGLTVGLYTSP T0333 65 :KDNPRFAETVATRPAIDLEEWGVQIA 1jbwA 75 :FIMRFNERIMIDHEPIPDAALVNAVA T0333 99 :GTMALVDD 1jbwA 101 :FVRAALER T0333 107 :YRP 1jbwA 116 :FNV T0333 116 :QGATVGLLAADRAGVPAVQRNQSA 1jbwA 123 :FITALAYWYFRQRQVDVAVIEVGI T0333 140 :WRTRGMHRSIAS 1jbwA 172 :KLLGHTITAIAK T0333 155 :DLM 1jbwA 187 :GII T0333 158 :DKHQVSLPEPVATIE 1jbwA 194 :PVVTGNLVPDAAAVV T0333 173 :SF 1jbwA 216 :GS T0333 191 :WVPYGGGAVLGDRLPPVP 1jbwA 218 :QWLRFDRDFSVPKAKLHG T0333 209 :ARPEVAITMGTIE 1jbwA 306 :DTPLIVIDGAHNP T0333 225 :FGIGAVEPIIAAAGEVDADFVLALGDLDI 1jbwA 319 :DGINGLITALKQLFSQPITVIAGILADKD T0333 313 :TAREAVSR 1jbwA 350 :AMADRLTA T0333 321 :RGIGLVSTS 1jbwA 359 :FSTVYLVPV T0333 359 :ALPTPAETVRRIVE 1jbwA 387 :LKDSWQEALAASLN Number of specific fragments extracted= 15 number of extra gaps= 0 total=3691 Number of alignments=182 # 1jbwA read from 1jbwA/merged-good-all-a2m # found chain 1jbwA in template set Warning: unaligning (T0333)S329 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jbwA)R386 Warning: unaligning (T0333)V358 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbwA)R386 T0333 2 :LFVSSPGIGHLFPLIQLAWGFRTAGHDVLIAV 1jbwA 41 :YIHVTGTNGKGSAANAIAHVLEASGLTVGLYT T0333 52 :PDYSAVKVF 1jbwA 74 :PFIMRFNER T0333 83 :EEWGVQIAAVNRPLVDGTMALVDDYRPD 1jbwA 92 :DAALVNAVAFVRAALERLQQQQADFNVT T0333 116 :QGATVGLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLT 1jbwA 123 :FITALAYWYFRQRQVDVAVIEVGIGGDTDSTNVITPVVS T0333 155 :D 1jbwA 296 :H T0333 175 :PPSLLLEAEPEGWFMRWVPY 1jbwA 297 :WPARLEKISDTPLIVIDGAH T0333 226 :GIGAVEPIIAAAGEV 1jbwA 317 :NPDGINGLITALKQL T0333 241 :DADFVLALGD 1jbwA 335 :PITVIAGILA T0333 306 :PRDQFQHTAREAVSRRGIGLV 1jbwA 345 :DKDYAAMADRLTAAFSTVYLV T0333 327 :ST 1jbwA 368 :PG T0333 359 :ALPTPAETVRRIVE 1jbwA 387 :LKDSWQEALAASLN Number of specific fragments extracted= 11 number of extra gaps= 0 total=3702 Number of alignments=183 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c3oA expands to /projects/compbio/data/pdb/1c3o.pdb.gz 1c3oA:Skipped atom 275, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 277, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 279, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 281, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 283, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 285, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 287, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 591, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 593, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 595, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 597, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 599, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 2557, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 2559, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 2561, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 2563, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 5050, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 5052, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 5054, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 5056, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 5058, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 5060, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 5062, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7269, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7271, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7273, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7275, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7277, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7279, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7281, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7550, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7552, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7554, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7556, because occupancy 0.500 <= existing 0.500 in 1c3oA Skipped atom 7558, because occupancy 0.500 <= existing 0.500 in 1c3oA # T0333 read from 1c3oA/merged-good-all-a2m # 1c3oA read from 1c3oA/merged-good-all-a2m # adding 1c3oA to template set # found chain 1c3oA in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1c3oA)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1c3oA)D558 T0333 2 :LFVSSPGI 1c3oA 10 :ILILGAGP T0333 10 :GHL 1c3oA 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1c3oA 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEH 1c3oA 51 :PAT T0333 37 :ADR 1c3oA 58 :PEM T0333 45 :LEVVDVAP 1c3oA 61 :ADATYIEP T0333 94 :RPL 1c3oA 71 :WEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1c3oA 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1c3oA 112 :GVT T0333 135 :RNQSA 1c3oA 115 :MIGAT T0333 141 :RTRGMHRSIASFLTDL 1c3oA 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATIESFPPSLL 1c3oA 521 :DLHPVYKRVDTCAAE T0333 184 :PEGWFMRWVPYGGGAV 1c3oA 536 :FATDTAYMYSTYEEEC T0333 204 :LPPV 1c3oA 553 :ANPS T0333 210 :RPEVAITMGT 1c3oA 559 :REKIMVLGGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLALGDLD 1c3oA 572 :IGQGIEFDYCCVHASLALREDGYETIMVNCNPE T0333 275 :LRTCTAVVHHG 1c3oA 610 :YDTSDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1c3oA 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1c3oA 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1c3oA 647 :PLKLARA T0333 318 :VSRRGIG 1c3oA 654 :LEAAGVP T0333 325 :LVST 1c3oA 662 :IGTS T0333 334 :ADLLRRLIG 1c3oA 666 :PDAIDRAED T0333 347 :RTAAREVREE 1c3oA 675 :RERFQHAVER T0333 363 :PAETVRRIVERI 1c3oA 697 :AIEMAVEKAKEI Number of specific fragments extracted= 25 number of extra gaps= 1 total=3727 Number of alignments=184 # 1c3oA read from 1c3oA/merged-good-all-a2m # found chain 1c3oA in template set T0333 2 :LFVSSPGI 1c3oA 12 :ILGAGPIV T0333 10 :GHL 1c3oA 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAA 1c3oA 28 :YSGAQACKALREEGYRVILVNSNPATIMT T0333 67 :NPRFAETVATRPAI 1c3oA 57 :DPEMADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1c3oA 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1c3oA 112 :GVT T0333 135 :RNQSA 1c3oA 115 :MIGAT T0333 140 :WRTRGMHRSIASFLT 1c3oA 800 :TLSQEIQDVMRQQVQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=3735 Number of alignments=185 # 1c3oA read from 1c3oA/merged-good-all-a2m # found chain 1c3oA in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1c3oA)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1c3oA)D558 T0333 1 :MLFVSSPGI 1c3oA 10 :ILILGAGPI T0333 10 :GHL 1c3oA 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1c3oA 28 :YSGAQACKALREEGYRVILVN T0333 34 :A 1c3oA 51 :P T0333 45 :LEVVDVAPDY 1c3oA 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1c3oA 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1c3oA 112 :GV T0333 137 :QSAWRTRGMHRSIASFLT 1c3oA 114 :TMIGATADAIDKAEDRRR T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1c3oA 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 203 :RLPPV 1c3oA 552 :EANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPII 1c3oA 559 :REKIMVLGGGPNRIGQGIEFDYCCV T0333 235 :AAAGEVDADFVLALGD 1c3oA 587 :LALREDGYETIMVNCN T0333 251 :LDISPL 1c3oA 608 :TDYDTS T0333 279 :TAVVHHGGGGTVMTAIDAGIP 1c3oA 615 :RLYFEPVTLEDVLEIVRIEKP T0333 300 :QLLAP 1c3oA 637 :GVIVQ T0333 305 :DPRDQFQHTAREAVSRRGIGL 1c3oA 643 :GGQTPLKLARALEAAGVPVIG T0333 329 :SD 1c3oA 665 :SP T0333 335 :DLLRRLIGDESLRTAAREV 1c3oA 667 :DAIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1c3oA 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 19 number of extra gaps= 1 total=3754 Number of alignments=186 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c3oC/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c3oC expands to /projects/compbio/data/pdb/1c3o.pdb.gz 1c3oC:Skipped atom 11156, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 11158, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 11160, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 11162, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 11164, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 11315, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 11317, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14278, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14280, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14282, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14284, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14286, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14853, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14855, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14857, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14859, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14861, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14863, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 14865, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 15096, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 15098, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 15100, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 15102, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 15104, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 17255, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 17257, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 17259, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 17261, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 17263, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 18626, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 18628, because occupancy 0.500 <= existing 0.500 in 1c3oC Skipped atom 18630, because occupancy 0.500 <= existing 0.500 in 1c3oC # T0333 read from 1c3oC/merged-good-all-a2m # 1c3oC read from 1c3oC/merged-good-all-a2m # adding 1c3oC to template set # found chain 1c3oC in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1c3oC)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1c3oC)D558 T0333 2 :LFVSSPGI 1c3oC 10 :ILILGAGP T0333 10 :GHL 1c3oC 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAV 1c3oC 28 :YSGAQACKALREEGYRVILVN T0333 34 :AEHADRAAAA 1c3oC 51 :PATIMTDPEM T0333 45 :LEVVDVAP 1c3oC 61 :ADATYIEP T0333 93 :NRPL 1c3oC 70 :HWEV T0333 100 :TMALVDDYRPDLVVYEQGATVGLLAADRA 1c3oC 74 :VRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1c3oC 112 :GVT T0333 136 :NQSAW 1c3oC 115 :MIGAT T0333 141 :RTRGMHRSIASFLTDL 1c3oC 505 :LAGVREAEIRKLRDQY T0333 165 :PEPVATIESFPPSLL 1c3oC 521 :DLHPVYKRVDTCAAE T0333 184 :PEGWFMRWVPYGGGAV 1c3oC 536 :FATDTAYMYSTYEEEC T0333 204 :LPPV 1c3oC 553 :ANPS T0333 210 :RPEVAITMGT 1c3oC 559 :REKIMVLGGG T0333 220 :IELQAFGIGAVEPIIAAAGEVDADFVLALGDLD 1c3oC 572 :IGQGIEFDYCCVHASLALREDGYETIMVNCNPE T0333 275 :LRTCTAVVHHG 1c3oC 610 :YDTSDRLYFEP T0333 286 :GGGTVMTAIDAGIP 1c3oC 622 :TLEDVLEIVRIEKP T0333 300 :QLLAPDPRD 1c3oC 637 :GVIVQYGGQ T0333 309 :QFQHTAR 1c3oC 647 :PLKLARA T0333 318 :VSRRGIG 1c3oC 654 :LEAAGVP T0333 325 :LVST 1c3oC 662 :IGTS T0333 334 :ADLLRRLIG 1c3oC 666 :PDAIDRAED T0333 347 :RTAAREVREE 1c3oC 675 :RERFQHAVER T0333 363 :PAETVRRIVERI 1c3oC 697 :AIEMAVEKAKEI Number of specific fragments extracted= 24 number of extra gaps= 1 total=3778 Number of alignments=187 # 1c3oC read from 1c3oC/merged-good-all-a2m # found chain 1c3oC in template set T0333 2 :LFVSSPGI 1c3oC 12 :ILGAGPIV T0333 10 :GHL 1c3oC 21 :GQA T0333 13 :FPLIQLAWGFRTAGHDVLIAVAEHADRAAAAG 1c3oC 28 :YSGAQACKALREEGYRVILVNSNPATIMTDPE T0333 45 :LEVVDVAPDY 1c3oC 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1c3oC 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GVP 1c3oC 112 :GVT T0333 135 :RNQSA 1c3oC 115 :MIGAT T0333 140 :WRTRGMHRSIASFLTDLM 1c3oC 800 :TLSQEIQDVMRQQVQKLA T0333 168 :VATI 1c3oC 874 :LAEQ T0333 173 :SFPPSLLL 1c3oC 878 :GVTKEVIP T0333 186 :GWFMRWVPYGGGAVLGDRLPPVP 1c3oC 886 :PYYSVKEVVLPFNKFPGVDPLLG T0333 209 :ARPEVAITM 1c3oC 941 :KHGRALLSV T0333 223 :QAFGIGAVEPIIAAAGEVDADFVL 1c3oC 950 :REGDKERVVDLAAKLLKQGFELDA T0333 255 :PLG 1c3oC 983 :EAG T0333 261 :RNVRAVGWT 1c3oC 986 :INPRLVNKV T0333 271 :LHTLLR 1c3oC 1001 :IQDRIK T0333 277 :TCTAVVHHG 1c3oC 1009 :EYTYIINTT T0333 286 :GGGTVMTAIDAGIPQ 1c3oC 1026 :SRVIRRSALQYKVHY Number of specific fragments extracted= 18 number of extra gaps= 0 total=3796 Number of alignments=188 # 1c3oC read from 1c3oC/merged-good-all-a2m # found chain 1c3oC in template set Warning: unaligning (T0333)P208 because of BadResidue code BAD_PEPTIDE in next template residue (1c3oC)D558 Warning: unaligning (T0333)A209 because of BadResidue code BAD_PEPTIDE at template residue (1c3oC)D558 T0333 1 :MLFVSSPGI 1c3oC 10 :ILILGAGPI T0333 10 :GH 1c3oC 21 :GQ T0333 12 :LFPLIQLAWGFRTAGHDVLIAV 1c3oC 27 :DYSGAQACKALREEGYRVILVN T0333 34 :AEHA 1c3oC 51 :PATI T0333 45 :LEVVDVAPDY 1c3oC 61 :ADATYIEPIH T0333 97 :VDGTMALVDDYRPDLVVYEQGATVGLLAADRA 1c3oC 71 :WEVVRKIIEKERPDAVLPTMGGQTALNCALEL T0333 129 :GV 1c3oC 112 :GV T0333 136 :NQ 1c3oC 114 :TM T0333 139 :AWRTRGMHRSIASFLT 1c3oC 116 :IGATADAIDKAEDRRR T0333 155 :DLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGA 1c3oC 508 :VREAEIRKLRDQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEEC T0333 204 :LPPV 1c3oC 553 :ANPS T0333 210 :RPEVAITMGTIELQAFGIGAVEPII 1c3oC 559 :REKIMVLGGGPNRIGQGIEFDYCCV T0333 235 :AAAGEVDADFVLALGD 1c3oC 587 :LALREDGYETIMVNCN T0333 251 :LDISPL 1c3oC 608 :TDYDTS T0333 262 :NVRAVGWTPLHTLL 1c3oC 614 :DRLYFEPVTLEDVL T0333 276 :RTCTAVVHHGGGGTVM 1c3oC 633 :EKPKGVIVQYGGQTPL T0333 311 :QHTAREAVSRRGIGL 1c3oC 649 :KLARALEAAGVPVIG T0333 329 :SD 1c3oC 665 :SP T0333 335 :DLLRRLIGDESLRTAAREV 1c3oC 667 :DAIDRAEDRERFQHAVERL T0333 360 :LPTPAETVRRIVER 1c3oC 695 :VTAIEMAVEKAKEI Number of specific fragments extracted= 20 number of extra gaps= 1 total=3816 Number of alignments=189 # command:Using radius: 8.0000 Alignment mode NUMB_ALIGNS: 189 Adding 16664 constraints to all.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all.constraints maxweight: 1.0000 Optimizing... Probability sum: -657.5819, CN propb: -657.5819 weights: 0.1120 constraints: 2058 # command:Found ConstraintSet # PrintContacts align.constraints_v3 Number of constraints in align.constraints 2058 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_v3 Number of constraints in align.constraints.bonus 2058 # command:Found ConstraintSet # PrintContacts rejected.constraints_v3 Number of constraints in rejected.constraints 14606 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_v3 Number of constraints in rejected.constraints.bonus 14606 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_v3 Number of constraints in noncontact.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_v3 Number of constraints in noncontact.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_v3 Number of constraints in all.constraints 16664 # command: