# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0321/ # command:# Making conformation for sequence T0321 numbered 1 through 251 Created new target T0321 from T0321.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0321/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0321//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0321/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0321//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0321/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0321/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0321/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wwkA expands to /projects/compbio/data/pdb/1wwk.pdb.gz 1wwkA:# T0321 read from 1wwkA/merged-good-all-a2m # 1wwkA read from 1wwkA/merged-good-all-a2m # adding 1wwkA to template set # found chain 1wwkA in template set T0321 6 :DAMINGIPE 1wwkA 55 :RRVIESAPK # choosing archetypes in rotamer library T0321 16 :FL 1wwkA 64 :LK T0321 21 :LVCGTT 1wwkA 66 :VIARAG T0321 45 :ETRMPMLTQ 1wwkA 86 :GIEVVNAPA T0321 67 :VKSWNYVEASIGLA 1wwkA 95 :ASSRSVAELAVGLM T0321 83 :NAYYNNP 1wwkA 109 :FSVARKI T0321 90 :QVAREHGVIFSDAKRVE 1wwkA 119 :DRKMREGVWAKKEAMGI T0321 119 :EVKGKKVGVVGHFP 1wwkA 136 :ELEGKTIGIIGFGR T0321 133 :HLESLLEPICDLSILEWSPE 1wwkA 154 :VAKIANALGMNILLYDPYPN T0321 153 :EG 1wwkA 181 :NG T0321 155 :DYPLP 1wwkA 184 :FVDLE T0321 163 :FILPECDYVYI 1wwkA 189 :TLLKESDVVTI T0321 178 :VVD 1wwkA 210 :LIN T0321 184 :PRLLELSRNAR 1wwkA 213 :EERLKLMKKTA T0321 197 :TLVGPGTPL 1wwkA 224 :ILINTSRGP T0321 222 :VKDNARAFRIVAGA 1wwkA 233 :VVDTNALVKALKEG Number of specific fragments extracted= 16 number of extra gaps= 0 total=16 Number of alignments=1 # 1wwkA read from 1wwkA/merged-good-all-a2m # found chain 1wwkA in template set T0321 6 :DAMINGIPE 1wwkA 55 :RRVIESAPK T0321 16 :FL 1wwkA 64 :LK T0321 21 :LVCGTT 1wwkA 66 :VIARAG T0321 42 :RPF 1wwkA 73 :GLD T0321 49 :PMLTQ 1wwkA 90 :VNAPA T0321 67 :VKSWNYVEASIGLA 1wwkA 95 :ASSRSVAELAVGLM T0321 83 :NAYYNNP 1wwkA 109 :FSVARKI T0321 90 :QVAREHGVIFSDAKRVE 1wwkA 119 :DRKMREGVWAKKEAMGI T0321 119 :EVKGKKVGVVGHFP 1wwkA 136 :ELEGKTIGIIGFGR T0321 133 :HLESLLEPICDLSILEWSPE 1wwkA 154 :VAKIANALGMNILLYDPYPN T0321 153 :EG 1wwkA 181 :NG T0321 155 :DYPLP 1wwkA 184 :FVDLE T0321 163 :FILPECDYVYI 1wwkA 189 :TLLKESDVVTI T0321 178 :VVD 1wwkA 210 :LIN T0321 184 :PRLLELSRNAR 1wwkA 213 :EERLKLMKKTA T0321 197 :TLVGPGTPL 1wwkA 224 :ILINTSRGP T0321 222 :VKDNARAFRIVAGA 1wwkA 233 :VVDTNALVKALKEG Number of specific fragments extracted= 17 number of extra gaps= 0 total=33 Number of alignments=2 # 1wwkA read from 1wwkA/merged-good-all-a2m # found chain 1wwkA in template set T0321 3 :EIYDAMING 1wwkA 33 :DRLVELVKD T0321 18 :VDELVCG 1wwkA 42 :VEAIIVR T0321 40 :PNRPF 1wwkA 49 :SKPKV T0321 46 :TR 1wwkA 71 :GV T0321 54 :NLLGLPLRVAAGC 1wwkA 73 :GLDNIDVEAAKEK T0321 67 :VKSWNYVEASIGLAA 1wwkA 95 :ASSRSVAELAVGLMF T0321 84 :AYYN 1wwkA 110 :SVAR T0321 88 :NPQVAREHGVIFSDAKRVE 1wwkA 117 :FADRKMREGVWAKKEAMGI T0321 119 :EVKGKKVGVVGHFPH 1wwkA 136 :ELEGKTIGIIGFGRI T0321 134 :LESLLEP 1wwkA 154 :VAKIANA T0321 142 :CDLSILEWSPE 1wwkA 161 :LGMNILLYDPY T0321 154 :GDYPL 1wwkA 183 :KFVDL T0321 162 :EFILPECDYVYI 1wwkA 188 :ETLLKESDVVTI T0321 184 :PRLLELSRNAR 1wwkA 213 :EERLKLMKKTA T0321 196 :ITLVGPGTPL 1wwkA 224 :ILINTSRGPV T0321 223 :KDNARAFRIVAGA 1wwkA 234 :VDTNALVKALKEG Number of specific fragments extracted= 16 number of extra gaps= 0 total=49 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sc6A expands to /projects/compbio/data/pdb/1sc6.pdb.gz 1sc6A:Skipped atom 1168, because occupancy 0.5 <= existing 0.500 in 1sc6A Skipped atom 1170, because occupancy 0.500 <= existing 0.500 in 1sc6A Skipped atom 1172, because occupancy 0.500 <= existing 0.500 in 1sc6A Skipped atom 1174, because occupancy 0.500 <= existing 0.500 in 1sc6A Skipped atom 1176, because occupancy 0.500 <= existing 0.500 in 1sc6A Skipped atom 1178, because occupancy 0.500 <= existing 0.500 in 1sc6A Skipped atom 1180, because occupancy 0.500 <= existing 0.500 in 1sc6A Skipped atom 1182, because occupancy 0.500 <= existing 0.500 in 1sc6A Skipped atom 1184, because occupancy 0.500 <= existing 0.500 in 1sc6A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0321 read from 1sc6A/merged-good-all-a2m # 1sc6A read from 1sc6A/merged-good-all-a2m # adding 1sc6A to template set # found chain 1sc6A in template set Warning: unaligning (T0321)D111 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sc6A)S146 Warning: unaligning (T0321)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sc6A)S146 Warning: unaligning (T0321)M221 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sc6A)D275 T0321 60 :LRVAAG 1sc6A 120 :LLLLLR T0321 70 :WNYVEAS 1sc6A 126 :GVPEANA T0321 105 :VEDRMN 1sc6A 134 :AHRGVG T0321 118 :NEVKGKKVGVVGHFP 1sc6A 147 :FEARGKKLGIIGYGH T0321 133 :HLESLLEPICDLSILEWSPE 1sc6A 166 :LGILAESLGMYVYFYDIENK T0321 153 :EGDYPLPASEFILPE 1sc6A 218 :KNMMGAKEISLMKPG T0321 170 :YVYITCA 1sc6A 233 :SLLINAS T0321 177 :SVVD 1sc6A 242 :TVVD T0321 183 :LPRLLELS 1sc6A 246 :IPALADAL T0321 210 :FEHGLQELSGF 1sc6A 254 :ASKHLAGAAID Number of specific fragments extracted= 10 number of extra gaps= 0 total=59 Number of alignments=4 # 1sc6A read from 1sc6A/merged-good-all-a2m # found chain 1sc6A in template set Warning: unaligning (T0321)D111 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sc6A)S146 Warning: unaligning (T0321)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sc6A)S146 Warning: unaligning (T0321)M221 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sc6A)D275 T0321 62 :VAAGCVKS 1sc6A 111 :SVAELVIG T0321 81 :AINAYYNNP 1sc6A 119 :ELLLLLRGV T0321 92 :A 1sc6A 128 :P T0321 101 :DAKRVEDR 1sc6A 129 :EANAKAHR T0321 109 :MN 1sc6A 138 :VG T0321 118 :NEVKGKKVGVVGHFP 1sc6A 147 :FEARGKKLGIIGYGH T0321 133 :HLESLLEPICDLSILEWSPEEGDYP 1sc6A 166 :LGILAESLGMYVYFYDIENKLPLGN T0321 158 :LPASEFILPECDYVYI 1sc6A 194 :VQHLSDLLNMSDVVSL T0321 183 :LPR 1sc6A 223 :AKE T0321 187 :LELSRNA 1sc6A 226 :ISLMKPG T0321 196 :ITLVGPGTP 1sc6A 233 :SLLINASRG T0321 205 :LAPV 1sc6A 248 :ALAD T0321 209 :LFEHGLQELSGF 1sc6A 253 :LASKHLAGAAID Number of specific fragments extracted= 13 number of extra gaps= 0 total=72 Number of alignments=5 # 1sc6A read from 1sc6A/merged-good-all-a2m # found chain 1sc6A in template set Warning: unaligning (T0321)D111 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sc6A)S146 Warning: unaligning (T0321)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sc6A)S146 T0321 61 :RVAAGCVKSWNYV 1sc6A 110 :RSVAELVIGELLL T0321 84 :AYYNNPQVAR 1sc6A 123 :LLRGVPEANA T0321 104 :RVEDRMN 1sc6A 133 :KAHRGVG T0321 118 :NEVKGKKVGVVGHFPHLESLLE 1sc6A 147 :FEARGKKLGIIGYGHIGTQLGI T0321 140 :PICDLSILEWSPEEGDYPLP 1sc6A 171 :ESLGMYVYFYDIENKLPLGN T0321 160 :ASEFILPECDYVYI 1sc6A 196 :HLSDLLNMSDVVSL T0321 184 :PRLLELSRNAR 1sc6A 223 :AKEISLMKPGS T0321 197 :TLVGPGTPL 1sc6A 234 :LLINASRGT T0321 222 :VKDNARAFRIVAG 1sc6A 243 :VVDIPALADALAS Number of specific fragments extracted= 9 number of extra gaps= 0 total=81 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yqdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yqdA expands to /projects/compbio/data/pdb/1yqd.pdb.gz 1yqdA:# T0321 read from 1yqdA/merged-good-all-a2m # 1yqdA read from 1yqdA/merged-good-all-a2m # adding 1yqdA to template set # found chain 1yqdA in template set T0321 13 :PEDFL 1yqdA 129 :HDGTI T0321 18 :VDELVCGTTHSVIRSGN 1yqdA 139 :SNHMVANERYIIRFPDN T0321 41 :NRPFETRM 1yqdA 156 :MPLDGGAP T0321 63 :AA 1yqdA 165 :LC T0321 77 :IGL 1yqdA 167 :AGI T0321 81 :AINAYYNNPQVAR 1yqdA 170 :TVYSPLKYFGLDE T0321 121 :KGKKVGVVGHF 1yqdA 183 :PGKHIGIVGLG T0321 134 :L 1yqdA 198 :V T0321 137 :LLEPICDLSILEWSPE 1yqdA 203 :AKAFGSKVTVISTSPS T0321 154 :GDYPLPASEFILPECDYVYITCA 1yqdA 234 :VSRDQEQMQAAAGTLDGIIDTVS T0321 183 :LPRLLELSRNARRITLVGPGTP 1yqdA 261 :LLPLFGLLKSHGKLILVGAPEK T0321 206 :APVLFEHGL 1yqdA 288 :AFSLIAGRK T0321 216 :ELSGFMVKDNARAFRIVAGA 1yqdA 297 :IVAGSGIGGMKETQEMIDFA Number of specific fragments extracted= 13 number of extra gaps= 0 total=94 Number of alignments=7 # 1yqdA read from 1yqdA/merged-good-all-a2m # found chain 1yqdA in template set T0321 12 :IPEDFLV 1yqdA 128 :YHDGTIT T0321 49 :PMLTQ 1yqdA 153 :PDNMP T0321 55 :LLG 1yqdA 158 :LDG T0321 63 :AAGCVK 1yqdA 161 :GAPLLC T0321 78 :GLAAINAYYNNPQVAR 1yqdA 167 :AGITVYSPLKYFGLDE T0321 121 :KGKKVGVVGHF 1yqdA 183 :PGKHIGIVGLG T0321 135 :ESLLEPICDLSILEWSPE 1yqdA 201 :KFAKAFGSKVTVISTSPS T0321 154 :GDYPLPASEFILPECDYVYITCA 1yqdA 234 :VSRDQEQMQAAAGTLDGIIDTVS T0321 183 :LPRLLELSRNARRITLVGPGTP 1yqdA 261 :LLPLFGLLKSHGKLILVGAPEK T0321 205 :LAPVLFEHGL 1yqdA 287 :PAFSLIAGRK T0321 216 :ELSGFMVKDNARAFRIVAGA 1yqdA 297 :IVAGSGIGGMKETQEMIDFA Number of specific fragments extracted= 11 number of extra gaps= 0 total=105 Number of alignments=8 # 1yqdA read from 1yqdA/merged-good-all-a2m # found chain 1yqdA in template set T0321 76 :SIGLAAINAYYN 1yqdA 194 :GLGHVAVKFAKA T0321 121 :KGKKVGVVGHFPHLESLLEPICDLSILEWSP 1yqdA 206 :FGSKVTVISTSPSKKEEALKNFGADSFLVSR T0321 157 :PLPASEFILPECDYVYITCA 1yqdA 237 :DQEQMQAAAGTLDGIIDTVS T0321 182 :TLPRLLELSRNARRITLVGPGTPL 1yqdA 260 :PLLPLFGLLKSHGKLILVGAPEKP T0321 206 :APVLF 1yqdA 287 :PAFSL T0321 211 :EHGL 1yqdA 293 :AGRK T0321 216 :ELSGFMVKDNARAFRIVAGA 1yqdA 297 :IVAGSGIGGMKETQEMIDFA Number of specific fragments extracted= 7 number of extra gaps= 0 total=112 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sjdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sjdA expands to /projects/compbio/data/pdb/1sjd.pdb.gz 1sjdA:# T0321 read from 1sjdA/merged-good-all-a2m # 1sjdA read from 1sjdA/merged-good-all-a2m # adding 1sjdA to template set # found chain 1sjdA in template set T0321 23 :CGTTHSVIRSGNGVGLG 1sjdA 29 :RELLLLRAVTPAGEGWG T0321 40 :PNRPFETRM 1sjdA 47 :CVTMAGPLY T0321 54 :NLLGLPLRVAAGCVKSWN 1sjdA 77 :AAEDITAAKVTPLLAKFK T0321 72 :YVEASIGLAAINAYYNNPQ 1sjdA 98 :MAKGALEMAVLDAELRAHE T0321 110 :NDPFIMSQNEVKG 1sjdA 117 :RSFAAELGSVRDS T0321 125 :VGVVGHF 1sjdA 133 :GVSVGIM T0321 132 :P 1sjdA 143 :P T0321 133 :HLESLLEPICDLSILEWSPEEG 1sjdA 148 :VVGGYLDEGYVRIKLKIEPGWD T0321 181 :KTLPRLLELSRNARRITLVGPGTP 1sjdA 171 :EPVRAVRERFGDDVLLQVDANTAY T0321 205 :LAPVLF 1sjdA 198 :DAPQLA T0321 211 :EHGLQELSGFM 1sjdA 207 :PFGLLLIEQPL T0321 222 :VKDNARAFRIVAG 1sjdA 219 :EEDVLGHAELARR Number of specific fragments extracted= 12 number of extra gaps= 0 total=124 Number of alignments=10 # 1sjdA read from 1sjdA/merged-good-all-a2m # found chain 1sjdA in template set T0321 23 :CGTTHSVIRSGNGVGLG 1sjdA 29 :RELLLLRAVTPAGEGWG T0321 40 :PNRPFETRM 1sjdA 47 :CVTMAGPLY T0321 54 :NLLGLPLRVAAGCVK 1sjdA 77 :AAEDITAAKVTPLLA T0321 69 :SWNYVEASIGLAAINAYYNNPQVA 1sjdA 95 :GHRMAKGALEMAVLDAELRAHERS T0321 93 :RE 1sjdA 127 :RD T0321 95 :HGVIFSDAKRVEDRMNDPFI 1sjdA 135 :SVGIMDTIPQLLDVVGGYLD T0321 115 :MSQNEVKGKKVGVVGHF 1sjdA 176 :VRERFGDDVLLQVDANT T0321 132 :PHLESLLEPICDLSILEWSPE 1sjdA 200 :PQLARLDPFGLLLIEQPLEEE T0321 157 :PLPASEFILPECDYVYITCASVV 1sjdA 221 :DVLGHAELARRIQTPICLDESIV T0321 182 :TLPRLLELSR 1sjdA 244 :SARAAADAIK T0321 192 :NARRITLVGPGTP 1sjdA 255 :GAVQIVNIKPGRV T0321 205 :LAPVLFEHGLQELSGFMV 1sjdA 276 :VHDVCAAHGIPVWCGGMI Number of specific fragments extracted= 12 number of extra gaps= 0 total=136 Number of alignments=11 # 1sjdA read from 1sjdA/merged-good-all-a2m # found chain 1sjdA in template set T0321 24 :GTTHSVIRSGNGVGLGPNRPF 1sjdA 30 :ELLLLRAVTPAGEGWGECVTM T0321 45 :ETRMPMLTQ 1sjdA 52 :GPLYSSEYN T0321 55 :LLGLPLRVAAGCVK 1sjdA 78 :AEDITAAKVTPLLA T0321 69 :SWNYVEASIGLAAINAYYNNP 1sjdA 95 :GHRMAKGALEMAVLDAELRAH T0321 110 :NDPFIMSQNEVKGK 1sjdA 116 :ERSFAAELGSVRDS T0321 125 :VGVVGHFPH 1sjdA 133 :GVSVGIMDT T0321 134 :LESLLEPICDLSILEWSPE 1sjdA 149 :VGGYLDEGYVRIKLKIEPG T0321 181 :KTLPRLLELSRNARRITLVGPGTPL 1sjdA 171 :EPVRAVRERFGDDVLLQVDANTAYT T0321 206 :APVLF 1sjdA 199 :APQLA T0321 211 :EHGLQELSGFM 1sjdA 207 :PFGLLLIEQPL T0321 222 :VKDNARAFRIVAG 1sjdA 219 :EEDVLGHAELARR Number of specific fragments extracted= 11 number of extra gaps= 0 total=147 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cdcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cdcA expands to /projects/compbio/data/pdb/2cdc.pdb.gz 2cdcA:Skipped atom 38, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 40, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 148, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 150, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 152, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 154, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 156, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 246, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 248, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 256, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 258, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 260, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 262, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 277, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 279, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 281, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 283, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 364, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 366, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 368, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 370, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 507, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 509, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 511, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 548, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 550, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 552, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 554, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 556, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 558, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 560, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 562, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 600, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 602, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 604, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 606, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 706, because occupancy 0.700 <= existing 0.750 in 2cdcA Skipped atom 708, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 710, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 747, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 749, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 751, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 753, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 858, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 860, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 862, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 864, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 883, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 885, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 887, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 889, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 891, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 893, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 895, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 897, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 899, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 901, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1282, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 1284, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 1286, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 1288, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 1290, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 1474, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1476, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1478, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1480, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1482, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1484, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1486, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1488, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1490, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1492, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1494, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1496, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1498, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1500, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1502, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1504, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1506, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1508, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1510, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1512, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1514, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1516, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1668, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1670, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 1950, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 2022, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2024, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2026, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2028, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2030, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2032, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2034, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2036, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2038, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2040, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2042, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2044, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2046, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2048, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2050, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2052, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2054, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2056, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2058, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2060, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2062, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2164, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2166, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2168, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2170, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2292, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2294, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2296, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2298, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2340, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2342, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2344, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2346, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2348, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2354, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2356, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2358, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2360, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2362, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2412, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 2418, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2420, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2422, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2436, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2438, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2440, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2442, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2534, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 2536, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 2538, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 2540, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 2542, because occupancy 0.400 <= existing 0.600 in 2cdcA Skipped atom 2627, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2629, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2631, because occupancy 0.300 <= existing 0.700 in 2cdcA Skipped atom 2760, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2762, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2764, because occupancy 0.500 <= existing 0.500 in 2cdcA Skipped atom 2766, because occupancy 0.500 <= existing 0.500 in 2cdcA # T0321 read from 2cdcA/merged-good-all-a2m # 2cdcA read from 2cdcA/merged-good-all-a2m # adding 2cdcA to template set # found chain 2cdcA in template set Warning: unaligning (T0321)P13 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2cdcA)G58 Warning: unaligning (T0321)F131 because of BadResidue code BAD_PEPTIDE in next template residue (2cdcA)P191 Warning: unaligning (T0321)P132 because of BadResidue code BAD_PEPTIDE at template residue (2cdcA)P191 T0321 6 :DAMINGI 2cdcA 43 :REIVNGK T0321 20 :ELVCGTTHSVIR 2cdcA 61 :FLVLGHEAIGVV T0321 32 :SGNGVGLG 2cdcA 80 :SQGDLVMP T0321 40 :PNRPF 2cdcA 90 :RRGCG T0321 49 :PML 2cdcA 132 :PKY T0321 52 :TQNLLGL 2cdcA 139 :PKSIEDI T0321 60 :LRVAAGCVKSWNY 2cdcA 149 :AQPLADIEKSIEE T0321 85 :YYNNPQVA 2cdcA 162 :ILEVQKRV T0321 96 :GVIFSDAKR 2cdcA 170 :PVWTCDDGT T0321 120 :VKGKKVGVVGH 2cdcA 179 :LNCRKVLVVGT T0321 133 :HL 2cdcA 192 :IG T0321 137 :LLEPICDLSILEWSPE 2cdcA 200 :FRTYGLEVWMANRREP T0321 155 :DYPLPASEFILPECDYVYI 2cdcA 234 :SNGYDKLKDSVGKFDVIID T0321 185 :RLLELSRNAR 2cdcA 259 :NILGNVIPLL T0321 195 :RITLVGPGTPL 2cdcA 273 :VLGLFGFSTSG T0321 206 :APVLFEHG 2cdcA 292 :LQEIVHTN T0321 225 :NARAFRIVA 2cdcA 310 :KPHFQQAVV Number of specific fragments extracted= 17 number of extra gaps= 1 total=164 Number of alignments=13 # 2cdcA read from 2cdcA/merged-good-all-a2m # found chain 2cdcA in template set Warning: unaligning (T0321)F16 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2cdcA)G58 Warning: unaligning (T0321)F131 because of BadResidue code BAD_PEPTIDE in next template residue (2cdcA)P191 Warning: unaligning (T0321)P132 because of BadResidue code BAD_PEPTIDE at template residue (2cdcA)P191 T0321 8 :MINGIPED 2cdcA 42 :DREIVNGK T0321 20 :ELVCGTTHSVIR 2cdcA 61 :FLVLGHEAIGVV T0321 32 :SGNGVGLG 2cdcA 80 :SQGDLVMP T0321 40 :PNRPF 2cdcA 90 :RRGCG T0321 52 :TQNLLGL 2cdcA 139 :PKSIEDI T0321 60 :LRVAAGCV 2cdcA 149 :AQPLADIE T0321 83 :NAYYNNPQVAREHGVIFSDAKRV 2cdcA 157 :KSIEEILEVQKRVPVWTCDDGTL T0321 121 :KGKKVGVVGH 2cdcA 180 :NCRKVLVVGT T0321 133 :HL 2cdcA 192 :IG T0321 137 :LLEPICDLSILEWSPE 2cdcA 200 :FRTYGLEVWMANRREP T0321 155 :DYPLPASEFILPECDYVYI 2cdcA 234 :SNGYDKLKDSVGKFDVIID T0321 185 :RLLELSRNAR 2cdcA 259 :NILGNVIPLL T0321 195 :RITLVGPGTP 2cdcA 273 :VLGLFGFSTS T0321 205 :LAPVLFEHG 2cdcA 291 :TLQEIVHTN Number of specific fragments extracted= 14 number of extra gaps= 1 total=178 Number of alignments=14 # 2cdcA read from 2cdcA/merged-good-all-a2m # found chain 2cdcA in template set Warning: unaligning (T0321)F131 because of BadResidue code BAD_PEPTIDE in next template residue (2cdcA)P191 Warning: unaligning (T0321)P132 because of BadResidue code BAD_PEPTIDE at template residue (2cdcA)P191 Warning: unaligning (T0321)M221 because of BadResidue code BAD_PEPTIDE in next template residue (2cdcA)N307 Warning: unaligning (T0321)V222 because of BadResidue code BAD_PEPTIDE at template residue (2cdcA)N307 T0321 52 :TQNLLGL 2cdcA 139 :PKSIEDI T0321 60 :LRVAAGCVKSWNYVEAS 2cdcA 149 :AQPLADIEKSIEEILEV T0321 92 :AREHGVIFSDA 2cdcA 166 :QKRVPVWTCDD T0321 118 :NEVKGKKVGVVGH 2cdcA 177 :GTLNCRKVLVVGT T0321 133 :H 2cdcA 192 :I T0321 134 :LE 2cdcA 199 :LF T0321 138 :LEPICDLSILEWSPE 2cdcA 201 :RTYGLEVWMANRREP T0321 153 :EGDY 2cdcA 234 :SNGY T0321 159 :PASEFILPECDYVYI 2cdcA 238 :DKLKDSVGKFDVIID T0321 175 :CA 2cdcA 253 :AT T0321 181 :KTLPRLLELSRNARRITLVGPGTPL 2cdcA 259 :NILGNVIPLLGRNGVLGLFGFSTSG T0321 206 :APVLFEHGLQELSG 2cdcA 292 :LQEIVHTNKTIIGL T0321 223 :KDNARAFRIVA 2cdcA 308 :GQKPHFQQAVV Number of specific fragments extracted= 13 number of extra gaps= 2 total=191 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y0eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y0eA expands to /projects/compbio/data/pdb/1y0e.pdb.gz 1y0eA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0321 read from 1y0eA/merged-good-all-a2m # 1y0eA read from 1y0eA/merged-good-all-a2m # adding 1y0eA to template set # found chain 1y0eA in template set Warning: unaligning (T0321)C175 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y0eA)T96 Warning: unaligning (T0321)A176 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y0eA)T96 T0321 112 :PFIMSQNEV 1y0eA 24 :MSKMALAAY T0321 121 :KGKKVGVVGHFPHLESLLEPIC 1y0eA 34 :GGAVGIRANTKEDILAIKETVD T0321 143 :DL 1y0eA 57 :PV T0321 145 :SILEWSPEEGDYP 1y0eA 60 :GIVKRDYDHSDVF T0321 158 :LPASEFILP 1y0eA 77 :SKEVDELIE T0321 167 :ECDYVYIT 1y0eA 87 :QCEVIALD T0321 180 :DKTLPRLLELSRN 1y0eA 102 :KETLDELVSYIRT T0321 193 :ARRITLVGPGTPLAPVLFEHGLQELS 1y0eA 118 :NVEIMADIATVEEAKNAARLGFDYIG Number of specific fragments extracted= 8 number of extra gaps= 1 total=199 Number of alignments=16 # 1y0eA read from 1y0eA/merged-good-all-a2m # found chain 1y0eA in template set Warning: unaligning (T0321)C175 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y0eA)T96 Warning: unaligning (T0321)A176 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y0eA)T96 T0321 97 :VIFSDAKRV 1y0eA 11 :QALPDEPLH T0321 108 :RMNDPFIMSQNEV 1y0eA 20 :SSFIMSKMALAAY T0321 121 :KGKKVGVVGHFPHLESLLEPI 1y0eA 34 :GGAVGIRANTKEDILAIKETV T0321 143 :DLSIL 1y0eA 55 :DLPVI T0321 148 :EWSPEEGDYP 1y0eA 63 :KRDYDHSDVF T0321 158 :LPASEFILP 1y0eA 77 :SKEVDELIE T0321 167 :ECDYVYIT 1y0eA 87 :QCEVIALD T0321 180 :DKTLPRLLELSRN 1y0eA 102 :KETLDELVSYIRT T0321 193 :ARRITLVGPGTPLAPVLFEHGLQELS 1y0eA 118 :NVEIMADIATVEEAKNAARLGFDYIG Number of specific fragments extracted= 9 number of extra gaps= 1 total=208 Number of alignments=17 # 1y0eA read from 1y0eA/merged-good-all-a2m # found chain 1y0eA in template set Warning: unaligning (T0321)C175 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y0eA)T96 Warning: unaligning (T0321)A176 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y0eA)T96 T0321 126 :GVVGHFPHLESLLEPICDLSIL 1y0eA 38 :GIRANTKEDILAIKETVDLPVI T0321 148 :EWSPEEGDYP 1y0eA 63 :KRDYDHSDVF T0321 158 :LPASEFILP 1y0eA 77 :SKEVDELIE T0321 167 :ECDYVYIT 1y0eA 87 :QCEVIALD T0321 180 :DKTLPRLLELSR 1y0eA 102 :KETLDELVSYIR T0321 192 :NARRIT 1y0eA 118 :NVEIMA T0321 198 :LVGPGTP 1y0eA 141 :YIGTTLH T0321 205 :LAPVLF 1y0eA 165 :FLKDVL T0321 211 :EHGLQELSGFMVKDNARAFRIVAGA 1y0eA 172 :SVDAKVIAEGNVITPDMYKRVMDLG Number of specific fragments extracted= 9 number of extra gaps= 1 total=217 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xhcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xhcA expands to /projects/compbio/data/pdb/1xhc.pdb.gz 1xhcA:Skipped atom 303, because occupancy 0.350 <= existing 0.650 in 1xhcA Skipped atom 305, because occupancy 0.350 <= existing 0.650 in 1xhcA Skipped atom 307, because occupancy 0.350 <= existing 0.650 in 1xhcA Skipped atom 309, because occupancy 0.350 <= existing 0.650 in 1xhcA # T0321 read from 1xhcA/merged-good-all-a2m # 1xhcA read from 1xhcA/merged-good-all-a2m # adding 1xhcA to template set # found chain 1xhcA in template set Warning: unaligning (T0321)K123 because first residue in template chain is (1xhcA)S1 Warning: unaligning (T0321)P201 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xhcA)G144 Warning: unaligning (T0321)G202 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xhcA)G144 T0321 124 :KVGVVGHFP 1xhcA 2 :KVVIVGNGP T0321 133 :HLESLLEP 1xhcA 15 :LAKQLSQT T0321 142 :CDLSILEWSPE 1xhcA 23 :YEVTVIDKEPV T0321 153 :EGDYPLPAS 1xhcA 54 :LFPYSLDWY T0321 168 :CDYVYI 1xhcA 94 :YDTLVL T0321 174 :TCA 1xhcA 101 :TGA T0321 177 :SV 1xhcA 118 :TL T0321 182 :TLPRLLELSRNARRITLVG 1xhcA 124 :DADRIKESIENSGEAIIIG T0321 203 :TPLAPVLFEHGLQELSGFMVK 1xhcA 148 :LELAGNLAEAGYHVKLIHRGA T0321 225 :NARAFRIVAGAE 1xhcA 178 :SNMIKDMLEETG T0321 237 :KVKIYS 1xhcA 195 :NSELLE T0321 243 :AGQKVTI 1xhcA 202 :NEEGVLT Number of specific fragments extracted= 12 number of extra gaps= 1 total=229 Number of alignments=19 # 1xhcA read from 1xhcA/merged-good-all-a2m # found chain 1xhcA in template set Warning: unaligning (T0321)K123 because first residue in template chain is (1xhcA)S1 Warning: unaligning (T0321)P201 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xhcA)G144 Warning: unaligning (T0321)G202 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xhcA)G144 T0321 124 :KVGVVGHFP 1xhcA 2 :KVVIVGNGP T0321 133 :HLESLLEP 1xhcA 15 :LAKQLSQT T0321 142 :CDLSILEWSPE 1xhcA 23 :YEVTVIDKEPV T0321 153 :EGDYPLPAS 1xhcA 54 :LFPYSLDWY T0321 168 :CDYVYI 1xhcA 94 :YDTLVL T0321 174 :TCA 1xhcA 101 :TGA T0321 177 :SV 1xhcA 118 :TL T0321 181 :KT 1xhcA 120 :RT T0321 183 :LPRLLELSRNARRITLVG 1xhcA 125 :ADRIKESIENSGEAIIIG T0321 203 :TP 1xhcA 145 :FI T0321 205 :LAPVLFEHGLQELSGFMVK 1xhcA 150 :LAGNLAEAGYHVKLIHRGA T0321 225 :NARAFRIVAGAE 1xhcA 178 :SNMIKDMLEETG T0321 237 :KVKIYS 1xhcA 195 :NSELLE T0321 243 :AGQKVTI 1xhcA 202 :NEEGVLT Number of specific fragments extracted= 14 number of extra gaps= 1 total=243 Number of alignments=20 # 1xhcA read from 1xhcA/merged-good-all-a2m # found chain 1xhcA in template set Warning: unaligning (T0321)K123 because first residue in template chain is (1xhcA)S1 Warning: unaligning (T0321)P201 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xhcA)G144 Warning: unaligning (T0321)G202 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xhcA)G144 T0321 124 :KVGVVGHFPH 1xhcA 2 :KVVIVGNGPG T0321 134 :LESLLEPICDLSILEWSPE 1xhcA 15 :LAKQLSQTYEVTVIDKEPV T0321 153 :EGDYPLPAS 1xhcA 46 :AGFIPRNRL T0321 168 :CDYVYITCAS 1xhcA 94 :YDTLVLATGA T0321 182 :TLPRLLELSRNARRITLVG 1xhcA 124 :DADRIKESIENSGEAIIIG T0321 205 :LAPVLFEHGLQELSGFM 1xhcA 150 :LAGNLAEAGYHVKLIHR T0321 225 :NARAFRIVAGAE 1xhcA 178 :SNMIKDMLEETG T0321 238 :VKIYSAGQKVTIK 1xhcA 190 :VKFFLNSELLEAN Number of specific fragments extracted= 8 number of extra gaps= 1 total=251 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1uufA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0321 read from 1uufA/merged-good-all-a2m # 1uufA read from 1uufA/merged-good-all-a2m # found chain 1uufA in training set Warning: unaligning (T0321)P201 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1uufA)P277 Warning: unaligning (T0321)G202 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uufA)P277 T0321 32 :SGNGVGLGP 1uufA 80 :PGDLVGVGC T0321 49 :PMLTQNL 1uufA 143 :IRHPQEQ T0321 60 :LRVAAGCVK 1uufA 150 :LAAVAPLLC T0321 77 :IGLAAINAYYNN 1uufA 159 :AGITTYSPLRHW T0321 118 :NEVKGKKVGVVGHF 1uufA 171 :QAGPGKKVGVVGIG T0321 133 :HLESLLEPICDLSILEWSPE 1uufA 190 :GIKLAHAMGAHVVAFTTSEA T0321 156 :YPLPASEFILPECDYVYITCA 1uufA 226 :RNADEMAAHLKSFDFILNTVA T0321 181 :KTLPRLLELSRNARRITLVG 1uufA 249 :HNLDDFTTLLKRDGTMTLVG T0321 209 :LFEHGL 1uufA 282 :LIMKRR T0321 216 :ELSGFMVKDNARAFRIVAG 1uufA 288 :AIAGSMIGGIPETQEMLDF Number of specific fragments extracted= 10 number of extra gaps= 1 total=261 Number of alignments=22 # 1uufA read from 1uufA/merged-good-all-a2m # found chain 1uufA in training set Warning: unaligning (T0321)P201 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1uufA)P277 Warning: unaligning (T0321)G202 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uufA)P277 T0321 49 :PMLTQNL 1uufA 143 :IRHPQEQ T0321 60 :LRVAAGCVK 1uufA 150 :LAAVAPLLC T0321 77 :IGLAAINAYYNN 1uufA 159 :AGITTYSPLRHW T0321 118 :NEVKGKKVGVVGHF 1uufA 171 :QAGPGKKVGVVGIG T0321 133 :HLESLLEPICDLSILEWSPE 1uufA 190 :GIKLAHAMGAHVVAFTTSEA T0321 156 :YPLPASEFILPECDYVYITCA 1uufA 226 :RNADEMAAHLKSFDFILNTVA T0321 181 :KTLPRLLELSRNARRITLVG 1uufA 249 :HNLDDFTTLLKRDGTMTLVG T0321 209 :LFEHGL 1uufA 282 :LIMKRR T0321 216 :ELSGFMVKDNARAFRIVAG 1uufA 288 :AIAGSMIGGIPETQEMLDF Number of specific fragments extracted= 9 number of extra gaps= 1 total=270 Number of alignments=23 # 1uufA read from 1uufA/merged-good-all-a2m # found chain 1uufA in training set Warning: unaligning (T0321)P201 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uufA)P277 T0321 77 :IGLAAINAYYN 1uufA 159 :AGITTYSPLRH T0321 117 :QNEVKGKKVGVVGHFPH 1uufA 170 :WQAGPGKKVGVVGIGGL T0321 134 :LE 1uufA 193 :LA T0321 138 :LEPICDLSILEWSPE 1uufA 195 :HAMGAHVVAFTTSEA T0321 157 :PLPASEFILPECDYVYITCA 1uufA 227 :NADEMAAHLKSFDFILNTVA T0321 181 :KTLPRLLELSRNARRITLVG 1uufA 249 :HNLDDFTTLLKRDGTMTLVG T0321 207 :PVL 1uufA 280 :FNL T0321 211 :EHGLQ 1uufA 284 :MKRRA T0321 217 :LSGFMVKDNARAFRIVAG 1uufA 289 :IAGSMIGGIPETQEMLDF Number of specific fragments extracted= 9 number of extra gaps= 0 total=279 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v8bA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v8bA expands to /projects/compbio/data/pdb/1v8b.pdb.gz 1v8bA:# T0321 read from 1v8bA/merged-good-all-a2m # 1v8bA read from 1v8bA/merged-good-all-a2m # adding 1v8bA to template set # found chain 1v8bA in template set T0321 27 :HSVIRSGNG 1v8bA 219 :FTAINVNDA T0321 65 :GCVKSWN 1v8bA 228 :VTKQKYD T0321 73 :VEASIGLAAINAYYNNPQ 1v8bA 235 :NVYGCRHSLPDGLMRATD T0321 118 :NEVKGKKVGVVGHF 1v8bA 253 :FLISGKIVVICGYG T0321 133 :HLESLLEPICDLSILEWSPE 1v8bA 272 :CASSMKGLGARVYITEIDPI T0321 153 :EGDYP 1v8bA 301 :FNVVT T0321 161 :SEFILPECDY 1v8bA 306 :LDEIVDKGDF T0321 172 :YITCA 1v8bA 316 :FITCT T0321 183 :LPRLLE 1v8bA 328 :LEHLLK T0321 190 :SRNARR 1v8bA 334 :MKNNAV T0321 199 :VGPGTPL 1v8bA 340 :VGNIGHF T0321 206 :APVLFEH 1v8bA 352 :VNELFNY T0321 213 :GLQE 1v8bA 360 :GIHI T0321 239 :KIYS 1v8bA 364 :ENVK T0321 243 :AGQKVTI 1v8bA 369 :QVDRITL Number of specific fragments extracted= 15 number of extra gaps= 0 total=294 Number of alignments=25 # 1v8bA read from 1v8bA/merged-good-all-a2m # found chain 1v8bA in template set T0321 69 :SWN 1v8bA 232 :KYD T0321 73 :VEASIGLAAINAYYNNP 1v8bA 235 :NVYGCRHSLPDGLMRAT T0321 103 :K 1v8bA 252 :D T0321 118 :NEVKGKKVGVVGHF 1v8bA 253 :FLISGKIVVICGYG T0321 133 :HLESLLEPICDLSILEWSPE 1v8bA 272 :CASSMKGLGARVYITEIDPI T0321 153 :EGDYP 1v8bA 301 :FNVVT T0321 161 :SEFILPECDY 1v8bA 306 :LDEIVDKGDF T0321 172 :YITCA 1v8bA 316 :FITCT T0321 183 :LPRLL 1v8bA 328 :LEHLL T0321 189 :LSRNARRITLVGPG 1v8bA 333 :KMKNNAVVGNIGHF T0321 206 :APVLFEH 1v8bA 352 :VNELFNY T0321 213 :GLQE 1v8bA 360 :GIHI T0321 239 :KIYS 1v8bA 364 :ENVK T0321 243 :AGQKVTI 1v8bA 369 :QVDRITL Number of specific fragments extracted= 14 number of extra gaps= 0 total=308 Number of alignments=26 # 1v8bA read from 1v8bA/merged-good-all-a2m # found chain 1v8bA in template set T0321 2 :WEIYDAMINGIP 1v8bA 205 :VLRLKKMDKQNE T0321 25 :TTHSVIRSGNG 1v8bA 217 :LLFTAINVNDA T0321 62 :VAAGCVKSWNYVEASIGLAAINAY 1v8bA 228 :VTKQKYDNVYGCRHSLPDGLMRAT T0321 117 :QNEVKGKKVGVVGHFPH 1v8bA 252 :DFLISGKIVVICGYGDV T0321 134 :LESLLEPICDLSILEWSP 1v8bA 273 :ASSMKGLGARVYITEIDP T0321 154 :GDYPLPASEFILPECDY 1v8bA 299 :EGFNVVTLDEIVDKGDF T0321 172 :YITCAS 1v8bA 316 :FITCTG T0321 183 :LPRLLE 1v8bA 328 :LEHLLK T0321 190 :SRNARRITLVGPG 1v8bA 334 :MKNNAVVGNIGHF T0321 203 :TPLAPVLFEHG 1v8bA 349 :EIQVNELFNYK T0321 235 :AEKVKIYSAGQKV 1v8bA 360 :GIHIENVKPQVDR Number of specific fragments extracted= 11 number of extra gaps= 0 total=319 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qmgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0321 read from 1qmgA/merged-good-all-a2m # 1qmgA read from 1qmgA/merged-good-all-a2m # found chain 1qmgA in training set T0321 111 :DPFIMSQNEVKG 1qmgA 113 :NLFPLLPDAFKG T0321 123 :KKVGVVGHFPHL 1qmgA 126 :KQIGVIGWGSQA T0321 136 :SLLE 1qmgA 146 :DSLT T0321 140 :PICDLSILE 1qmgA 153 :SDVVVKIGL T0321 150 :SPE 1qmgA 162 :RKG T0321 154 :GDYPLPA 1qmgA 174 :AGFSEEN T0321 161 :SEFILPECDYVYITCA 1qmgA 186 :MWETISGSDLVLLLIS T0321 177 :SVVDKTLPRLLELSRNAR 1qmgA 203 :SAQADNYEKVFSHMKPNS T0321 198 :LVGPGTPLAPV 1qmgA 221 :ILGLSHGFLLG T0321 209 :LFEHG 1qmgA 233 :LQSLG T0321 214 :LQELSGFMVKDNARAFRIVAGAEKVKIYSAGQKVTI 1qmgA 244 :ISVIAVCPKGMGPSVRRLYVQGKEVNGAGINSSFAV Number of specific fragments extracted= 11 number of extra gaps= 0 total=330 Number of alignments=28 # 1qmgA read from 1qmgA/merged-good-all-a2m # found chain 1qmgA in training set T0321 102 :AKR 1qmgA 115 :FPL T0321 116 :SQNEVKG 1qmgA 118 :LPDAFKG T0321 123 :KKVGVVGHFPHL 1qmgA 126 :KQIGVIGWGSQA T0321 136 :SLLE 1qmgA 146 :DSLT T0321 140 :PICDLSIL 1qmgA 151 :AKSDVVVK T0321 148 :EWSPE 1qmgA 160 :GLRKG T0321 154 :GDYPLPA 1qmgA 174 :AGFSEEN T0321 161 :SEFILPECDYVYITCA 1qmgA 186 :MWETISGSDLVLLLIS T0321 177 :SVVDKTLPRLLELSRNAR 1qmgA 203 :SAQADNYEKVFSHMKPNS T0321 198 :LVGPGTPLAPV 1qmgA 221 :ILGLSHGFLLG T0321 209 :LFEHG 1qmgA 233 :LQSLG T0321 214 :LQELSGFMVKDNARAFRIVAGAEKVKIYSAGQKVTI 1qmgA 244 :ISVIAVCPKGMGPSVRRLYVQGKEVNGAGINSSFAV Number of specific fragments extracted= 12 number of extra gaps= 0 total=342 Number of alignments=29 # 1qmgA read from 1qmgA/merged-good-all-a2m # found chain 1qmgA in training set T0321 111 :DPFIMSQNEVKG 1qmgA 113 :NLFPLLPDAFKG T0321 123 :KKVGVVGHFPH 1qmgA 126 :KQIGVIGWGSQ T0321 134 :LESLLEPICDLSILE 1qmgA 147 :SLTEAKSDVVVKIGL T0321 150 :SPE 1qmgA 162 :RKG T0321 155 :DYPLPA 1qmgA 175 :GFSEEN T0321 161 :SEFILPECDYVYIT 1qmgA 186 :MWETISGSDLVLLL T0321 175 :CASVVDKTLPRLLELSRNAR 1qmgA 201 :SDSAQADNYEKVFSHMKPNS T0321 198 :LVGPGTPLAPVLF 1qmgA 221 :ILGLSHGFLLGHL T0321 212 :HGLQELSGFMVKDNARAFRIVAGAEK 1qmgA 242 :KNISVIAVCPKGMGPSVRRLYVQGKE Number of specific fragments extracted= 9 number of extra gaps= 0 total=351 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1np3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1np3A expands to /projects/compbio/data/pdb/1np3.pdb.gz 1np3A:# T0321 read from 1np3A/merged-good-all-a2m # 1np3A read from 1np3A/merged-good-all-a2m # adding 1np3A to template set # found chain 1np3A in template set T0321 100 :SDAKRVE 1np3A 4 :FYDKDCD T0321 117 :QNEVKGKKVGVVGHFP 1np3A 11 :LSIIQGKKVAIIGYGS T0321 133 :HLESLLEPICDLSIL 1np3A 31 :HACNLKDSGVDVTVG T0321 149 :WSPE 1np3A 46 :LRSG T0321 161 :SEFILPECDYVYI 1np3A 66 :VKTAVAAADVVMI T0321 181 :KTLPRLLELSRNA 1np3A 84 :FQGRLYKEEIEPN T0321 194 :R 1np3A 101 :A T0321 196 :ITLVGPGTPLA 1np3A 102 :TLAFAHGFSIH T0321 210 :FEH 1np3A 113 :YNQ T0321 213 :GLQELSGFMVKDNARAFRIVAGAEKVKI 1np3A 121 :DLDVIMIAPKAPGHTVRSEFVKGGGIPD Number of specific fragments extracted= 10 number of extra gaps= 0 total=361 Number of alignments=31 # 1np3A read from 1np3A/merged-good-all-a2m # found chain 1np3A in template set T0321 117 :QNEVKGKKVGVVGHFP 1np3A 11 :LSIIQGKKVAIIGYGS T0321 133 :HLESLLEPICDLSIL 1np3A 31 :HACNLKDSGVDVTVG T0321 149 :WSPE 1np3A 46 :LRSG T0321 161 :SEFILPECDYVYI 1np3A 66 :VKTAVAAADVVMI T0321 181 :KTLPRLLELSRNA 1np3A 84 :FQGRLYKEEIEPN T0321 194 :R 1np3A 101 :A T0321 196 :ITLVGPGTPLA 1np3A 102 :TLAFAHGFSIH T0321 210 :FEH 1np3A 113 :YNQ T0321 213 :GLQELSGFMVKDNARAFRIVAGAEKVKI 1np3A 121 :DLDVIMIAPKAPGHTVRSEFVKGGGIPD Number of specific fragments extracted= 9 number of extra gaps= 0 total=370 Number of alignments=32 # 1np3A read from 1np3A/merged-good-all-a2m # found chain 1np3A in template set T0321 112 :PFIMSQNEVKGKKVGVVGHFPH 1np3A 6 :DKDCDLSIIQGKKVAIIGYGSQ T0321 134 :LESLLEPICDLSILE 1np3A 32 :ACNLKDSGVDVTVGL T0321 150 :SPE 1np3A 47 :RSG T0321 160 :ASEFILPECDYVYITC 1np3A 65 :DVKTAVAAADVVMILT T0321 184 :PRLLELSRNARRITL 1np3A 91 :EEIEPNLKKGATLAF T0321 203 :TPLAPVLF 1np3A 106 :AHGFSIHY T0321 211 :EHGLQELSGFMVKDNARAFRIVAGAEKVK 1np3A 119 :RADLDVIMIAPKAPGHTVRSEFVKGGGIP Number of specific fragments extracted= 7 number of extra gaps= 0 total=377 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fl2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fl2A expands to /projects/compbio/data/pdb/1fl2.pdb.gz 1fl2A:# T0321 read from 1fl2A/merged-good-all-a2m # 1fl2A read from 1fl2A/merged-good-all-a2m # adding 1fl2A to template set # found chain 1fl2A in template set T0321 2 :WEIYDAMINGIP 1fl2A 267 :QKLAGALKVHVD T0321 14 :EDFLVDELVCGTT 1fl2A 286 :DSQSASKLIPAAV T0321 27 :HSVIRSGNGVGLG 1fl2A 303 :HQIETASGAVLKA T0321 40 :PNRPF 1fl2A 321 :ATGAK T0321 45 :ETRMPMLTQNLLG 1fl2A 327 :RNMNVPGEDQYRT T0321 95 :HGVIFS 1fl2A 340 :KGVTYC T0321 113 :FIMSQNEVKGKKVGVVGHF 1fl2A 346 :PHCDGPLFKGKRVAVIGGG T0321 132 :P 1fl2A 366 :S T0321 133 :HLESLLEPICDLSILEWSPE 1fl2A 370 :AAIDLAGIVEHVTLLEFAPE T0321 154 :GDYPLPASEFI 1fl2A 390 :MKADQVLQDKL T0321 165 :LPECDYV 1fl2A 403 :LKNVDII Number of specific fragments extracted= 11 number of extra gaps= 0 total=388 Number of alignments=34 # 1fl2A read from 1fl2A/merged-good-all-a2m # found chain 1fl2A in template set T0321 3 :EIYDAMINGIPE 1fl2A 268 :KLAGALKVHVDE T0321 15 :DFLVDELVCGTT 1fl2A 287 :SQSASKLIPAAV T0321 27 :HSVIRSGNGVGLG 1fl2A 303 :HQIETASGAVLKA T0321 40 :PNRPFETRMPMLTQNLLGL 1fl2A 322 :TGAKWRNMNVPGEDQYRTK T0321 104 :RVE 1fl2A 341 :GVT T0321 111 :DPFIMSQNEVKGKKVGVVGHF 1fl2A 344 :YCPHCDGPLFKGKRVAVIGGG T0321 132 :P 1fl2A 366 :S T0321 133 :HLESLLEPICDLSILEWSPE 1fl2A 370 :AAIDLAGIVEHVTLLEFAPE T0321 154 :GDYPLPASEFI 1fl2A 390 :MKADQVLQDKL T0321 165 :LPECDYV 1fl2A 403 :LKNVDII Number of specific fragments extracted= 10 number of extra gaps= 0 total=398 Number of alignments=35 # 1fl2A read from 1fl2A/merged-good-all-a2m # found chain 1fl2A in template set T0321 1 :MWEIYDAMINGIP 1fl2A 269 :LAGALKVHVDEYD T0321 14 :EDFLVDELV 1fl2A 286 :DSQSASKLI T0321 26 :THSVIRSGNGVGLGPN 1fl2A 301 :GLHQIETASGAVLKAR T0321 46 :TRMPMLTQNLLGL 1fl2A 328 :NMNVPGEDQYRTK T0321 96 :GVI 1fl2A 341 :GVT T0321 111 :DPFIMSQNEVKGKKVGVVGHFPHLESLLE 1fl2A 344 :YCPHCDGPLFKGKRVAVIGGGNSGVEAAI T0321 140 :PICDLSILEWSPEEGDYPLPASEFI 1fl2A 376 :GIVEHVTLLEFAPEMKADQVLQDKL T0321 165 :LPECDYV 1fl2A 403 :LKNVDII Number of specific fragments extracted= 8 number of extra gaps= 0 total=406 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xdwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xdwA expands to /projects/compbio/data/pdb/1xdw.pdb.gz 1xdwA:# T0321 read from 1xdwA/merged-good-all-a2m # 1xdwA read from 1xdwA/merged-good-all-a2m # adding 1xdwA to template set # found chain 1xdwA in template set Warning: unaligning (T0321)K123 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xdwA)T148 Warning: unaligning (T0321)K124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xdwA)T148 T0321 2 :WEIYDAMINGI 1xdwA 59 :KQNLDIYKKLG T0321 18 :VDELVCGTT 1xdwA 70 :VKYILTRTA T0321 27 :HSV 1xdwA 93 :FPM T0321 39 :GPNR 1xdwA 96 :AFVP T0321 57 :GLPLRVAAGCVKS 1xdwA 100 :RYSPNAIAELAVT T0321 75 :ASIGLA 1xdwA 113 :QAMMLL T0321 84 :AYYN 1xdwA 122 :AYTT T0321 91 :VAREHG 1xdwA 126 :SRTAKK T0321 102 :AKRVEDRMND 1xdwA 132 :NFKVDAFMFS T0321 118 :NEVKG 1xdwA 142 :KEVRN T0321 125 :VGVVGHFP 1xdwA 149 :VGVVGLGR T0321 133 :HLESLLEPICDLSILEWSP 1xdwA 161 :AAQIFHGMGATVIGEDVFE T0321 152 :EEG 1xdwA 185 :DYC T0321 155 :DYP 1xdwA 189 :QVS T0321 161 :SEFILPECDYVYITC 1xdwA 192 :LDEVLEKSDIITIHA T0321 181 :KTLPRLLELSRNAR 1xdwA 215 :VVTRDFLKKMKDGA T0321 196 :ITLVGPGTPLA 1xdwA 229 :ILVNCARGQLV T0321 224 :DNARAFRIVAGAE 1xdwA 240 :DTEAVIEAVESGK Number of specific fragments extracted= 18 number of extra gaps= 1 total=424 Number of alignments=37 # 1xdwA read from 1xdwA/merged-good-all-a2m # found chain 1xdwA in template set Warning: unaligning (T0321)K123 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xdwA)T148 Warning: unaligning (T0321)K124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xdwA)T148 T0321 2 :WEIYDAMINGI 1xdwA 59 :KQNLDIYKKLG T0321 18 :VDELVCGTT 1xdwA 70 :VKYILTRTA T0321 36 :VGLGPNRP 1xdwA 93 :FPMAFVPR T0321 51 :L 1xdwA 101 :Y T0321 59 :PLRVAAGCVKS 1xdwA 102 :SPNAIAELAVT T0321 75 :ASIGL 1xdwA 113 :QAMML T0321 86 :YN 1xdwA 118 :LR T0321 88 :NPQVAREHGVIFSDA 1xdwA 123 :YTTSRTAKKNFKVDA T0321 108 :RMND 1xdwA 138 :FMFS T0321 118 :NEVKG 1xdwA 142 :KEVRN T0321 125 :VGVVGHFP 1xdwA 149 :VGVVGLGR T0321 133 :HLESLLEPICDLSILEWSP 1xdwA 161 :AAQIFHGMGATVIGEDVFE T0321 152 :EEG 1xdwA 185 :DYC T0321 155 :DYP 1xdwA 189 :QVS T0321 161 :SEFILPECDYVYI 1xdwA 192 :LDEVLEKSDIITI T0321 181 :KTLPRLLELSRNAR 1xdwA 215 :VVTRDFLKKMKDGA T0321 196 :ITLVGPGTPLA 1xdwA 229 :ILVNCARGQLV T0321 224 :DNARAFRIVAGAE 1xdwA 240 :DTEAVIEAVESGK Number of specific fragments extracted= 18 number of extra gaps= 1 total=442 Number of alignments=38 # 1xdwA read from 1xdwA/merged-good-all-a2m # found chain 1xdwA in template set Warning: unaligning (T0321)K123 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xdwA)T148 Warning: unaligning (T0321)K124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xdwA)T148 T0321 2 :WEIYDAM 1xdwA 62 :LDIYKKL T0321 18 :VDELVCG 1xdwA 70 :VKYILTR T0321 39 :GPNRPF 1xdwA 77 :TAGTDH T0321 47 :R 1xdwA 97 :F T0321 55 :LLGLPLRVAAGCVKSWNYVE 1xdwA 98 :VPRYSPNAIAELAVTQAMML T0321 85 :YYN 1xdwA 118 :LRH T0321 88 :NPQVAREHGVIFSD 1xdwA 123 :YTTSRTAKKNFKVD T0321 113 :FIMSQNEVKG 1xdwA 137 :AFMFSKEVRN T0321 125 :VGVVGHFPH 1xdwA 149 :VGVVGLGRI T0321 134 :LESLLEPICDLSILEWSPE 1xdwA 161 :AAQIFHGMGATVIGEDVFE T0321 153 :EGDYPLPASEFILPECDYVYITC 1xdwA 184 :EDYCTQVSLDEVLEKSDIITIHA T0321 181 :KTLPRLLELSRNAR 1xdwA 215 :VVTRDFLKKMKDGA T0321 196 :ITLVGPGTPLA 1xdwA 229 :ILVNCARGQLV T0321 224 :DNARAFRIVAGA 1xdwA 240 :DTEAVIEAVESG Number of specific fragments extracted= 14 number of extra gaps= 1 total=456 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g76A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2g76A expands to /projects/compbio/data/pdb/2g76.pdb.gz 2g76A:Skipped atom 746, because occupancy 0.500 <= existing 0.500 in 2g76A Skipped atom 750, because occupancy 0.500 <= existing 0.500 in 2g76A Skipped atom 752, because occupancy 0.500 <= existing 0.500 in 2g76A Skipped atom 754, because occupancy 0.500 <= existing 0.500 in 2g76A Skipped atom 756, because occupancy 0.500 <= existing 0.500 in 2g76A Skipped atom 767, because occupancy 0.300 <= existing 0.700 in 2g76A Skipped atom 771, because occupancy 0.300 <= existing 0.700 in 2g76A Skipped atom 773, because occupancy 0.300 <= existing 0.700 in 2g76A Skipped atom 775, because occupancy 0.300 <= existing 0.700 in 2g76A Skipped atom 777, because occupancy 0.300 <= existing 0.700 in 2g76A Skipped atom 1371, because occupancy 0.200 <= existing 0.800 in 2g76A Skipped atom 1375, because occupancy 0.200 <= existing 0.800 in 2g76A Skipped atom 1377, because occupancy 0.200 <= existing 0.800 in 2g76A Skipped atom 1379, because occupancy 0.200 <= existing 0.800 in 2g76A Skipped atom 1381, because occupancy 0.200 <= existing 0.800 in 2g76A Skipped atom 1383, because occupancy 0.200 <= existing 0.800 in 2g76A Skipped atom 2030, because occupancy 0.500 <= existing 0.500 in 2g76A Skipped atom 2034, because occupancy 0.500 <= existing 0.500 in 2g76A Skipped atom 2036, because occupancy 0.500 <= existing 0.500 in 2g76A # T0321 read from 2g76A/merged-good-all-a2m # 2g76A read from 2g76A/merged-good-all-a2m # adding 2g76A to template set # found chain 2g76A in template set T0321 60 :LRV 2g76A 105 :AAE T0321 63 :AAGCVKSWNYVEASIG 2g76A 112 :MIMCLARQIPQATASM T0321 93 :REHG 2g76A 128 :KDGK T0321 103 :KRVEDRMN 2g76A 132 :WERKKFMG T0321 118 :NEVKGKKVGVVGHFP 2g76A 140 :TELNGKTLGILGLGR T0321 133 :HLESLLEPICDLSILE 2g76A 159 :VATRMQSFGMKTIGYD T0321 154 :GDYPLPAS 2g76A 175 :PIISPEVS T0321 162 :EFILPECDYVYI 2g76A 193 :EEIWPLCDFITV T0321 178 :VVDKT 2g76A 215 :LLNDN T0321 186 :LLELSRNAR 2g76A 220 :TFAQCKKGV T0321 196 :ITLVGPGTPL 2g76A 229 :RVVNCARGGI T0321 223 :KDNARAFRIVAGAE 2g76A 239 :VDEGALLRALQSGQ Number of specific fragments extracted= 12 number of extra gaps= 0 total=468 Number of alignments=40 # 2g76A read from 2g76A/merged-good-all-a2m # found chain 2g76A in template set T0321 69 :SWNYVEASIG 2g76A 102 :SLSAAELTCG T0321 81 :AINAYYNNPQVARE 2g76A 112 :MIMCLARQIPQATA T0321 95 :HGVIFSDAKRV 2g76A 130 :GKWERKKFMGT T0321 119 :EVKGKKVGVVGHFP 2g76A 141 :ELNGKTLGILGLGR T0321 133 :HLESLLEPICDLSILE 2g76A 159 :VATRMQSFGMKTIGYD T0321 154 :GDYPLPAS 2g76A 175 :PIISPEVS T0321 162 :EFILPECDYVYI 2g76A 193 :EEIWPLCDFITV T0321 178 :VVDKT 2g76A 215 :LLNDN T0321 186 :LLELSRNAR 2g76A 220 :TFAQCKKGV T0321 196 :ITLVGPGTPL 2g76A 229 :RVVNCARGGI T0321 223 :KDNARAFRIVAGAE 2g76A 239 :VDEGALLRALQSGQ Number of specific fragments extracted= 11 number of extra gaps= 0 total=479 Number of alignments=41 # 2g76A read from 2g76A/merged-good-all-a2m # found chain 2g76A in template set T0321 67 :VKSWNYVEASIGLAAINAYY 2g76A 100 :GNSLSAAELTCGMIMCLARQ T0321 87 :NNPQVAREHG 2g76A 122 :QATASMKDGK T0321 110 :NDPFIMSQNEVKGKKVGVVGHFPH 2g76A 132 :WERKKFMGTELNGKTLGILGLGRI T0321 134 :LESLLEP 2g76A 159 :VATRMQS T0321 142 :CDLSILEWSP 2g76A 166 :FGMKTIGYDP T0321 155 :DYPLPA 2g76A 176 :IISPEV T0321 161 :SEFILPECDYVYITC 2g76A 192 :LEEIWPLCDFITVHT T0321 178 :VVD 2g76A 215 :LLN T0321 184 :PRLLELSRNAR 2g76A 218 :DNTFAQCKKGV T0321 196 :ITLVGPGTPL 2g76A 229 :RVVNCARGGI T0321 223 :KDNARAFRIVAGA 2g76A 239 :VDEGALLRALQSG Number of specific fragments extracted= 11 number of extra gaps= 0 total=490 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vmeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0321 read from 1vmeA/merged-good-all-a2m # 1vmeA read from 1vmeA/merged-good-all-a2m # found chain 1vmeA in training set T0321 4 :IYDAMINGIP 1vmeA 113 :GKRLLEGFYG T0321 14 :EDFLVD 1vmeA 124 :KDVTVV T0321 20 :ELVCGTT 1vmeA 141 :KFKFVMT T0321 27 :HSVIR 1vmeA 156 :MVTYL T0321 33 :GNGVGLG 1vmeA 161 :DGILFSC T0321 41 :NRPFETRMP 1vmeA 173 :YLLPEILDD T0321 68 :KSWNYVEAS 1vmeA 182 :SNESVVERY T0321 77 :IGLAAINAYYNNPQVARE 1vmeA 194 :VTKYIVTVIGHYKNYILE T0321 95 :HGVIF 1vmeA 228 :HGLIW T0321 102 :AKRVEDRMNDPFIMSQNEVKGKKVGVVGHF 1vmeA 233 :KKDPQRLLNHYVSVAKGDPKKGKVTVIYDS T0321 132 :PHL 1vmeA 265 :GFV T0321 135 :ESLLEPICDLSILEWSPEEGDYPLPASE 1vmeA 276 :DSLKEKGFTPVVYKFSDEERPAISEILK T0321 165 :LPECDYVYITCAS 1vmeA 305 :IPDSEALIFGVST T0321 178 :VVDKTLPRLLELSRNARRITLVGPGTPL 1vmeA 325 :LMRFTLLEIIDKANYEKPVLVFGVHGWA T0321 206 :APV 1vmeA 359 :AGE T0321 209 :LFEHGLQELSGFMVK 1vmeA 363 :LKETKFRILSFTEIK T0321 224 :DNARAFRIVAG 1vmeA 382 :DERKIEEAISL Number of specific fragments extracted= 17 number of extra gaps= 0 total=507 Number of alignments=43 # 1vmeA read from 1vmeA/merged-good-all-a2m # found chain 1vmeA in training set T0321 5 :YDAMINGIP 1vmeA 114 :KRLLEGFYG T0321 14 :EDFLVD 1vmeA 124 :KDVTVV T0321 20 :ELVCGTT 1vmeA 141 :KFKFVMT T0321 27 :HSVI 1vmeA 156 :MVTY T0321 32 :SGNGVGLG 1vmeA 160 :LDGILFSC T0321 40 :PNRPFETRMPMLTQN 1vmeA 171 :GGYLLPEILDDSNES T0321 63 :AAGCVKS 1vmeA 186 :VVERYLP T0321 73 :VEASIGLAAI 1vmeA 193 :HVTKYIVTVI T0321 85 :YYNNPQVARE 1vmeA 209 :ILEGAEKLSS T0321 95 :HGVIF 1vmeA 229 :GLIWK T0321 103 :KRVEDRMNDPFIMSQNEVKGKKVGVVGHF 1vmeA 234 :KDPQRLLNHYVSVAKGDPKKGKVTVIYDS T0321 132 :PHL 1vmeA 265 :GFV T0321 135 :ESLLEPICDLSILEWSPEEGDYPLPASE 1vmeA 276 :DSLKEKGFTPVVYKFSDEERPAISEILK T0321 165 :LPECDYVYITCAS 1vmeA 305 :IPDSEALIFGVST T0321 178 :VVDKTLPRLLELSRNARRITLVGPGTP 1vmeA 325 :LMRFTLLEIIDKANYEKPVLVFGVHGW T0321 205 :LAPV 1vmeA 358 :TAGE T0321 209 :LFEHGLQELSGFMVK 1vmeA 363 :LKETKFRILSFTEIK T0321 224 :DNARAFRIVAG 1vmeA 382 :DERKIEEAISL Number of specific fragments extracted= 18 number of extra gaps= 0 total=525 Number of alignments=44 # 1vmeA read from 1vmeA/merged-good-all-a2m # found chain 1vmeA in training set Warning: unaligning (T0321)P204 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1vmeA)R357 T0321 4 :IYDAMINGI 1vmeA 211 :EGAEKLSSL T0321 17 :LVDELVCGTTH 1vmeA 220 :KIKALLPGHGL T0321 40 :P 1vmeA 231 :I T0321 56 :LGLPLRVAAGCVKSWNY 1vmeA 232 :WKKDPQRLLNHYVSVAK T0321 118 :NEVKGKKVGVVGHFPH 1vmeA 249 :GDPKKGKVTVIYDSMY T0321 134 :LESLLEPI 1vmeA 274 :AIDSLKEK T0321 142 :CDLSILEWS 1vmeA 283 :FTPVVYKFS T0321 152 :EEGDYPLPASEFILPECDYVYITCAS 1vmeA 292 :DEERPAISEILKDIPDSEALIFGVST T0321 178 :VVDKTLPRLLELSRNARRITLVGPGT 1vmeA 325 :LMRFTLLEIIDKANYEKPVLVFGVHG T0321 205 :LAPVLF 1vmeA 358 :TAGELL T0321 211 :EHGLQELSGFMVK 1vmeA 365 :ETKFRILSFTEIK T0321 224 :DNARAFRIVAG 1vmeA 382 :DERKIEEAISL Number of specific fragments extracted= 12 number of extra gaps= 1 total=537 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2d0iA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2d0iA expands to /projects/compbio/data/pdb/2d0i.pdb.gz 2d0iA:# T0321 read from 2d0iA/merged-good-all-a2m # 2d0iA read from 2d0iA/merged-good-all-a2m # adding 2d0iA to template set # found chain 2d0iA in template set T0321 3 :EIYDAMINGI 2d0iA 14 :EALEELKKYA T0321 17 :LVD 2d0iA 24 :DVE T0321 20 :ELVCG 2d0iA 44 :DGIIV T0321 32 :S 2d0iA 49 :S T0321 44 :FETRMP 2d0iA 50 :PTTKIT T0321 50 :MLTQN 2d0iA 60 :ENAER T0321 55 :LLGLPLRVAAG 2d0iA 75 :YDNIDLEEATK T0321 66 :CVKSWNYVEASIGL 2d0iA 95 :GLLSEAVAEFTVGL T0321 81 :AIN 2d0iA 109 :IIN T0321 85 :YYNNP 2d0iA 112 :LMRKI T0321 90 :QVARE 2d0iA 120 :DKFIR T0321 102 :AKRVED 2d0iA 125 :RGEWES T0321 112 :PFIMSQNE 2d0iA 131 :HAKIWTGF T0321 121 :KGKKVGVVGHFP 2d0iA 145 :YGKKVGILGMGA T0321 133 :HLESLLEPICDLSILEWSPE 2d0iA 161 :IARRLIPFGVKLYYWSRHRK T0321 153 :EGDYPL 2d0iA 189 :ARYMDI T0321 162 :EFILPECDYVYIT 2d0iA 195 :DELLEKSDIVILA T0321 176 :ASVVDKTL 2d0iA 208 :LPLTRDTY T0321 184 :PRLLELSRNA 2d0iA 220 :EERVKKLEGK T0321 197 :TLVGPGTPLA 2d0iA 230 :YLVNIGRGAL T0321 214 :L 2d0iA 240 :V T0321 224 :DNARAFRIVAGAE 2d0iA 241 :DEKAVTEAIKQGK Number of specific fragments extracted= 22 number of extra gaps= 0 total=559 Number of alignments=46 # 2d0iA read from 2d0iA/merged-good-all-a2m # found chain 2d0iA in template set T0321 2 :WEIYDAMINGI 2d0iA 13 :REALEELKKYA T0321 17 :LVD 2d0iA 24 :DVE T0321 20 :ELVCGTT 2d0iA 44 :DGIIVSP T0321 45 :ETRM 2d0iA 51 :TTKI T0321 50 :MLTQN 2d0iA 60 :ENAER T0321 55 :LLGLPLRVAAG 2d0iA 75 :YDNIDLEEATK T0321 66 :CVKSWNYVEASIGL 2d0iA 95 :GLLSEAVAEFTVGL T0321 81 :AINAY 2d0iA 109 :IINLM T0321 86 :YNNPQVAREHGVIFSD 2d0iA 116 :IHYADKFIRRGEWESH T0321 103 :KRVEDRMND 2d0iA 132 :AKIWTGFKR T0321 118 :NEVKGKKVGVVGHFP 2d0iA 142 :ESLYGKKVGILGMGA T0321 133 :HLESLLEPICDLSILEWSPE 2d0iA 161 :IARRLIPFGVKLYYWSRHRK T0321 153 :EGDYPL 2d0iA 189 :ARYMDI T0321 162 :EFILPECDYVYI 2d0iA 195 :DELLEKSDIVIL T0321 175 :CASVVDKT 2d0iA 207 :ALPLTRDT T0321 184 :PRLLELSRNA 2d0iA 220 :EERVKKLEGK T0321 197 :TLVGPGTPLA 2d0iA 230 :YLVNIGRGAL T0321 214 :L 2d0iA 240 :V T0321 224 :DNARAFRIVAGAE 2d0iA 241 :DEKAVTEAIKQGK Number of specific fragments extracted= 19 number of extra gaps= 0 total=578 Number of alignments=47 # 2d0iA read from 2d0iA/merged-good-all-a2m # found chain 2d0iA in template set T0321 55 :LLGLPLRVAAG 2d0iA 75 :YDNIDLEEATK T0321 67 :VKSWNYVEASIGL 2d0iA 96 :LLSEAVAEFTVGL T0321 81 :AINAYYNNPQV 2d0iA 109 :IINLMRKIHYA T0321 92 :AREHG 2d0iA 122 :FIRRG T0321 103 :KRVEDRMNDPFIMSQNEVKGKKVGVVGHFP 2d0iA 127 :EWESHAKIWTGFKRIESLYGKKVGILGMGA T0321 133 :HLESLLEPICDLSILEWSPE 2d0iA 160 :AIARRLIPFGVKLYYWSRHR T0321 160 :ASEFILPECDYVYITCA 2d0iA 193 :DIDELLEKSDIVILALP T0321 178 :VVD 2d0iA 217 :IIN T0321 184 :PRLLELSRNAR 2d0iA 220 :EERVKKLEGKY T0321 196 :ITLVGPGTP 2d0iA 231 :LVNIGRGAL T0321 223 :KDNARAFRIVAGAE 2d0iA 240 :VDEKAVTEAIKQGK Number of specific fragments extracted= 11 number of extra gaps= 0 total=589 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2nacA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0321 read from 2nacA/merged-good-all-a2m # 2nacA read from 2nacA/merged-good-all-a2m # found chain 2nacA in training set Warning: unaligning (T0321)V128 because of BadResidue code BAD_PEPTIDE in next template residue (2nacA)A198 Warning: unaligning (T0321)G129 because of BadResidue code BAD_PEPTIDE at template residue (2nacA)A198 T0321 71 :NYV 2nacA 149 :SVA T0321 75 :ASIGLAAINAYYNNPQVA 2nacA 152 :EHVVMMILSLVRNYLPSH T0321 103 :KRVEDRMNDPFIMSQNEV 2nacA 170 :EWARKGGWNIADCVSHAY T0321 121 :KGKKVGV 2nacA 190 :EAMHVGT T0321 130 :HF 2nacA 199 :AG T0321 133 :HLESLLEPICDLSILEWS 2nacA 206 :VLRRLAPFDVHLHYTDRH T0321 155 :DYPLPAS 2nacA 224 :RLPESVE T0321 162 :EFILPECDYVYITC 2nacA 242 :EDMYPVCDVVTLNC T0321 179 :VDK 2nacA 265 :IND T0321 185 :RLLELSRNAR 2nacA 268 :ETLKLFKRGA T0321 196 :ITLVGPGTPL 2nacA 278 :YIVNTARGKL T0321 224 :DNARAFRIVAGAE 2nacA 289 :DRDAVARALESGR Number of specific fragments extracted= 12 number of extra gaps= 1 total=601 Number of alignments=49 # 2nacA read from 2nacA/merged-good-all-a2m # found chain 2nacA in training set Warning: unaligning (T0321)V128 because of BadResidue code BAD_PEPTIDE in next template residue (2nacA)A198 Warning: unaligning (T0321)G129 because of BadResidue code BAD_PEPTIDE at template residue (2nacA)A198 T0321 70 :W 2nacA 148 :I T0321 72 :YVEASIGLAAINAYYNNPQVAREHGVIFSDAKRVEDRMND 2nacA 149 :SVAEHVVMMILSLVRNYLPSHEWARKGGWNIADCVSHAYD T0321 120 :VKGKKVGV 2nacA 189 :LEAMHVGT T0321 130 :HF 2nacA 199 :AG T0321 133 :HLESLLEPICDLSILEWS 2nacA 206 :VLRRLAPFDVHLHYTDRH T0321 155 :DYPLPAS 2nacA 224 :RLPESVE T0321 162 :EFILPECDYVYITC 2nacA 242 :EDMYPVCDVVTLNC T0321 179 :VDK 2nacA 265 :IND T0321 184 :PR 2nacA 268 :ET T0321 187 :LELSRNAR 2nacA 270 :LKLFKRGA T0321 197 :TLVGPGTP 2nacA 278 :YIVNTARG T0321 224 :DNARAFRIVAGAE 2nacA 289 :DRDAVARALESGR Number of specific fragments extracted= 12 number of extra gaps= 1 total=613 Number of alignments=50 # 2nacA read from 2nacA/merged-good-all-a2m # found chain 2nacA in training set Warning: unaligning (T0321)V128 because of BadResidue code BAD_PEPTIDE in next template residue (2nacA)A198 Warning: unaligning (T0321)G129 because of BadResidue code BAD_PEPTIDE at template residue (2nacA)A198 T0321 61 :RVAAGCVKS 2nacA 148 :ISVAEHVVM T0321 80 :AAINAYYNNPQV 2nacA 157 :MILSLVRNYLPS T0321 92 :AREH 2nacA 172 :ARKG T0321 107 :DRMNDPFIMSQNEVKGKKVGV 2nacA 176 :GWNIADCVSHAYDLEAMHVGT T0321 130 :HFP 2nacA 199 :AGR T0321 134 :LESLLEPI 2nacA 206 :VLRRLAPF T0321 143 :DLSILEWS 2nacA 214 :DVHLHYTD T0321 153 :EGDYPLPASEFI 2nacA 222 :RHRLPESVEKEL T0321 165 :LPECDYVYITC 2nacA 245 :YPVCDVVTLNC T0321 179 :VD 2nacA 265 :IN T0321 184 :PRLLELSRNAR 2nacA 267 :DETLKLFKRGA T0321 196 :ITLVGPGTPLA 2nacA 278 :YIVNTARGKLC T0321 224 :DNARAFRIVAGA 2nacA 289 :DRDAVARALESG Number of specific fragments extracted= 13 number of extra gaps= 1 total=626 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y81A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0321 read from 1y81A/merged-good-all-a2m # 1y81A read from 1y81A/merged-good-all-a2m # found chain 1y81A in training set Warning: unaligning (T0321)G122 because first residue in template chain is (1y81A)F6 T0321 123 :KKVGVVGHF 1y81A 7 :RKIALVGAS T0321 132 :P 1y81A 18 :P T0321 133 :HLESLLEPICDLSILEWSPE 1y81A 25 :ILKDLLSKGFEVLPVNPNYD T0321 156 :YPLPASEFILPECDYVYI 1y81A 50 :KCYRSVRELPKDVDVIVF T0321 182 :TLPRLLELS 1y81A 70 :PPKVGLQVA T0321 207 :PVLFEHGLQELSGFMVKDNARAFRIVAGAEK 1y81A 79 :KEAVEAGFKKLWFQPGAESEEIRRFLEKAGV Number of specific fragments extracted= 6 number of extra gaps= 0 total=632 Number of alignments=52 # 1y81A read from 1y81A/merged-good-all-a2m # found chain 1y81A in training set Warning: unaligning (T0321)G122 because first residue in template chain is (1y81A)F6 T0321 123 :KKVGVVGHF 1y81A 7 :RKIALVGAS T0321 132 :P 1y81A 18 :P T0321 133 :HLESLLEPICDLSILEWSPE 1y81A 25 :ILKDLLSKGFEVLPVNPNYD T0321 156 :Y 1y81A 50 :K T0321 158 :LPASEFILPECDYVYI 1y81A 52 :YRSVRELPKDVDVIVF T0321 182 :TLPRLLELSR 1y81A 70 :PPKVGLQVAK T0321 208 :VLFEHGLQELSGFMVKDNARAFRIVAGAEK 1y81A 80 :EAVEAGFKKLWFQPGAESEEIRRFLEKAGV Number of specific fragments extracted= 7 number of extra gaps= 0 total=639 Number of alignments=53 # 1y81A read from 1y81A/merged-good-all-a2m # found chain 1y81A in training set Warning: unaligning (T0321)G122 because first residue in template chain is (1y81A)F6 T0321 123 :KKVGVVGHFPH 1y81A 7 :RKIALVGASKN T0321 134 :LESLLEPICDLSILEWSPE 1y81A 26 :LKDLLSKGFEVLPVNPNYD T0321 153 :EGDYPLPASEFILPECDYVYITC 1y81A 47 :EGLKCYRSVRELPKDVDVIVFVV T0321 182 :TLPRLLELSR 1y81A 70 :PPKVGLQVAK T0321 208 :VLFEHGLQELSGFMVKDNARAFRIVAGAEKVKIYSA 1y81A 80 :EAVEAGFKKLWFQPGAESEEIRRFLEKAGVEYSFGR Number of specific fragments extracted= 5 number of extra gaps= 0 total=644 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vpdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0321 read from 1vpdA/merged-good-all-a2m # 1vpdA read from 1vpdA/merged-good-all-a2m # found chain 1vpdA in training set Warning: unaligning (T0321)K123 because first residue in template chain is (1vpdA)M3 Warning: unaligning (T0321)K124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vpdA)K4 T0321 125 :VGVVGHF 1vpdA 5 :VGFIGLG T0321 132 :PHLESLLEPICDLSILEWSPE 1vpdA 16 :PMSKNLLKAGYSLVVSDRNPE T0321 158 :LPASEFILPECDYVYI 1vpdA 49 :ASTAKAIAEQCDVIIT T0321 181 :KTLPRL 1vpdA 67 :PNSPHV T0321 187 :LELSRNAR 1vpdA 83 :IEGAKPGT T0321 196 :ITLVGPGTP 1vpdA 91 :VLIDMSSIA T0321 205 :LAPVLFEHGLQELSGFMVK 1vpdA 106 :ISDALKAKGVEMLDAPVSG T0321 228 :AFRIVAGA 1vpdA 125 :GEPKAIDG Number of specific fragments extracted= 8 number of extra gaps= 0 total=652 Number of alignments=55 # 1vpdA read from 1vpdA/merged-good-all-a2m # found chain 1vpdA in training set Warning: unaligning (T0321)K123 because first residue in template chain is (1vpdA)M3 Warning: unaligning (T0321)K124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vpdA)K4 T0321 125 :VGVVGHF 1vpdA 5 :VGFIGLG T0321 132 :PHLESLLEPICDLSILEWSPE 1vpdA 16 :PMSKNLLKAGYSLVVSDRNPE T0321 158 :LPASEFILPECDYVYI 1vpdA 49 :ASTAKAIAEQCDVIIT T0321 181 :KTLPRL 1vpdA 67 :PNSPHV T0321 187 :LELSRNAR 1vpdA 83 :IEGAKPGT T0321 196 :ITLVGPGTP 1vpdA 91 :VLIDMSSIA T0321 205 :LAPVLFEHGLQELSGFMVK 1vpdA 106 :ISDALKAKGVEMLDAPVSG T0321 228 :AFRIVAGA 1vpdA 125 :GEPKAIDG Number of specific fragments extracted= 8 number of extra gaps= 0 total=660 Number of alignments=56 # 1vpdA read from 1vpdA/merged-good-all-a2m # found chain 1vpdA in training set Warning: unaligning (T0321)K123 because first residue in template chain is (1vpdA)M3 Warning: unaligning (T0321)K124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vpdA)K4 T0321 125 :VGVVGHFPH 1vpdA 5 :VGFIGLGIM T0321 134 :LESLLEPICDLSILEWSPE 1vpdA 18 :SKNLLKAGYSLVVSDRNPE T0321 158 :LPASEFILPECDYVYI 1vpdA 49 :ASTAKAIAEQCDVIIT T0321 175 :CA 1vpdA 65 :ML T0321 181 :KTLPR 1vpdA 67 :PNSPH T0321 186 :LLELSRNAR 1vpdA 82 :IIEGAKPGT T0321 196 :ITLVGPGTP 1vpdA 91 :VLIDMSSIA T0321 205 :LAPVLFEHGLQELSGFMVKD 1vpdA 106 :ISDALKAKGVEMLDAPVSGG T0321 229 :FRIVAG 1vpdA 126 :EPKAID Number of specific fragments extracted= 9 number of extra gaps= 0 total=669 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rcuA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rcuA expands to /projects/compbio/data/pdb/1rcu.pdb.gz 1rcuA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0321 read from 1rcuA/merged-good-all-a2m # 1rcuA read from 1rcuA/merged-good-all-a2m # adding 1rcuA to template set # found chain 1rcuA in template set Warning: unaligning (T0321)G122 because first residue in template chain is (1rcuA)M1 T0321 123 :KKVGVVGHF 1rcuA 2 :KKVVVVGYS T0321 132 :P 1rcuA 12 :P T0321 133 :HLESLLE 1rcuA 17 :PVSELRD T0321 142 :CDLSILEWSPE 1rcuA 35 :KGYLVFNGGRD T0321 153 :EGDYPLPASEF 1rcuA 81 :KTGLDFQMRSF T0321 164 :ILPECDYVYITCA 1rcuA 93 :LLRNADVVVSIGG T0321 181 :KTLPRLLELSRNARRITLVGPGTPLAPVLF 1rcuA 108 :GTAIEILGAYALGKPVILLRGTGGWTDRIS T0321 211 :EHG 1rcuA 142 :DGK T0321 219 :GFMVKDNARAFRIVAG 1rcuA 154 :IHQAWTVEEAVQIIEQ Number of specific fragments extracted= 9 number of extra gaps= 0 total=678 Number of alignments=58 # 1rcuA read from 1rcuA/merged-good-all-a2m # found chain 1rcuA in template set Warning: unaligning (T0321)G122 because first residue in template chain is (1rcuA)M1 T0321 123 :KKVGVVGHF 1rcuA 2 :KKVVVVGYS T0321 132 :P 1rcuA 12 :P T0321 133 :HLESLLE 1rcuA 17 :PVSELRD T0321 142 :CDLSILEWSPE 1rcuA 35 :KGYLVFNGGRD T0321 153 :EGDYPLPASEF 1rcuA 81 :KTGLDFQMRSF T0321 164 :ILPECDYVYITCA 1rcuA 93 :LLRNADVVVSIGG T0321 181 :KTLPRLLELSRNARRITLVGPGTPLAPVLF 1rcuA 108 :GTAIEILGAYALGKPVILLRGTGGWTDRIS T0321 211 :EHG 1rcuA 142 :DGK T0321 219 :GFMVKDNARAFRIVAG 1rcuA 154 :IHQAWTVEEAVQIIEQ Number of specific fragments extracted= 9 number of extra gaps= 0 total=687 Number of alignments=59 # 1rcuA read from 1rcuA/merged-good-all-a2m # found chain 1rcuA in template set Warning: unaligning (T0321)G122 because first residue in template chain is (1rcuA)M1 T0321 123 :KKVGVVGHFPH 1rcuA 2 :KKVVVVGYSGP T0321 134 :L 1rcuA 21 :L T0321 142 :CDLSILEWSPE 1rcuA 35 :KGYLVFNGGRD T0321 153 :EGDYPLPASEFILPECDYVYITCA 1rcuA 82 :TGLDFQMRSFVLLRNADVVVSIGG T0321 181 :KTLPRLLELSRNARRITLVGPGTPLAPVLF 1rcuA 108 :GTAIEILGAYALGKPVILLRGTGGWTDRIS T0321 211 :EHGLQ 1rcuA 143 :GKYLD T0321 219 :GFMVKDNARAFRIVAG 1rcuA 154 :IHQAWTVEEAVQIIEQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=694 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o4sA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1o4sA expands to /projects/compbio/data/pdb/1o4s.pdb.gz 1o4sA:Skipped atom 146, because occupancy 0.330 <= existing 0.340 in 1o4sA Skipped atom 149, because occupancy 0.330 <= existing 0.340 in 1o4sA Skipped atom 152, because occupancy 0.330 <= existing 0.340 in 1o4sA Skipped atom 155, because occupancy 0.330 <= existing 0.340 in 1o4sA Skipped atom 507, because occupancy 0.500 <= existing 0.500 in 1o4sA Skipped atom 509, because occupancy 0.500 <= existing 0.500 in 1o4sA Skipped atom 511, because occupancy 0.500 <= existing 0.500 in 1o4sA Skipped atom 513, because occupancy 0.500 <= existing 0.500 in 1o4sA Skipped atom 515, because occupancy 0.500 <= existing 0.500 in 1o4sA Skipped atom 517, because occupancy 0.500 <= existing 0.500 in 1o4sA Skipped atom 709, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 711, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 713, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 715, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 1521, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 1523, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 1525, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 1527, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 2016, because occupancy 0.500 <= existing 0.500 in 1o4sA Skipped atom 2216, because occupancy 0.350 <= existing 0.650 in 1o4sA Skipped atom 2218, because occupancy 0.350 <= existing 0.650 in 1o4sA # T0321 read from 1o4sA/merged-good-all-a2m # 1o4sA read from 1o4sA/merged-good-all-a2m # adding 1o4sA to template set # found chain 1o4sA in template set Warning: unaligning (T0321)A176 because of BadResidue code BAD_PEPTIDE in next template residue (1o4sA)N172 T0321 2 :WEIYDAMINGIPEDFLVDELVCG 1o4sA 73 :EGIAKRIGERYKKDISPDQVVVT T0321 71 :NYVEASIGLAAI 1o4sA 96 :NGAKQALFNAFM T0321 84 :AYY 1o4sA 108 :ALL T0321 120 :VKGKKVGVVGHF 1o4sA 111 :DPGDEVIVFSPV T0321 132 :PHLESLLEPICDLSILEWSPE 1o4sA 125 :SYIPQIILAGGTVNVVETFMS T0321 153 :EGDYPLPASE 1o4sA 147 :NFQPSLEEVE T0321 163 :FILPECDYVYITC 1o4sA 158 :LLVGKTKAVLINS T0321 181 :KTLPRLLELSRNARRITLVGPGTPL 1o4sA 182 :EFLEGLVRLAKKRNFYIISDEVYDS T0321 206 :APV 1o4sA 217 :LDV T0321 212 :HGLQELSGFMV 1o4sA 221 :EGFDRIVYING Number of specific fragments extracted= 10 number of extra gaps= 1 total=704 Number of alignments=61 # 1o4sA read from 1o4sA/merged-good-all-a2m # found chain 1o4sA in template set Warning: unaligning (T0321)A176 because of BadResidue code BAD_PEPTIDE in next template residue (1o4sA)N172 T0321 2 :WEIYDAMINGIPEDFLVDELVCG 1o4sA 73 :EGIAKRIGERYKKDISPDQVVVT T0321 71 :NYVEASIGLAAI 1o4sA 96 :NGAKQALFNAFM T0321 84 :AYY 1o4sA 108 :ALL T0321 103 :K 1o4sA 111 :D T0321 121 :KGKKVGVVGHF 1o4sA 112 :PGDEVIVFSPV T0321 132 :PHLESLLEPICDLSILEWSPE 1o4sA 125 :SYIPQIILAGGTVNVVETFMS T0321 153 :EGDYPLPASE 1o4sA 147 :NFQPSLEEVE T0321 163 :FILPECDYVYITC 1o4sA 158 :LLVGKTKAVLINS T0321 183 :LPRLLELSRNARRITLVGPGTP 1o4sA 184 :LEGLVRLAKKRNFYIISDEVYD T0321 205 :LAPV 1o4sA 216 :ILDV T0321 212 :HGLQELSGFMV 1o4sA 221 :EGFDRIVYING Number of specific fragments extracted= 11 number of extra gaps= 1 total=715 Number of alignments=62 # 1o4sA read from 1o4sA/merged-good-all-a2m # found chain 1o4sA in template set Warning: unaligning (T0321)A176 because of BadResidue code BAD_PEPTIDE in next template residue (1o4sA)N172 Warning: unaligning (T0321)S177 because of BadResidue code BAD_PEPTIDE at template residue (1o4sA)N172 T0321 3 :EIYDAMING 1o4sA 19 :AKAKALIKK T0321 15 :DFLVDEL 1o4sA 28 :GEDVINL T0321 35 :GVGLGPNRPF 1o4sA 35 :TAGEPDFPTP T0321 46 :TRMPMLTQNLLGLPLRVAAGCVKSWN 1o4sA 58 :GEVKYTDPRGIYELREGIAKRIGERY T0321 72 :YVEASIGLA 1o4sA 97 :GAKQALFNA T0321 82 :INAYY 1o4sA 106 :FMALL T0321 120 :VKGKKVGVVGHFPH 1o4sA 111 :DPGDEVIVFSPVWV T0321 134 :LESLLEPICDLSILEWSPE 1o4sA 127 :IPQIILAGGTVNVVETFMS T0321 153 :EGDYPLPASE 1o4sA 147 :NFQPSLEEVE T0321 163 :FILPECDYVYITC 1o4sA 158 :LLVGKTKAVLINS T0321 178 :VV 1o4sA 173 :NP T0321 181 :KTLPRLLELSRNARRITLVGPGT 1o4sA 182 :EFLEGLVRLAKKRNFYIISDEVY Number of specific fragments extracted= 12 number of extra gaps= 1 total=727 Number of alignments=63 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0321//projects/compbio/experiments/protein-predict/casp7/T0321/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0321//projects/compbio/experiments/protein-predict/casp7/T0321/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0321/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0321/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)I146.CB) [> 3.9445 = 6.5742 < 8.5464] w=1.0000 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)I146.CB) [> 3.1240 = 5.2067 < 6.7687] w=0.9998 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)L144.CB) [> 3.1653 = 5.2755 < 6.8582] w=0.9844 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)S145.CB) [> 4.2027 = 7.0045 < 9.1059] w=0.9707 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)L147.CB) [> 4.1301 = 6.8835 < 8.9485] w=0.9531 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)E148.CB) [> 3.3323 = 5.5539 < 7.2201] w=0.9199 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)S145.CB) [> 2.9765 = 4.9608 < 6.4490] w=0.9129 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)L147.CB) [> 3.9640 = 6.6067 < 8.5887] w=0.8852 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)D143.CB) [> 4.0097 = 6.6828 < 8.6876] w=0.8830 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)L144.CB) [> 3.7829 = 6.3048 < 8.1962] w=0.8752 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)Y170.CB) [> 3.0517 = 5.0862 < 6.6120] w=0.8716 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)E148.CB) [> 3.1204 = 5.2007 < 6.7609] w=0.8685 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)L147.CB) [> 3.0876 = 5.1460 < 6.6898] w=0.8672 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)C168.CB) [> 2.9373 = 4.8955 < 6.3641] w=0.8624 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)L147.CB) [> 3.9751 = 6.6251 < 8.6126] w=0.8609 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)S145.CB) [> 4.2723 = 7.1205 < 9.2566] w=0.8499 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)Y172.CB) [> 3.7388 = 6.2313 < 8.1007] w=0.8444 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)Y170.CB) [> 4.0792 = 6.7986 < 8.8382] w=0.8444 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)C168.CB) [> 3.9836 = 6.6393 < 8.6310] w=0.8444 to align # Constraint # added constraint: constraint((T0321)K124.CB, (T0321)S145.CB) [> 3.8292 = 6.3820 < 8.2966] w=0.8244 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)I173.CB) [> 3.2028 = 5.3379 < 6.9393] w=0.8186 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)C142.CB) [> 3.0133 = 5.0222 < 6.5289] w=0.8181 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)Y172.CB) [> 4.2271 = 7.0451 < 9.1587] w=0.8165 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)Y172.CB) [> 3.0796 = 5.1327 < 6.6725] w=0.8152 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)L144.CB) [> 3.6773 = 6.1288 < 7.9675] w=0.8027 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)V171.CB) [> 3.1154 = 5.1923 < 6.7499] w=0.7880 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)Y172.CB) [> 3.9560 = 6.5933 < 8.5713] w=0.7880 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)V171.CB) [> 4.5444 = 7.5740 < 9.8462] w=0.7880 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)D169.CB) [> 4.0925 = 6.8208 < 8.8670] w=0.7860 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)C168.CB) [> 4.1008 = 6.8346 < 8.8850] w=0.7843 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)V199.CB) [> 3.5548 = 5.9247 < 7.7021] w=0.7604 to align # Constraint # added constraint: constraint((T0321)K124.CB, (T0321)D143.CB) [> 2.8754 = 4.7923 < 6.2300] w=0.7349 to align # Constraint # added constraint: constraint((T0321)K124.CB, (T0321)C168.CB) [> 3.0412 = 5.0686 < 6.5892] w=0.7294 to align # Constraint # added constraint: constraint((T0321)K124.CB, (T0321)D169.CB) [> 3.1713 = 5.2855 < 6.8711] w=0.7294 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)I146.CB) [> 4.1143 = 6.8572 < 8.9143] w=0.7275 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)T197.CB) [> 4.0187 = 6.6978 < 8.7071] w=0.7255 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)L198.CB) [> 3.8925 = 6.4874 < 8.4337] w=0.7119 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)V171.CB) [> 3.9975 = 6.6625 < 8.6612] w=0.7090 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)G200.CA) [> 3.8086 = 6.3477 < 8.2521] w=0.7085 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)S190.CB) [> 3.9509 = 6.5848 < 8.5603] w=0.6899 to align # Constraint # added constraint: constraint((T0321)K124.CB, (T0321)E167.CB) [> 3.5758 = 5.9597 < 7.7476] w=0.6862 to align # Constraint # added constraint: constraint((T0321)K123.CB, (T0321)D169.CB) [> 2.7927 = 4.6545 < 6.0509] w=0.6862 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)L137.CB) [> 3.2357 = 5.3928 < 7.0106] w=0.6839 to align # Constraint # added constraint: constraint((T0321)C168.CB, (T0321)R194.CB) [> 3.8228 = 6.3713 < 8.2827] w=0.6771 to align # Constraint # added constraint: constraint((T0321)D169.CB, (T0321)R194.CB) [> 3.5842 = 5.9738 < 7.7659] w=0.6750 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)R194.CB) [> 3.9305 = 6.5509 < 8.5161] w=0.6750 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)I146.CB) [> 3.2056 = 5.3426 < 6.9454] w=0.6723 to align # Constraint # added constraint: constraint((T0321)K123.CB, (T0321)D143.CB) [> 3.9753 = 6.6255 < 8.6131] w=0.6529 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)R194.CB) [> 3.9908 = 6.6514 < 8.6468] w=0.6504 to align # Constraint # added constraint: constraint((T0321)K123.CB, (T0321)C142.CB) [> 3.4395 = 5.7325 < 7.4522] w=0.6464 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)I146.CB) [> 4.3818 = 7.3030 < 9.4939] w=0.6436 to align # Constraint # added constraint: constraint((T0321)L134.CB, (T0321)I146.CB) [> 3.8622 = 6.4370 < 8.3680] w=0.6427 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)T197.CB) [> 4.2230 = 7.0384 < 9.1499] w=0.6418 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)I196.CB) [> 3.5493 = 5.9155 < 7.6901] w=0.6407 to align # Constraint # added constraint: constraint((T0321)K124.CB, (T0321)C142.CB) [> 4.2506 = 7.0843 < 9.2095] w=0.6402 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)I173.CB) [> 4.3943 = 7.3238 < 9.5210] w=0.6397 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)V199.CB) [> 3.8814 = 6.4690 < 8.4098] w=0.6347 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)T197.CB) [> 3.6957 = 6.1595 < 8.0073] w=0.6308 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)I196.CB) [> 3.6566 = 6.0944 < 7.9227] w=0.6188 to align # Constraint # added constraint: constraint((T0321)L165.CB, (T0321)S190.CB) [> 3.2877 = 5.4794 < 7.1233] w=0.6097 to align # Constraint # added constraint: constraint((T0321)G122.CA, (T0321)D143.CB) [> 3.6946 = 6.1578 < 8.0051] w=0.6086 to align # Constraint # added constraint: constraint((T0321)K121.CB, (T0321)I141.CB) [> 2.8440 = 4.7400 < 6.1620] w=0.6064 to align # Constraint # added constraint: constraint((T0321)L134.CB, (T0321)L144.CB) [> 3.1657 = 5.2761 < 6.8590] w=0.5769 to align # Constraint # added constraint: constraint((T0321)L165.CB, (T0321)L189.CB) [> 2.7416 = 4.5693 < 5.9401] w=0.5704 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)E148.CB) [> 4.2706 = 7.1176 < 9.2529] w=0.5664 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)L137.CB) [> 4.3556 = 7.2594 < 9.4372] w=0.5641 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)I164.CB) [> 3.3845 = 5.6408 < 7.3331] w=0.5603 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)W149.CB) [> 4.1129 = 6.8548 < 8.9113] w=0.5534 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)I164.CB) [> 3.3867 = 5.6444 < 7.3378] w=0.5513 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)T197.CB) [> 3.7943 = 6.3238 < 8.2210] w=0.5366 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)I164.CB) [> 3.2690 = 5.4483 < 7.0828] w=0.5338 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)V171.CB) [> 4.6223 = 7.7038 < 10.0149] w=0.5323 to align # Constraint # added constraint: constraint((T0321)P166.CB, (T0321)L189.CB) [> 3.5303 = 5.8839 < 7.6490] w=0.5317 to align # Constraint # added constraint: constraint((T0321)K124.CB, (T0321)Y170.CB) [> 4.5595 = 7.5992 < 9.8790] w=0.5296 to align # Constraint # added constraint: constraint((T0321)V120.CB, (T0321)C142.CB) [> 3.4465 = 5.7442 < 7.4675] w=0.5086 to align # Constraint # added constraint: constraint((T0321)E162.CB, (T0321)L189.CB) [> 3.4693 = 5.7822 < 7.5168] w=0.4955 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)L198.CB) [> 3.9151 = 6.5252 < 8.4828] w=0.4786 to align # Constraint # added constraint: constraint((T0321)D169.CB, (T0321)R191.CB) [> 3.9116 = 6.5193 < 8.4750] w=0.4785 to align # Constraint # added constraint: constraint((T0321)C168.CB, (T0321)S190.CB) [> 4.0575 = 6.7625 < 8.7912] w=0.4785 to align # Constraint # added constraint: constraint((T0321)P166.CB, (T0321)R191.CB) [> 4.0419 = 6.7364 < 8.7573] w=0.4785 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)S161.CB) [> 3.4839 = 5.8064 < 7.5484] w=0.4755 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)T174.CB) [> 3.7965 = 6.3275 < 8.2258] w=0.4754 to align # Constraint # added constraint: constraint((T0321)K123.CB, (T0321)Y170.CB) [> 3.8473 = 6.4123 < 8.3359] w=0.4713 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)L198.CB) [> 3.4352 = 5.7253 < 7.4429] w=0.4692 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)L198.CB) [> 3.9732 = 6.6220 < 8.6086] w=0.4650 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)L217.CB) [> 3.6615 = 6.1024 < 7.9332] w=0.4612 to align # Constraint # added constraint: constraint((T0321)V120.CB, (T0321)I141.CB) [> 3.6939 = 6.1565 < 8.0034] w=0.4544 to align # Constraint # added constraint: constraint((T0321)V120.CB, (T0321)P140.CB) [> 3.6468 = 6.0780 < 7.9013] w=0.4496 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)L186.CB) [> 3.8723 = 6.4539 < 8.3901] w=0.4441 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)C175.CB) [> 3.2237 = 5.3729 < 6.9847] w=0.4381 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)L217.CB) [> 3.9379 = 6.5631 < 8.5321] w=0.4378 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)L147.CB) [> 4.2486 = 7.0810 < 9.2054] w=0.4362 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)G200.CA) [> 3.7959 = 6.3266 < 8.2245] w=0.4285 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)T174.CB) [> 3.1196 = 5.1993 < 6.7591] w=0.4198 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)G219.CA) [> 3.8817 = 6.4695 < 8.4104] w=0.4098 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)I164.CB) [> 4.1380 = 6.8967 < 8.9657] w=0.4063 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)S161.CB) [> 3.8521 = 6.4202 < 8.3463] w=0.4061 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)G200.CA) [> 4.1333 = 6.8888 < 8.9555] w=0.4054 to align # Constraint # added constraint: constraint((T0321)L165.CB, (T0321)L186.CB) [> 3.5999 = 5.9998 < 7.7997] w=0.3989 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)P201.CB) [> 3.6109 = 6.0182 < 7.8237] w=0.3953 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)S218.CB) [> 3.8129 = 6.3548 < 8.2613] w=0.3951 to align # Constraint # added constraint: constraint((T0321)R194.CB, (T0321)L214.CB) [> 3.4134 = 5.6890 < 7.3957] w=0.3945 to align # Constraint # added constraint: constraint((T0321)I196.CB, (T0321)L217.CB) [> 3.8973 = 6.4955 < 8.4442] w=0.3939 to align # Constraint # added constraint: constraint((T0321)I196.CB, (T0321)E216.CB) [> 3.7710 = 6.2850 < 8.1706] w=0.3910 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)Y172.CB) [> 3.7298 = 6.2163 < 8.0812] w=0.3884 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)G219.CA) [> 3.4529 = 5.7548 < 7.4812] w=0.3861 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)R195.CB) [> 3.0809 = 5.1348 < 6.6753] w=0.3837 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)I164.CB) [> 4.1680 = 6.9466 < 9.0306] w=0.3803 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)E167.CB) [> 3.9436 = 6.5727 < 8.5445] w=0.3780 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)E216.CB) [> 4.2089 = 7.0148 < 9.1193] w=0.3775 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)T174.CB) [> 3.7944 = 6.3240 < 8.2213] w=0.3761 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)C175.CB) [> 3.5859 = 5.9765 < 7.7695] w=0.3620 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)W149.CB) [> 3.6447 = 6.0745 < 7.8968] w=0.3601 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)S150.CB) [> 3.9202 = 6.5337 < 8.4937] w=0.3571 to align # Constraint # added constraint: constraint((T0321)G200.CA, (T0321)G219.CA) [> 3.6623 = 6.1038 < 7.9349] w=0.3550 to align # Constraint # added constraint: constraint((T0321)F131.CB, (T0321)T174.CB) [> 3.5012 = 5.8354 < 7.5860] w=0.3533 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)I196.CB) [> 4.0298 = 6.7163 < 8.7312] w=0.3411 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)G200.CA) [> 3.6803 = 6.1338 < 7.9739] w=0.3373 to align # Constraint # added constraint: constraint((T0321)F131.CB, (T0321)E148.CB) [> 4.4167 = 7.3612 < 9.5696] w=0.3372 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)L214.CB) [> 3.3379 = 5.5632 < 7.2322] w=0.3357 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)S218.CB) [> 3.6001 = 6.0001 < 7.8002] w=0.3307 to align # Constraint # added constraint: constraint((T0321)I196.CB, (T0321)Q215.CB) [> 3.6111 = 6.0185 < 7.8241] w=0.3291 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)I231.CB) [> 2.9080 = 4.8467 < 6.3007] w=0.3193 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)A228.CB) [> 4.0168 = 6.6947 < 8.7031] w=0.3193 to align # Constraint # added constraint: constraint((T0321)F131.CB, (T0321)C175.CB) [> 4.1181 = 6.8634 < 8.9225] w=0.3177 to align # Constraint # added constraint: constraint((T0321)A193.CB, (T0321)L214.CB) [> 4.3192 = 7.1987 < 9.3583] w=0.3175 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)Y156.CB) [> 4.0816 = 6.8027 < 8.8435] w=0.3128 to align # Constraint # added constraint: constraint((T0321)F131.CB, (T0321)A176.CB) [> 4.3398 = 7.2330 < 9.4029] w=0.3049 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)V199.CB) [> 3.5072 = 5.8454 < 7.5990] w=0.3033 to align # Constraint # added constraint: constraint((T0321)V120.CB, (T0321)Y170.CB) [> 4.5845 = 7.6408 < 9.9331] w=0.3019 to align # Constraint # added constraint: constraint((T0321)N192.CB, (T0321)G213.CA) [> 3.8627 = 6.4379 < 8.3692] w=0.2987 to align # Constraint # added constraint: constraint((T0321)Y85.CB, (T0321)Y170.CB) [> 4.1895 = 6.9825 < 9.0772] w=0.2974 to align # Constraint # added constraint: constraint((T0321)R194.CB, (T0321)Q215.CB) [> 4.3266 = 7.2109 < 9.3742] w=0.2916 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)Y156.CB) [> 3.6028 = 6.0046 < 7.8060] w=0.2907 to align # Constraint # added constraint: constraint((T0321)D169.CB, (T0321)A193.CB) [> 4.2574 = 7.0957 < 9.2244] w=0.2906 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)E216.CB) [> 3.2823 = 5.4704 < 7.1116] w=0.2906 to align # Constraint # added constraint: constraint((T0321)S161.CB, (T0321)L186.CB) [> 4.2545 = 7.0908 < 9.2181] w=0.2895 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)L214.CB) [> 4.1139 = 6.8566 < 8.9135] w=0.2894 to align # Constraint # added constraint: constraint((T0321)G200.CA, (T0321)S218.CB) [> 3.9081 = 6.5135 < 8.4676] w=0.2880 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)R195.CB) [> 4.1125 = 6.8541 < 8.9103] w=0.2858 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)G202.CA) [> 4.1936 = 6.9893 < 9.0861] w=0.2857 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)A160.CB) [> 3.8128 = 6.3548 < 8.2612] w=0.2854 to align # Constraint # added constraint: constraint((T0321)R195.CB, (T0321)E216.CB) [> 3.8495 = 6.4159 < 8.3406] w=0.2842 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)H212.CB) [> 3.8097 = 6.3496 < 8.2544] w=0.2831 to align # Constraint # added constraint: constraint((T0321)S161.CB, (T0321)R185.CB) [> 3.5129 = 5.8549 < 7.6114] w=0.2787 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)I231.CB) [> 4.4673 = 7.4454 < 9.6791] w=0.2779 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)T174.CB) [> 4.3836 = 7.3059 < 9.4977] w=0.2760 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)L186.CB) [> 4.2115 = 7.0191 < 9.1249] w=0.2759 to align # Constraint # added constraint: constraint((T0321)G200.CA, (T0321)F220.CB) [> 3.2783 = 5.4638 < 7.1029] w=0.2744 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)V120.CB) [> 4.0159 = 6.6931 < 8.7011] w=0.2740 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)F220.CB) [> 3.6491 = 6.0819 < 7.9064] w=0.2740 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)L186.CB) [> 3.7787 = 6.2978 < 8.1871] w=0.2683 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)T174.CB) [> 3.4034 = 5.6724 < 7.3741] w=0.2672 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)L158.CB) [> 3.4871 = 5.8118 < 7.5553] w=0.2633 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)S218.CB) [> 3.4886 = 5.8143 < 7.5586] w=0.2602 to align # Constraint # added constraint: constraint((T0321)V120.CB, (T0321)L137.CB) [> 4.2179 = 7.0299 < 9.1389] w=0.2552 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)L217.CB) [> 4.3250 = 7.2084 < 9.3709] w=0.2547 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)I196.CB) [> 4.0849 = 6.8081 < 8.8505] w=0.2544 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)P157.CB) [> 4.1572 = 6.9286 < 9.0072] w=0.2537 to align # Constraint # added constraint: constraint((T0321)G200.CA, (T0321)M221.CB) [> 4.2177 = 7.0296 < 9.1384] w=0.2500 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)G219.CA) [> 3.6669 = 6.1115 < 7.9449] w=0.2423 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)F163.CB) [> 4.3020 = 7.1700 < 9.3210] w=0.2369 to align # Constraint # added constraint: constraint((T0321)R195.CB, (T0321)L217.CB) [> 4.0155 = 6.6926 < 8.7003] w=0.2364 to align # Constraint # added constraint: constraint((T0321)I164.CB, (T0321)L189.CB) [> 3.9092 = 6.5153 < 8.4699] w=0.2323 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)P201.CB) [> 3.8575 = 6.4291 < 8.3578] w=0.2306 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)G200.CA) [> 3.9441 = 6.5734 < 8.5455] w=0.2305 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)F220.CB) [> 4.3604 = 7.2673 < 9.4475] w=0.2203 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)L183.CB) [> 4.5935 = 7.6558 < 9.9525] w=0.2191 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)A206.CB) [> 4.0627 = 6.7712 < 8.8026] w=0.2170 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)Y170.CB) [> 4.4721 = 7.4535 < 9.6896] w=0.2149 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)R230.CB) [> 4.6916 = 7.8194 < 10.1652] w=0.2124 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)I196.CB) [> 3.9914 = 6.6524 < 8.6481] w=0.2100 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)F220.CB) [> 3.9962 = 6.6604 < 8.6585] w=0.2077 to align # Constraint # added constraint: constraint((T0321)P184.CB, (T0321)R227.CB) [> 2.5631 = 4.2718 < 5.5533] w=0.2070 to align # Constraint # added constraint: constraint((T0321)G202.CA, (T0321)F220.CB) [> 3.0107 = 5.0178 < 6.5231] w=0.2062 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)H133.CB) [> 3.6174 = 6.0290 < 7.8377] w=0.2057 to align # Constraint # added constraint: constraint((T0321)S161.CB, (T0321)V171.CB) [> 4.0886 = 6.8144 < 8.8587] w=0.2056 to align # Constraint # added constraint: constraint((T0321)L165.CB, (T0321)E188.CB) [> 3.5116 = 5.8526 < 7.6084] w=0.2055 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)I146.CB) [> 3.6330 = 6.0551 < 7.8716] w=0.2014 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)S136.CB) [> 3.5074 = 5.8457 < 7.5994] w=0.1989 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)V208.CB) [> 3.4746 = 5.7911 < 7.5284] w=0.1929 to align # Constraint # added constraint: constraint((T0321)G202.CA, (T0321)M221.CB) [> 3.8398 = 6.3996 < 8.3195] w=0.1924 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)H212.CB) [> 4.1734 = 6.9556 < 9.0423] w=0.1924 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)P201.CB) [> 3.7984 = 6.3308 < 8.2300] w=0.1866 to align # Constraint # added constraint: constraint((T0321)T203.CB, (T0321)F220.CB) [> 4.0702 = 6.7836 < 8.8187] w=0.1856 to align # Constraint # added constraint: constraint((T0321)L158.CB, (T0321)L186.CB) [> 4.2740 = 7.1233 < 9.2602] w=0.1853 to align # Constraint # added constraint: constraint((T0321)L134.CB, (T0321)Y172.CB) [> 3.9470 = 6.5784 < 8.5519] w=0.1840 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)Q215.CB) [> 3.9140 = 6.5233 < 8.4803] w=0.1800 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)L205.CB) [> 3.3068 = 5.5113 < 7.1647] w=0.1783 to align # Constraint # added constraint: constraint((T0321)C142.CB, (T0321)Y170.CB) [> 4.4824 = 7.4706 < 9.7118] w=0.1781 to align # Constraint # added constraint: constraint((T0321)S76.CB, (T0321)Y172.CB) [> 3.6533 = 6.0889 < 7.9156] w=0.1766 to align # Constraint # added constraint: constraint((T0321)L134.CB, (T0321)T174.CB) [> 3.4508 = 5.7514 < 7.4768] w=0.1734 to align # Constraint # added constraint: constraint((T0321)G78.CA, (T0321)S136.CB) [> 3.1957 = 5.3262 < 6.9240] w=0.1727 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)E216.CB) [> 3.6182 = 6.0303 < 7.8394] w=0.1717 to align # Constraint # added constraint: constraint((T0321)V73.CB, (T0321)H133.CB) [> 2.7345 = 4.5576 < 5.9248] w=0.1714 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)C175.CB) [> 4.2405 = 7.0675 < 9.1878] w=0.1708 to align # Constraint # added constraint: constraint((T0321)E148.CB, (T0321)S161.CB) [> 3.5262 = 5.8770 < 7.6402] w=0.1703 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)L209.CB) [> 4.0806 = 6.8010 < 8.8413] w=0.1680 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)L137.CB) [> 4.2955 = 7.1591 < 9.3068] w=0.1676 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)F220.CB) [> 3.5464 = 5.9107 < 7.6838] w=0.1668 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)V199.CB) [> 3.9805 = 6.6342 < 8.6245] w=0.1662 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)L205.CB) [> 3.8558 = 6.4263 < 8.3542] w=0.1659 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)V199.CB) [> 3.5638 = 5.9397 < 7.7216] w=0.1652 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)V199.CB) [> 3.8720 = 6.4533 < 8.3893] w=0.1643 to align # Constraint # added constraint: constraint((T0321)A84.CB, (T0321)T197.CB) [> 3.5038 = 5.8396 < 7.5915] w=0.1638 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)V208.CB) [> 3.3010 = 5.5016 < 7.1521] w=0.1637 to align # Constraint # added constraint: constraint((T0321)G202.CA, (T0321)V222.CB) [> 3.9562 = 6.5936 < 8.5717] w=0.1632 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)V171.CB) [> 4.3320 = 7.2201 < 9.3861] w=0.1630 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)I173.CB) [> 4.1819 = 6.9699 < 9.0608] w=0.1620 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)M221.CB) [> 4.4665 = 7.4442 < 9.6775] w=0.1609 to align # Constraint # added constraint: constraint((T0321)Q117.CB, (T0321)P140.CB) [> 3.4041 = 5.6735 < 7.3756] w=0.1603 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)A176.CB) [> 3.2629 = 5.4382 < 7.0697] w=0.1603 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)L137.CB) [> 4.3658 = 7.2764 < 9.4593] w=0.1603 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)A228.CB) [> 4.2159 = 7.0266 < 9.1345] w=0.1597 to align # Constraint # added constraint: constraint((T0321)Q117.CB, (T0321)I141.CB) [> 4.2592 = 7.0987 < 9.2284] w=0.1595 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)M221.CB) [> 4.4383 = 7.3971 < 9.6162] w=0.1589 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)L165.CB) [> 4.3596 = 7.2661 < 9.4459] w=0.1577 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)L137.CB) [> 3.8479 = 6.4132 < 8.3372] w=0.1576 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)Y172.CB) [> 4.0226 = 6.7043 < 8.7156] w=0.1575 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)I164.CB) [> 4.6722 = 7.7871 < 10.1232] w=0.1572 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)E148.CB) [> 4.0508 = 6.7513 < 8.7767] w=0.1565 to align # Constraint # added constraint: constraint((T0321)V73.CB, (T0321)S136.CB) [> 4.0482 = 6.7469 < 8.7710] w=0.1545 to align # Constraint # added constraint: constraint((T0321)T203.CB, (T0321)N225.CB) [> 4.3697 = 7.2829 < 9.4677] w=0.1539 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)G39.CA) [> 3.8715 = 6.4525 < 8.3883] w=0.1527 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)I196.CB) [> 4.3704 = 7.2840 < 9.4692] w=0.1510 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)L38.CB) [> 3.4847 = 5.8078 < 7.5501] w=0.1494 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)Y170.CB) [> 3.9287 = 6.5479 < 8.5123] w=0.1480 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)G219.CA) [> 4.0277 = 6.7129 < 8.7267] w=0.1479 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)V120.CB) [> 3.9807 = 6.6345 < 8.6249] w=0.1478 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)H212.CB) [> 3.5215 = 5.8692 < 7.6300] w=0.1478 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)P201.CB) [> 3.6451 = 6.0752 < 7.8977] w=0.1469 to align # Constraint # added constraint: constraint((T0321)V29.CB, (T0321)G39.CA) [> 4.2124 = 7.0206 < 9.1268] w=0.1464 to align # Constraint # added constraint: constraint((T0321)V179.CB, (T0321)D224.CB) [> 3.7691 = 6.2819 < 8.1665] w=0.1461 to align # Constraint # added constraint: constraint((T0321)V179.CB, (T0321)A228.CB) [> 4.1857 = 6.9761 < 9.0690] w=0.1461 to align # Constraint # added constraint: constraint((T0321)D180.CB, (T0321)D224.CB) [> 2.6958 = 4.4931 < 5.8410] w=0.1461 to align # Constraint # added constraint: constraint((T0321)D180.CB, (T0321)R227.CB) [> 3.0671 = 5.1119 < 6.6455] w=0.1461 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)Y170.CB) [> 4.0535 = 6.7559 < 8.7826] w=0.1456 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)G154.CA) [> 3.6997 = 6.1662 < 8.0160] w=0.1453 to align # Constraint # added constraint: constraint((T0321)L144.CB, (T0321)G154.CA) [> 3.3284 = 5.5474 < 7.2116] w=0.1453 to align # Constraint # added constraint: constraint((T0321)L144.CB, (T0321)E153.CB) [> 3.2428 = 5.4047 < 7.0261] w=0.1453 to align # Constraint # added constraint: constraint((T0321)Y5.CB, (T0321)V18.CB) [> 3.2765 = 5.4608 < 7.0990] w=0.1448 to align # Constraint # added constraint: constraint((T0321)Y85.CB, (T0321)V120.CB) [> 3.4044 = 5.6739 < 7.3761] w=0.1448 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)S218.CB) [> 3.6600 = 6.0999 < 7.9299] w=0.1437 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)A206.CB) [> 3.9155 = 6.5258 < 8.4835] w=0.1426 to align # Constraint # added constraint: constraint((T0321)W149.CB, (T0321)A160.CB) [> 3.9610 = 6.6016 < 8.5821] w=0.1420 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)P140.CB) [> 3.8642 = 6.4403 < 8.3724] w=0.1413 to align # Constraint # added constraint: constraint((T0321)I196.CB, (T0321)S218.CB) [> 4.1276 = 6.8793 < 8.9431] w=0.1409 to align # Constraint # added constraint: constraint((T0321)T203.CB, (T0321)S218.CB) [> 4.4966 = 7.4943 < 9.7426] w=0.1404 to align # Constraint # added constraint: constraint((T0321)G200.CA, (T0321)L217.CB) [> 3.7160 = 6.1933 < 8.0512] w=0.1380 to align # Constraint # added constraint: constraint((T0321)Y85.CB, (T0321)I196.CB) [> 3.4545 = 5.7575 < 7.4847] w=0.1379 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)L134.CB) [> 4.5257 = 7.5429 < 9.8058] w=0.1366 to align # Constraint # added constraint: constraint((T0321)S76.CB, (T0321)G200.CA) [> 4.1020 = 6.8366 < 8.8876] w=0.1365 to align # Constraint # added constraint: constraint((T0321)P204.CB, (T0321)N225.CB) [> 4.2417 = 7.0695 < 9.1903] w=0.1345 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)G154.CA) [> 3.4324 = 5.7207 < 7.4369] w=0.1336 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)L138.CB) [> 3.2869 = 5.4781 < 7.1216] w=0.1327 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)V199.CB) [> 4.0974 = 6.8290 < 8.8777] w=0.1318 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)T197.CB) [> 4.4778 = 7.4631 < 9.7020] w=0.1311 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)F163.CB) [> 3.7267 = 6.2112 < 8.0745] w=0.1311 to align # Constraint # added constraint: constraint((T0321)A206.CB, (T0321)E216.CB) [> 3.1167 = 5.1945 < 6.7529] w=0.1307 to align # Constraint # added constraint: constraint((T0321)L138.CB, (T0321)E153.CB) [> 3.6506 = 6.0844 < 7.9096] w=0.1301 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)A176.CB) [> 3.4292 = 5.7153 < 7.4299] w=0.1298 to align # Constraint # added constraint: constraint((T0321)H27.CB, (T0321)G39.CA) [> 3.5313 = 5.8856 < 7.6512] w=0.1275 to align # Constraint # added constraint: constraint((T0321)V178.CB, (T0321)L205.CB) [> 3.4672 = 5.7786 < 7.5122] w=0.1274 to align # Constraint # added constraint: constraint((T0321)P204.CB, (T0321)F220.CB) [> 3.8233 = 6.3722 < 8.2839] w=0.1272 to align # Constraint # added constraint: constraint((T0321)I9.CB, (T0321)V18.CB) [> 3.7074 = 6.1791 < 8.0328] w=0.1265 to align # Constraint # added constraint: constraint((T0321)P204.CB, (T0321)K223.CB) [> 4.2781 = 7.1301 < 9.2691] w=0.1235 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)P151.CB) [> 4.2745 = 7.1242 < 9.2614] w=0.1230 to align # Constraint # added constraint: constraint((T0321)V179.CB, (T0321)A206.CB) [> 3.3402 = 5.5670 < 7.2371] w=0.1222 to align # Constraint # added constraint: constraint((T0321)L137.CB, (T0321)Y172.CB) [> 4.5529 = 7.5882 < 9.8647] w=0.1216 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)V199.CB) [> 3.4364 = 5.7274 < 7.4456] w=0.1200 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)I231.CB) [> 3.8155 = 6.3592 < 8.2669] w=0.1196 to align # Constraint # added constraint: constraint((T0321)E74.CB, (T0321)S136.CB) [> 4.0033 = 6.6721 < 8.6737] w=0.1195 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)L138.CB) [> 3.8154 = 6.3589 < 8.2666] w=0.1194 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)L198.CB) [> 3.3147 = 5.5244 < 7.1817] w=0.1190 to align # Constraint # added constraint: constraint((T0321)K123.CB, (T0321)L144.CB) [> 3.5303 = 5.8838 < 7.6489] w=0.1169 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)S190.CB) [> 4.3477 = 7.2462 < 9.4201] w=0.1155 to align # Constraint # added constraint: constraint((T0321)G200.CA, (T0321)V222.CB) [> 3.6383 = 6.0638 < 7.8829] w=0.1153 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)V120.CB) [> 4.1776 = 6.9627 < 9.0515] w=0.1144 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)P201.CB) [> 4.0316 = 6.7193 < 8.7352] w=0.1130 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)C175.CB) [> 3.2886 = 5.4811 < 7.1254] w=0.1117 to align # Constraint # added constraint: constraint((T0321)H27.CB, (T0321)L38.CB) [> 4.0615 = 6.7691 < 8.7999] w=0.1113 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)T182.CB) [> 3.8744 = 6.4574 < 8.3946] w=0.1113 to align # Constraint # added constraint: constraint((T0321)G202.CA, (T0321)G219.CA) [> 3.2251 = 5.3752 < 6.9878] w=0.1108 to align # Constraint # added constraint: constraint((T0321)F113.CB, (T0321)L137.CB) [> 3.0722 = 5.1204 < 6.6565] w=0.1102 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)V125.CB) [> 4.1781 = 6.9634 < 9.0525] w=0.1098 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)E211.CB) [> 4.6379 = 7.7299 < 10.0489] w=0.1097 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)G202.CA) [> 4.1711 = 6.9518 < 9.0374] w=0.1087 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)C175.CB) [> 3.7752 = 6.2921 < 8.1797] w=0.1078 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)S136.CB) [> 3.3949 = 5.6582 < 7.3556] w=0.1077 to align # Constraint # added constraint: constraint((T0321)F210.CB, (T0321)A235.CB) [> 2.8725 = 4.7876 < 6.2238] w=0.1076 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)D224.CB) [> 3.6263 = 6.0438 < 7.8569] w=0.1076 to align # Constraint # added constraint: constraint((T0321)A193.CB, (T0321)A235.CB) [> 4.2982 = 7.1637 < 9.3128] w=0.1074 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)S136.CB) [> 3.2111 = 5.3519 < 6.9575] w=0.1073 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)P204.CB) [> 3.5887 = 5.9811 < 7.7755] w=0.1068 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)G202.CA) [> 4.1675 = 6.9458 < 9.0296] w=0.1058 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)G200.CA) [> 4.6312 = 7.7188 < 10.0344] w=0.1058 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)T203.CB) [> 3.7526 = 6.2543 < 8.1306] w=0.1047 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)V178.CB) [> 4.1438 = 6.9064 < 8.9783] w=0.1046 to align # Constraint # added constraint: constraint((T0321)V178.CB, (T0321)K223.CB) [> 4.3342 = 7.2237 < 9.3908] w=0.1046 to align # Constraint # added constraint: constraint((T0321)V179.CB, (T0321)K223.CB) [> 2.5159 = 4.1932 < 5.4511] w=0.1046 to align # Constraint # added constraint: constraint((T0321)Y72.CB, (T0321)P201.CB) [> 4.0121 = 6.6869 < 8.6930] w=0.1038 to align # Constraint # added constraint: constraint((T0321)R195.CB, (T0321)S218.CB) [> 3.5254 = 5.8756 < 7.6383] w=0.1038 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)L217.CB) [> 4.3940 = 7.3233 < 9.5203] w=0.1038 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)S190.CB) [> 4.5758 = 7.6264 < 9.9143] w=0.1038 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)L217.CB) [> 3.9985 = 6.6641 < 8.6633] w=0.1026 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)G37.CA) [> 3.4892 = 5.8153 < 7.5599] w=0.1024 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)G202.CA) [> 3.8613 = 6.4355 < 8.3662] w=0.1023 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)V199.CB) [> 3.9444 = 6.5740 < 8.5462] w=0.1018 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)G200.CA) [> 4.3515 = 7.2526 < 9.4284] w=0.1013 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)L147.CB) [> 4.1047 = 6.8411 < 8.8934] w=0.1008 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)A228.CB) [> 4.4532 = 7.4220 < 9.6486] w=0.1006 to align # Constraint # added constraint: constraint((T0321)P132.CB, (T0321)A226.CB) [> 3.7090 = 6.1817 < 8.0363] w=0.1006 to align # Constraint # added constraint: constraint((T0321)F131.CB, (T0321)N225.CB) [> 3.9301 = 6.5501 < 8.5152] w=0.1006 to align # Constraint # added constraint: constraint((T0321)V67.CB, (T0321)Y172.CB) [> 3.0545 = 5.0908 < 6.6180] w=0.0997 to align # Constraint # added constraint: constraint((T0321)A193.CB, (T0321)E236.CB) [> 4.7174 = 7.8623 < 10.2210] w=0.0992 to align # Constraint # added constraint: constraint((T0321)G122.CA, (T0321)L144.CB) [> 3.7690 = 6.2816 < 8.1661] w=0.0992 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)L198.CB) [> 4.5693 = 7.6156 < 9.9003] w=0.0988 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)A228.CB) [> 4.2031 = 7.0052 < 9.1068] w=0.0984 to align # Constraint # added constraint: constraint((T0321)V29.CB, (T0321)L38.CB) [> 3.9806 = 6.6343 < 8.6246] w=0.0950 to align # Constraint # added constraint: constraint((T0321)V120.CB, (T0321)L144.CB) [> 3.4843 = 5.8072 < 7.5493] w=0.0949 to align # Constraint # added constraint: constraint((T0321)T182.CB, (T0321)A206.CB) [> 2.5946 = 4.3243 < 5.6216] w=0.0947 to align # Constraint # added constraint: constraint((T0321)F220.CB, (T0321)I231.CB) [> 3.2859 = 5.4764 < 7.1194] w=0.0943 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)M221.CB) [> 4.1814 = 6.9690 < 9.0597] w=0.0942 to align # Constraint # added constraint: constraint((T0321)A92.CB, (T0321)R104.CB) [> 4.0608 = 6.7680 < 8.7983] w=0.0942 to align # Constraint # added constraint: constraint((T0321)S116.CB, (T0321)P140.CB) [> 3.2018 = 5.3363 < 6.9372] w=0.0942 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)P140.CB) [> 3.2438 = 5.4064 < 7.0283] w=0.0932 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)P201.CB) [> 4.2873 = 7.1455 < 9.2892] w=0.0928 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)S218.CB) [> 3.6365 = 6.0608 < 7.8791] w=0.0927 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)V120.CB) [> 4.1495 = 6.9158 < 8.9905] w=0.0924 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)L137.CB) [> 4.1150 = 6.8583 < 8.9158] w=0.0917 to align # Constraint # added constraint: constraint((T0321)T182.CB, (T0321)T203.CB) [> 4.0163 = 6.6938 < 8.7019] w=0.0912 to align # Constraint # added constraint: constraint((T0321)A75.CB, (T0321)G200.CA) [> 4.4326 = 7.3877 < 9.6040] w=0.0905 to align # Constraint # added constraint: constraint((T0321)L134.CB, (T0321)G154.CA) [> 3.6617 = 6.1029 < 7.9337] w=0.0902 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)T203.CB) [> 3.9146 = 6.5244 < 8.4817] w=0.0894 to align # Constraint # added constraint: constraint((T0321)S177.CB, (T0321)G202.CA) [> 3.9175 = 6.5291 < 8.4879] w=0.0894 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)Y170.CB) [> 4.0269 = 6.7114 < 8.7249] w=0.0890 to align # Constraint # added constraint: constraint((T0321)E106.CB, (T0321)E119.CB) [> 3.5250 = 5.8750 < 7.6375] w=0.0887 to align # Constraint # added constraint: constraint((T0321)W149.CB, (T0321)T182.CB) [> 4.5497 = 7.5828 < 9.8577] w=0.0884 to align # Constraint # added constraint: constraint((T0321)N88.CB, (T0321)A102.CB) [> 4.0424 = 6.7373 < 8.7585] w=0.0882 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)L205.CB) [> 3.9295 = 6.5492 < 8.5140] w=0.0882 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)R42.CB) [> 3.5433 = 5.9055 < 7.6771] w=0.0880 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)S218.CB) [> 3.7448 = 6.2414 < 8.1138] w=0.0879 to align # Constraint # added constraint: constraint((T0321)V67.CB, (T0321)L198.CB) [> 3.3732 = 5.6220 < 7.3086] w=0.0874 to align # Constraint # added constraint: constraint((T0321)A63.CB, (T0321)G200.CA) [> 3.9485 = 6.5808 < 8.5551] w=0.0874 to align # Constraint # added constraint: constraint((T0321)S136.CB, (T0321)F229.CB) [> 3.5618 = 5.9364 < 7.7173] w=0.0874 to align # Constraint # added constraint: constraint((T0321)N87.CB, (T0321)V105.CB) [> 3.0371 = 5.0618 < 6.5804] w=0.0874 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)H133.CB) [> 2.7277 = 4.5462 < 5.9100] w=0.0872 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)L217.CB) [> 4.4558 = 7.4263 < 9.6542] w=0.0867 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)F220.CB) [> 4.3440 = 7.2400 < 9.4120] w=0.0867 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)V199.CB) [> 3.4983 = 5.8306 < 7.5798] w=0.0861 to align # Constraint # added constraint: constraint((T0321)A63.CB, (T0321)H133.CB) [> 4.0652 = 6.7753 < 8.8079] w=0.0859 to align # Constraint # added constraint: constraint((T0321)A63.CB, (T0321)P201.CB) [> 4.1915 = 6.9859 < 9.0816] w=0.0859 to align # Constraint # added constraint: constraint((T0321)A64.CB, (T0321)H133.CB) [> 2.7620 = 4.6033 < 5.9843] w=0.0859 to align # Constraint # added constraint: constraint((T0321)A84.CB, (T0321)F220.CB) [> 2.9493 = 4.9155 < 6.3902] w=0.0857 to align # Constraint # added constraint: constraint((T0321)N83.CB, (T0321)I231.CB) [> 3.8450 = 6.4083 < 8.3308] w=0.0857 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)I231.CB) [> 3.2208 = 5.3680 < 6.9784] w=0.0857 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)P201.CB) [> 4.3216 = 7.2027 < 9.3635] w=0.0856 to align # Constraint # added constraint: constraint((T0321)A75.CB, (T0321)P201.CB) [> 3.9628 = 6.6047 < 8.5860] w=0.0856 to align # Constraint # added constraint: constraint((T0321)L137.CB, (T0321)Y170.CB) [> 4.4089 = 7.3481 < 9.5525] w=0.0852 to align # Constraint # added constraint: constraint((T0321)T25.CB, (T0321)P40.CB) [> 3.9984 = 6.6641 < 8.6633] w=0.0847 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)P40.CB) [> 3.4197 = 5.6996 < 7.4095] w=0.0847 to align # Constraint # added constraint: constraint((T0321)G202.CA, (T0321)S218.CB) [> 3.3725 = 5.6208 < 7.3070] w=0.0841 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)G200.CA) [> 4.0920 = 6.8201 < 8.8661] w=0.0830 to align # Constraint # added constraint: constraint((T0321)E135.CB, (T0321)L144.CB) [> 3.1876 = 5.3127 < 6.9066] w=0.0830 to align # Constraint # added constraint: constraint((T0321)V67.CB, (T0321)A228.CB) [> 4.6231 = 7.7052 < 10.0167] w=0.0829 to align # Constraint # added constraint: constraint((T0321)C66.CB, (T0321)I231.CB) [> 4.3085 = 7.1809 < 9.3352] w=0.0829 to align # Constraint # added constraint: constraint((T0321)H27.CB, (T0321)P40.CB) [> 3.8610 = 6.4349 < 8.3654] w=0.0823 to align # Constraint # added constraint: constraint((T0321)G78.CA, (T0321)H133.CB) [> 3.9109 = 6.5181 < 8.4735] w=0.0818 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)T197.CB) [> 4.2471 = 7.0785 < 9.2020] w=0.0809 to align # Constraint # added constraint: constraint((T0321)V67.CB, (T0321)I77.CB) [> 4.5684 = 7.6140 < 9.8982] w=0.0800 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)P207.CB) [> 3.7118 = 6.1864 < 8.0423] w=0.0794 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)A176.CB) [> 3.2990 = 5.4984 < 7.1479] w=0.0786 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)V125.CB) [> 4.2961 = 7.1602 < 9.3082] w=0.0785 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)E216.CB) [> 3.1727 = 5.2878 < 6.8741] w=0.0781 to align # Constraint # added constraint: constraint((T0321)V222.CB, (T0321)I231.CB) [> 4.4255 = 7.3758 < 9.5885] w=0.0778 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)T203.CB) [> 3.9545 = 6.5908 < 8.5681] w=0.0773 to align # Constraint # added constraint: constraint((T0321)F113.CB, (T0321)S136.CB) [> 3.3167 = 5.5278 < 7.1862] w=0.0760 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)Y170.CB) [> 3.9365 = 6.5608 < 8.5290] w=0.0760 to align # Constraint # added constraint: constraint((T0321)S177.CB, (T0321)T203.CB) [> 2.3359 = 3.8931 < 5.0610] w=0.0759 to align # Constraint # added constraint: constraint((T0321)S177.CB, (T0321)P201.CB) [> 3.0996 = 5.1660 < 6.7158] w=0.0759 to align # Constraint # added constraint: constraint((T0321)S177.CB, (T0321)G200.CA) [> 4.2595 = 7.0991 < 9.2289] w=0.0759 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)P40.CB) [> 3.8639 = 6.4398 < 8.3718] w=0.0757 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)V179.CB) [> 2.9579 = 4.9298 < 6.4088] w=0.0757 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)V178.CB) [> 3.8886 = 6.4810 < 8.4254] w=0.0757 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)N41.CB) [> 4.2840 = 7.1400 < 9.2821] w=0.0755 to align # Constraint # added constraint: constraint((T0321)Y5.CB, (T0321)F16.CB) [> 2.5482 = 4.2471 < 5.5212] w=0.0751 to align # Constraint # added constraint: constraint((T0321)G78.CA, (T0321)P140.CB) [> 4.1473 = 6.9121 < 8.9858] w=0.0744 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)L209.CB) [> 3.6700 = 6.1166 < 7.9516] w=0.0740 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)L198.CB) [> 3.9225 = 6.5375 < 8.4987] w=0.0736 to align # Constraint # added constraint: constraint((T0321)V105.CB, (T0321)E119.CB) [> 4.1970 = 6.9950 < 9.0935] w=0.0735 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)V105.CB) [> 3.3104 = 5.5173 < 7.1726] w=0.0735 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)Y172.CB) [> 4.3363 = 7.2272 < 9.3954] w=0.0735 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)V125.CB) [> 4.6310 = 7.7183 < 10.0337] w=0.0735 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)L137.CB) [> 3.9326 = 6.5543 < 8.5205] w=0.0730 to align # Constraint # added constraint: constraint((T0321)A84.CB, (T0321)Y170.CB) [> 4.6400 = 7.7333 < 10.0533] w=0.0730 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)L198.CB) [> 3.8127 = 6.3545 < 8.2608] w=0.0728 to align # Constraint # added constraint: constraint((T0321)K181.CB, (T0321)L205.CB) [> 3.2346 = 5.3910 < 7.0083] w=0.0726 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)L209.CB) [> 3.4272 = 5.7119 < 7.4255] w=0.0712 to align # Constraint # added constraint: constraint((T0321)K68.CB, (T0321)I77.CB) [> 3.4931 = 5.8219 < 7.5685] w=0.0709 to align # Constraint # added constraint: constraint((T0321)S218.CB, (T0321)I231.CB) [> 3.0982 = 5.1637 < 6.7128] w=0.0708 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)V199.CB) [> 3.9012 = 6.5021 < 8.4527] w=0.0701 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)G200.CA) [> 4.2562 = 7.0937 < 9.2218] w=0.0701 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)P140.CB) [> 4.5767 = 7.6279 < 9.9163] w=0.0700 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)V199.CB) [> 3.6358 = 6.0598 < 7.8777] w=0.0695 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)L198.CB) [> 4.1494 = 6.9156 < 8.9903] w=0.0694 to align # Constraint # added constraint: constraint((T0321)V73.CB, (T0321)G202.CA) [> 3.7112 = 6.1853 < 8.0409] w=0.0694 to align # Constraint # added constraint: constraint((T0321)N83.CB, (T0321)V120.CB) [> 4.2894 = 7.1489 < 9.2936] w=0.0693 to align # Constraint # added constraint: constraint((T0321)A63.CB, (T0321)V232.CB) [> 4.4892 = 7.4820 < 9.7267] w=0.0692 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)T197.CB) [> 3.9020 = 6.5034 < 8.4544] w=0.0685 to align # Constraint # added constraint: constraint((T0321)P204.CB, (T0321)M221.CB) [> 3.9354 = 6.5590 < 8.5267] w=0.0684 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)V125.CB) [> 4.0681 = 6.7802 < 8.8142] w=0.0681 to align # Constraint # added constraint: constraint((T0321)P204.CB, (T0321)S218.CB) [> 3.9348 = 6.5580 < 8.5254] w=0.0677 to align # Constraint # added constraint: constraint((T0321)E20.CB, (T0321)V29.CB) [> 4.4689 = 7.4481 < 9.6825] w=0.0677 to align # Constraint # added constraint: constraint((T0321)G78.CA, (T0321)I231.CB) [> 3.9230 = 6.5383 < 8.4998] w=0.0677 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)V222.CB) [> 3.1681 = 5.2801 < 6.8641] w=0.0677 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)V222.CB) [> 3.1703 = 5.2839 < 6.8690] w=0.0677 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)T174.CB) [> 4.0295 = 6.7158 < 8.7305] w=0.0677 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)Y172.CB) [> 3.9506 = 6.5844 < 8.5597] w=0.0677 to align # Constraint # added constraint: constraint((T0321)A64.CB, (T0321)S136.CB) [> 3.3038 = 5.5063 < 7.1582] w=0.0670 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)V208.CB) [> 4.4798 = 7.4663 < 9.7062] w=0.0665 to align # Constraint # added constraint: constraint((T0321)V120.CB, (T0321)D143.CB) [> 3.8623 = 6.4373 < 8.3684] w=0.0665 to align # Constraint # added constraint: constraint((T0321)Y72.CB, (T0321)G200.CA) [> 4.0131 = 6.6885 < 8.6951] w=0.0665 to align # Constraint # added constraint: constraint((T0321)V178.CB, (T0321)T203.CB) [> 3.3962 = 5.6604 < 7.3585] w=0.0664 to align # Constraint # added constraint: constraint((T0321)N87.CB, (T0321)M115.CB) [> 3.8562 = 6.4269 < 8.3550] w=0.0657 to align # Constraint # added constraint: constraint((T0321)M221.CB, (T0321)A243.CB) [> 3.5618 = 5.9363 < 7.7172] w=0.0655 to align # Constraint # added constraint: constraint((T0321)Y85.CB, (T0321)P140.CB) [> 3.7145 = 6.1909 < 8.0482] w=0.0655 to align # Constraint # added constraint: constraint((T0321)A84.CB, (T0321)Y172.CB) [> 3.8061 = 6.3434 < 8.2465] w=0.0655 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)E216.CB) [> 3.7791 = 6.2984 < 8.1880] w=0.0655 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)L217.CB) [> 3.2660 = 5.4434 < 7.0764] w=0.0655 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)S218.CB) [> 4.2233 = 7.0389 < 9.1505] w=0.0655 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)L217.CB) [> 4.0342 = 6.7238 < 8.7409] w=0.0655 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)S218.CB) [> 3.8042 = 6.3404 < 8.2425] w=0.0655 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)G219.CA) [> 2.9595 = 4.9325 < 6.4122] w=0.0655 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)P140.CB) [> 4.7175 = 7.8625 < 10.2213] w=0.0653 to align # Constraint # added constraint: constraint((T0321)D180.CB, (T0321)A206.CB) [> 4.1574 = 6.9289 < 9.0076] w=0.0651 to align # Constraint # added constraint: constraint((T0321)A63.CB, (T0321)G78.CA) [> 3.3198 = 5.5330 < 7.1929] w=0.0650 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)L217.CB) [> 4.2056 = 7.0093 < 9.1121] w=0.0649 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)E216.CB) [> 4.3135 = 7.1891 < 9.3459] w=0.0649 to align # Constraint # added constraint: constraint((T0321)G200.CA, (T0321)E216.CB) [> 3.9457 = 6.5762 < 8.5490] w=0.0649 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)S190.CB) [> 3.8726 = 6.4542 < 8.3905] w=0.0647 to align # Constraint # added constraint: constraint((T0321)A64.CB, (T0321)L137.CB) [> 3.4334 = 5.7223 < 7.4390] w=0.0642 to align # Constraint # added constraint: constraint((T0321)G219.CA, (T0321)I240.CB) [> 3.4139 = 5.6898 < 7.3967] w=0.0642 to align # Constraint # added constraint: constraint((T0321)M8.CB, (T0321)C23.CB) [> 4.3033 = 7.1722 < 9.3239] w=0.0640 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)D111.CB) [> 3.6616 = 6.1026 < 7.9334] w=0.0640 to align # Constraint # added constraint: constraint((T0321)G39.CA, (T0321)L79.CB) [> 2.9990 = 4.9984 < 6.4979] w=0.0635 to align # Constraint # added constraint: constraint((T0321)I30.CB, (T0321)G39.CA) [> 4.3259 = 7.2098 < 9.3728] w=0.0632 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)P40.CB) [> 4.0112 = 6.6853 < 8.6909] w=0.0632 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)V222.CB) [> 3.2695 = 5.4491 < 7.0839] w=0.0630 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)D224.CB) [> 4.0635 = 6.7725 < 8.8043] w=0.0630 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)V171.CB) [> 4.2344 = 7.0573 < 9.1744] w=0.0624 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)V171.CB) [> 3.9326 = 6.5543 < 8.5206] w=0.0618 to align # Constraint # added constraint: constraint((T0321)S116.CB, (T0321)L137.CB) [> 3.3079 = 5.5132 < 7.1672] w=0.0614 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)S145.CB) [> 3.8236 = 6.3727 < 8.2845] w=0.0606 to align # Constraint # added constraint: constraint((T0321)L134.CB, (T0321)S145.CB) [> 3.4900 = 5.8167 < 7.5617] w=0.0606 to align # Constraint # added constraint: constraint((T0321)F113.CB, (T0321)H133.CB) [> 3.3246 = 5.5409 < 7.2032] w=0.0598 to align # Constraint # added constraint: constraint((T0321)V128.CB, (T0321)L137.CB) [> 3.6640 = 6.1066 < 7.9386] w=0.0585 to align # Constraint # added constraint: constraint((T0321)P132.CB, (T0321)V232.CB) [> 3.2453 = 5.4088 < 7.0314] w=0.0583 to align # Constraint # added constraint: constraint((T0321)S136.CB, (T0321)G234.CA) [> 4.2541 = 7.0902 < 9.2172] w=0.0583 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)T203.CB) [> 2.5930 = 4.3217 < 5.6182] w=0.0583 to align # Constraint # added constraint: constraint((T0321)R185.CB, (T0321)P201.CB) [> 4.4751 = 7.4586 < 9.6961] w=0.0583 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)V179.CB) [> 4.0781 = 6.7968 < 8.8358] w=0.0571 to align # Constraint # added constraint: constraint((T0321)G219.CA, (T0321)I231.CB) [> 4.3696 = 7.2826 < 9.4674] w=0.0571 to align # Constraint # added constraint: constraint((T0321)S218.CB, (T0321)G234.CA) [> 4.3959 = 7.3265 < 9.5244] w=0.0571 to align # Constraint # added constraint: constraint((T0321)L217.CB, (T0321)I231.CB) [> 4.5613 = 7.6021 < 9.8828] w=0.0571 to align # Constraint # added constraint: constraint((T0321)P207.CB, (T0321)G219.CA) [> 4.3109 = 7.1848 < 9.3402] w=0.0571 to align # Constraint # added constraint: constraint((T0321)P207.CB, (T0321)E216.CB) [> 4.1670 = 6.9450 < 9.0284] w=0.0571 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)V222.CB) [> 2.8140 = 4.6900 < 6.0970] w=0.0571 to align # Constraint # added constraint: constraint((T0321)V199.CB, (T0321)I231.CB) [> 4.4754 = 7.4590 < 9.6967] w=0.0571 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)V222.CB) [> 4.1729 = 6.9548 < 9.0412] w=0.0571 to align # Constraint # added constraint: constraint((T0321)W149.CB, (T0321)V178.CB) [> 2.8291 = 4.7151 < 6.1297] w=0.0571 to align # Constraint # added constraint: constraint((T0321)S136.CB, (T0321)A235.CB) [> 3.3713 = 5.6189 < 7.3046] w=0.0569 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)P40.CB) [> 4.2083 = 7.0138 < 9.1179] w=0.0568 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)G39.CA) [> 3.6785 = 6.1307 < 7.9700] w=0.0567 to align # Constraint # added constraint: constraint((T0321)L60.CB, (T0321)F131.CB) [> 4.7495 = 7.9157 < 10.2905] w=0.0567 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)N41.CB) [> 3.1115 = 5.1859 < 6.7416] w=0.0567 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)P40.CB) [> 3.7522 = 6.2537 < 8.1298] w=0.0567 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)L51.CB) [> 4.2494 = 7.0824 < 9.2071] w=0.0566 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)T197.CB) [> 4.0444 = 6.7406 < 8.7627] w=0.0565 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)S190.CB) [> 4.4555 = 7.4259 < 9.6536] w=0.0564 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)I173.CB) [> 3.8148 = 6.3580 < 8.2654] w=0.0564 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)I173.CB) [> 4.2390 = 7.0651 < 9.1846] w=0.0564 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)S136.CB) [> 4.3141 = 7.1902 < 9.3472] w=0.0556 to align # Constraint # added constraint: constraint((T0321)V73.CB, (T0321)G200.CA) [> 4.1346 = 6.8910 < 8.9583] w=0.0556 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)I141.CB) [> 3.4027 = 5.6711 < 7.3724] w=0.0556 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)I196.CB) [> 3.8494 = 6.4157 < 8.3404] w=0.0547 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)I196.CB) [> 3.9631 = 6.6051 < 8.5866] w=0.0547 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)P157.CB) [> 4.1056 = 6.8426 < 8.8954] w=0.0546 to align # Constraint # added constraint: constraint((T0321)T182.CB, (T0321)P204.CB) [> 2.9393 = 4.8989 < 6.3686] w=0.0543 to align # Constraint # added constraint: constraint((T0321)R42.CB, (T0321)S76.CB) [> 3.5471 = 5.9118 < 7.6854] w=0.0537 to align # Constraint # added constraint: constraint((T0321)M8.CB, (T0321)L21.CB) [> 4.3074 = 7.1790 < 9.3328] w=0.0537 to align # Constraint # added constraint: constraint((T0321)T25.CB, (T0321)N41.CB) [> 3.7274 = 6.2124 < 8.0761] w=0.0534 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)N41.CB) [> 3.1847 = 5.3078 < 6.9001] w=0.0534 to align # Constraint # added constraint: constraint((T0321)Y72.CB, (T0321)G202.CA) [> 4.1756 = 6.9594 < 9.0472] w=0.0534 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)L198.CB) [> 3.3119 = 5.5198 < 7.1757] w=0.0532 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)T197.CB) [> 4.1996 = 6.9993 < 9.0990] w=0.0532 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)P207.CB) [> 4.4519 = 7.4199 < 9.6458] w=0.0527 to align # Constraint # added constraint: constraint((T0321)P204.CB, (T0321)V222.CB) [> 4.3468 = 7.2446 < 9.4180] w=0.0524 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)V222.CB) [> 3.3370 = 5.5616 < 7.2301] w=0.0524 to align # Constraint # added constraint: constraint((T0321)L51.CB, (T0321)A63.CB) [> 3.6433 = 6.0722 < 7.8939] w=0.0521 to align # Constraint # added constraint: constraint((T0321)V91.CB, (T0321)R195.CB) [> 4.1659 = 6.9432 < 9.0262] w=0.0520 to align # Constraint # added constraint: constraint((T0321)L51.CB, (T0321)L60.CB) [> 4.3874 = 7.3123 < 9.5060] w=0.0520 to align # Constraint # added constraint: constraint((T0321)Q215.CB, (T0321)K239.CB) [> 4.0140 = 6.6901 < 8.6971] w=0.0520 to align # Constraint # added constraint: constraint((T0321)S76.CB, (T0321)L134.CB) [> 3.2041 = 5.3402 < 6.9422] w=0.0519 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)E216.CB) [> 3.3861 = 5.6435 < 7.3366] w=0.0517 to align # Constraint # added constraint: constraint((T0321)D180.CB, (T0321)L205.CB) [> 4.4545 = 7.4241 < 9.6514] w=0.0513 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)G202.CA) [> 4.5907 = 7.6512 < 9.9465] w=0.0513 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)G200.CA) [> 3.7285 = 6.2141 < 8.0784] w=0.0513 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)G202.CA) [> 4.1344 = 6.8907 < 8.9579] w=0.0513 to align # Constraint # added constraint: constraint((T0321)S116.CB, (T0321)C142.CB) [> 4.3184 = 7.1973 < 9.3565] w=0.0513 to align # Constraint # added constraint: constraint((T0321)K68.CB, (T0321)G78.CA) [> 3.4348 = 5.7246 < 7.4420] w=0.0511 to align # Constraint # added constraint: constraint((T0321)V67.CB, (T0321)G78.CA) [> 4.4068 = 7.3446 < 9.5480] w=0.0511 to align # Constraint # added constraint: constraint((T0321)C66.CB, (T0321)G78.CA) [> 3.2284 = 5.3806 < 6.9948] w=0.0511 to align # Constraint # added constraint: constraint((T0321)G65.CA, (T0321)G78.CA) [> 3.5871 = 5.9784 < 7.7720] w=0.0511 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)M48.CB) [> 3.9783 = 6.6304 < 8.6196] w=0.0511 to align # Constraint # added constraint: constraint((T0321)F131.CB, (T0321)S177.CB) [> 4.4903 = 7.4838 < 9.7289] w=0.0510 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)F220.CB) [> 3.7636 = 6.2727 < 8.1545] w=0.0509 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)F220.CB) [> 4.1928 = 6.9880 < 9.0844] w=0.0509 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)G219.CA) [> 4.0626 = 6.7711 < 8.8024] w=0.0509 to align # Constraint # added constraint: constraint((T0321)Y170.CB, (T0321)L217.CB) [> 4.4058 = 7.3430 < 9.5459] w=0.0509 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)L144.CB) [> 4.6361 = 7.7269 < 10.0450] w=0.0509 to align # Constraint # added constraint: constraint((T0321)L217.CB, (T0321)K237.CB) [> 3.6184 = 6.0307 < 7.8399] w=0.0509 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)K237.CB) [> 4.3067 = 7.1779 < 9.3313] w=0.0509 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)Y156.CB) [> 4.7844 = 7.9740 < 10.3662] w=0.0507 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)V199.CB) [> 3.9556 = 6.5927 < 8.5705] w=0.0507 to align # Constraint # added constraint: constraint((T0321)R42.CB, (T0321)V73.CB) [> 3.6112 = 6.0188 < 7.8244] w=0.0503 to align # Constraint # added constraint: constraint((T0321)M48.CB, (T0321)A63.CB) [> 4.4156 = 7.3594 < 9.5672] w=0.0503 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)P43.CB) [> 4.4408 = 7.4013 < 9.6217] w=0.0502 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)Y170.CB) [> 3.7445 = 6.2408 < 8.1130] w=0.0501 to align # Constraint # added constraint: constraint((T0321)T52.CB, (T0321)V232.CB) [> 4.0797 = 6.7995 < 8.8394] w=0.0499 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)G200.CA) [> 4.7733 = 7.9555 < 10.3422] w=0.0496 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)M221.CB) [> 4.0229 = 6.7048 < 8.7162] w=0.0496 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)V127.CB) [> 4.7261 = 7.8768 < 10.2398] w=0.0496 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)I231.CB) [> 2.6330 = 4.3882 < 5.7047] w=0.0496 to align # Constraint # added constraint: constraint((T0321)N83.CB, (T0321)F220.CB) [> 3.6332 = 6.0553 < 7.8719] w=0.0496 to align # Constraint # added constraint: constraint((T0321)N83.CB, (T0321)V222.CB) [> 4.0843 = 6.8071 < 8.8493] w=0.0496 to align # Constraint # added constraint: constraint((T0321)N71.CB, (T0321)Y85.CB) [> 3.7574 = 6.2624 < 8.1411] w=0.0494 to align # Constraint # added constraint: constraint((T0321)A228.CB, (T0321)V238.CB) [> 2.7945 = 4.6574 < 6.0546] w=0.0493 to align # Constraint # added constraint: constraint((T0321)N88.CB, (T0321)Y170.CB) [> 3.0112 = 5.0186 < 6.5242] w=0.0490 to align # Constraint # added constraint: constraint((T0321)N88.CB, (T0321)T197.CB) [> 3.7644 = 6.2740 < 8.1562] w=0.0490 to align # Constraint # added constraint: constraint((T0321)V18.CB, (T0321)S32.CB) [> 4.3442 = 7.2403 < 9.4123] w=0.0488 to align # Constraint # added constraint: constraint((T0321)V18.CB, (T0321)R31.CB) [> 3.9272 = 6.5454 < 8.5090] w=0.0488 to align # Constraint # added constraint: constraint((T0321)V18.CB, (T0321)I30.CB) [> 3.7409 = 6.2348 < 8.1052] w=0.0488 to align # Constraint # added constraint: constraint((T0321)L17.CB, (T0321)G33.CA) [> 4.1486 = 6.9143 < 8.9886] w=0.0488 to align # Constraint # added constraint: constraint((T0321)L17.CB, (T0321)S32.CB) [> 3.0311 = 5.0519 < 6.5674] w=0.0488 to align # Constraint # added constraint: constraint((T0321)F16.CB, (T0321)S32.CB) [> 4.1313 = 6.8855 < 8.9511] w=0.0488 to align # Constraint # added constraint: constraint((T0321)F113.CB, (T0321)V127.CB) [> 4.4868 = 7.4779 < 9.7213] w=0.0488 to align # Constraint # added constraint: constraint((T0321)H130.CB, (T0321)Y170.CB) [> 4.7037 = 7.8396 < 10.1914] w=0.0488 to align # Constraint # added constraint: constraint((T0321)D143.CB, (T0321)E167.CB) [> 3.3953 = 5.6589 < 7.3566] w=0.0488 to align # Constraint # added constraint: constraint((T0321)G219.CA, (T0321)K246.CB) [> 4.1533 = 6.9221 < 8.9987] w=0.0486 to align # Constraint # added constraint: constraint((T0321)M221.CB, (T0321)G244.CA) [> 3.7359 = 6.2264 < 8.0943] w=0.0486 to align # Constraint # added constraint: constraint((T0321)M221.CB, (T0321)Q245.CB) [> 3.0383 = 5.0638 < 6.5829] w=0.0486 to align # Constraint # added constraint: constraint((T0321)G35.CA, (T0321)Q53.CB) [> 4.5357 = 7.5596 < 9.8274] w=0.0483 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)M115.CB) [> 3.6769 = 6.1281 < 7.9666] w=0.0482 to align # Constraint # added constraint: constraint((T0321)I98.CB, (T0321)K123.CB) [> 4.5840 = 7.6401 < 9.9321] w=0.0477 to align # Constraint # added constraint: constraint((T0321)F220.CB, (T0321)I240.CB) [> 3.7631 = 6.2717 < 8.1533] w=0.0472 to align # Constraint # added constraint: constraint((T0321)L183.CB, (T0321)L198.CB) [> 4.3255 = 7.2091 < 9.3719] w=0.0472 to align # Constraint # added constraint: constraint((T0321)G35.CA, (T0321)A84.CB) [> 3.5060 = 5.8434 < 7.5964] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G35.CA, (T0321)N88.CB) [> 4.2244 = 7.0406 < 9.1528] w=0.0470 to align # Constraint # added constraint: constraint((T0321)V36.CB, (T0321)N83.CB) [> 4.6900 = 7.8167 < 10.1618] w=0.0470 to align # Constraint # added constraint: constraint((T0321)V36.CB, (T0321)A84.CB) [> 3.6920 = 6.1533 < 7.9993] w=0.0470 to align # Constraint # added constraint: constraint((T0321)V36.CB, (T0321)N87.CB) [> 4.7244 = 7.8739 < 10.2361] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G37.CA, (T0321)A80.CB) [> 3.0870 = 5.1450 < 6.6885] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G37.CA, (T0321)A81.CB) [> 4.4644 = 7.4407 < 9.6729] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G37.CA, (T0321)N83.CB) [> 2.3010 = 3.8350 < 4.9854] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G37.CA, (T0321)A84.CB) [> 2.2871 = 3.8119 < 4.9554] w=0.0470 to align # Constraint # added constraint: constraint((T0321)I30.CB, (T0321)A84.CB) [> 2.9575 = 4.9292 < 6.4080] w=0.0470 to align # Constraint # added constraint: constraint((T0321)I30.CB, (T0321)N83.CB) [> 4.3198 = 7.1996 < 9.3595] w=0.0470 to align # Constraint # added constraint: constraint((T0321)I30.CB, (T0321)A81.CB) [> 3.2973 = 5.4955 < 7.1442] w=0.0470 to align # Constraint # added constraint: constraint((T0321)I30.CB, (T0321)A80.CB) [> 2.2967 = 3.8279 < 4.9763] w=0.0470 to align # Constraint # added constraint: constraint((T0321)V29.CB, (T0321)A80.CB) [> 4.1550 = 6.9250 < 9.0026] w=0.0470 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)A80.CB) [> 2.7433 = 4.5722 < 5.9438] w=0.0470 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)L79.CB) [> 4.6911 = 7.8185 < 10.1640] w=0.0470 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)I77.CB) [> 3.7654 = 6.2757 < 8.1584] w=0.0470 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)S76.CB) [> 3.4507 = 5.7512 < 7.4765] w=0.0470 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)S76.CB) [> 3.9980 = 6.6634 < 8.6624] w=0.0470 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)V73.CB) [> 4.7580 = 7.9300 < 10.3090] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)F44.CB) [> 3.8592 = 6.4320 < 8.3616] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)L198.CB) [> 3.7439 = 6.2399 < 8.1118] w=0.0470 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)L198.CB) [> 4.1671 = 6.9451 < 9.0287] w=0.0470 to align # Constraint # added constraint: constraint((T0321)A64.CB, (T0321)E74.CB) [> 4.5379 = 7.5631 < 9.8321] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L60.CB, (T0321)Y86.CB) [> 4.7704 = 7.9507 < 10.3359] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L60.CB, (T0321)I82.CB) [> 2.3608 = 3.9346 < 5.1150] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L60.CB, (T0321)A81.CB) [> 2.8868 = 4.8113 < 6.2548] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L60.CB, (T0321)G78.CA) [> 3.4357 = 5.7262 < 7.4440] w=0.0470 to align # Constraint # added constraint: constraint((T0321)P59.CB, (T0321)Y85.CB) [> 4.0893 = 6.8155 < 8.8602] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L38.CB, (T0321)L79.CB) [> 4.5738 = 7.6229 < 9.9098] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L38.CB, (T0321)A80.CB) [> 3.5926 = 5.9877 < 7.7840] w=0.0470 to align # Constraint # added constraint: constraint((T0321)L38.CB, (T0321)N83.CB) [> 3.2220 = 5.3701 < 6.9811] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G39.CA, (T0321)I77.CB) [> 4.4873 = 7.4789 < 9.7225] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G39.CA, (T0321)G78.CA) [> 4.4398 = 7.3997 < 9.6196] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G39.CA, (T0321)A80.CB) [> 2.3834 = 3.9723 < 5.1641] w=0.0470 to align # Constraint # added constraint: constraint((T0321)G39.CA, (T0321)N83.CB) [> 3.8422 = 6.4037 < 8.3248] w=0.0470 to align # Constraint # added constraint: constraint((T0321)P40.CB, (T0321)S76.CB) [> 2.6945 = 4.4908 < 5.8380] w=0.0470 to align # Constraint # added constraint: constraint((T0321)N41.CB, (T0321)A75.CB) [> 4.4285 = 7.3809 < 9.5951] w=0.0470 to align # Constraint # added constraint: constraint((T0321)R42.CB, (T0321)Y72.CB) [> 3.0020 = 5.0034 < 6.5044] w=0.0470 to align # Constraint # added constraint: constraint((T0321)P59.CB, (T0321)A81.CB) [> 4.7341 = 7.8902 < 10.2573] w=0.0470 to align # Constraint # added constraint: constraint((T0321)A75.CB, (T0321)S136.CB) [> 4.3729 = 7.2882 < 9.4747] w=0.0464 to align # Constraint # added constraint: constraint((T0321)V178.CB, (T0321)P204.CB) [> 3.8056 = 6.3427 < 8.2455] w=0.0461 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)N110.CB) [> 3.8493 = 6.4156 < 8.3402] w=0.0451 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)T197.CB) [> 4.0472 = 6.7454 < 8.7690] w=0.0449 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)I196.CB) [> 4.0101 = 6.6835 < 8.6885] w=0.0449 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)V199.CB) [> 3.8673 = 6.4454 < 8.3791] w=0.0449 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)L198.CB) [> 3.2529 = 5.4215 < 7.0480] w=0.0445 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)Y170.CB) [> 2.7343 = 4.5572 < 5.9243] w=0.0435 to align # Constraint # added constraint: constraint((T0321)P207.CB, (T0321)V232.CB) [> 3.5017 = 5.8361 < 7.5870] w=0.0431 to align # Constraint # added constraint: constraint((T0321)F210.CB, (T0321)V232.CB) [> 4.2444 = 7.0740 < 9.1961] w=0.0431 to align # Constraint # added constraint: constraint((T0321)P132.CB, (T0321)G234.CA) [> 4.3400 = 7.2333 < 9.4033] w=0.0389 to align # Constraint # added constraint: constraint((T0321)P132.CB, (T0321)A233.CB) [> 2.6156 = 4.3593 < 5.6671] w=0.0389 to align # Constraint # added constraint: constraint((T0321)G78.CA, (T0321)M115.CB) [> 3.4459 = 5.7431 < 7.4660] w=0.0381 to align # Constraint # added constraint: constraint((T0321)P49.CB, (T0321)F99.CB) [> 3.0262 = 5.0436 < 6.5567] w=0.0381 to align # Constraint # added constraint: constraint((T0321)P49.CB, (T0321)V97.CB) [> 3.2297 = 5.3828 < 6.9977] w=0.0381 to align # Constraint # added constraint: constraint((T0321)M48.CB, (T0321)V97.CB) [> 3.6473 = 6.0789 < 7.9025] w=0.0381 to align # Constraint # added constraint: constraint((T0321)N41.CB, (T0321)G96.CA) [> 4.3023 = 7.1704 < 9.3216] w=0.0381 to align # Constraint # added constraint: constraint((T0321)V36.CB, (T0321)V105.CB) [> 4.3489 = 7.2481 < 9.4226] w=0.0381 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)V91.CB) [> 4.2719 = 7.1198 < 9.2557] w=0.0381 to align # Constraint # added constraint: constraint((T0321)S177.CB, (T0321)P204.CB) [> 4.3118 = 7.1864 < 9.3423] w=0.0381 to align # Constraint # added constraint: constraint((T0321)P140.CB, (T0321)A233.CB) [> 4.7506 = 7.9177 < 10.2930] w=0.0381 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)V222.CB) [> 3.5577 = 5.9296 < 7.7085] w=0.0381 to align # Constraint # added constraint: constraint((T0321)M115.CB, (T0321)E167.CB) [> 4.5698 = 7.6163 < 9.9012] w=0.0381 to align # Constraint # added constraint: constraint((T0321)P89.CB, (T0321)M109.CB) [> 3.4046 = 5.6744 < 7.3767] w=0.0379 to align # Constraint # added constraint: constraint((T0321)P89.CB, (T0321)M115.CB) [> 3.9537 = 6.5895 < 8.5663] w=0.0379 to align # Constraint # added constraint: constraint((T0321)L21.CB, (T0321)G39.CA) [> 4.5678 = 7.6130 < 9.8969] w=0.0378 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)G39.CA) [> 3.4243 = 5.7071 < 7.4192] w=0.0378 to align # Constraint # added constraint: constraint((T0321)A64.CB, (T0321)T174.CB) [> 4.6561 = 7.7601 < 10.0881] w=0.0378 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)I196.CB) [> 2.8575 = 4.7625 < 6.1912] w=0.0378 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)R47.CB) [> 4.5322 = 7.5537 < 9.8198] w=0.0378 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)R42.CB) [> 3.4925 = 5.8208 < 7.5670] w=0.0378 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)F44.CB) [> 4.1128 = 6.8547 < 8.9111] w=0.0378 to align # Constraint # added constraint: constraint((T0321)I9.CB, (T0321)V22.CB) [> 4.6476 = 7.7460 < 10.0698] w=0.0378 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)P49.CB) [> 2.8302 = 4.7171 < 6.1322] w=0.0378 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)M50.CB) [> 4.5351 = 7.5586 < 9.8261] w=0.0378 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)L51.CB) [> 4.3840 = 7.3067 < 9.4987] w=0.0378 to align # Constraint # added constraint: constraint((T0321)T25.CB, (T0321)L51.CB) [> 4.1606 = 6.9344 < 9.0147] w=0.0378 to align # Constraint # added constraint: constraint((T0321)T25.CB, (T0321)V67.CB) [> 4.7929 = 7.9881 < 10.3845] w=0.0378 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)M50.CB) [> 3.7376 = 6.2293 < 8.0981] w=0.0378 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)T52.CB) [> 4.5311 = 7.5518 < 9.8173] w=0.0378 to align # Constraint # added constraint: constraint((T0321)V178.CB, (T0321)V222.CB) [> 3.1528 = 5.2547 < 6.8311] w=0.0378 to align # Constraint # added constraint: constraint((T0321)T52.CB, (T0321)P132.CB) [> 4.1464 = 6.9107 < 8.9839] w=0.0378 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)I249.CB) [> 3.7647 = 6.2744 < 8.1567] w=0.0376 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)I173.CB) [> 3.5902 = 5.9837 < 7.7787] w=0.0376 to align # Constraint # added constraint: constraint((T0321)N88.CB, (T0321)A243.CB) [> 3.9263 = 6.5438 < 8.5069] w=0.0376 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)I173.CB) [> 4.0972 = 6.8287 < 8.8773] w=0.0376 to align # Constraint # added constraint: constraint((T0321)G35.CA, (T0321)C66.CB) [> 4.1395 = 6.8992 < 8.9689] w=0.0376 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)I249.CB) [> 4.5588 = 7.5980 < 9.8774] w=0.0376 to align # Constraint # added constraint: constraint((T0321)L209.CB, (T0321)V247.CB) [> 3.8718 = 6.4530 < 8.3890] w=0.0376 to align # Constraint # added constraint: constraint((T0321)F210.CB, (T0321)V247.CB) [> 4.5460 = 7.5767 < 9.8497] w=0.0376 to align # Constraint # added constraint: constraint((T0321)L214.CB, (T0321)I249.CB) [> 4.3439 = 7.2399 < 9.4118] w=0.0376 to align # Constraint # added constraint: constraint((T0321)Q215.CB, (T0321)V247.CB) [> 4.2082 = 7.0136 < 9.1177] w=0.0376 to align # Constraint # added constraint: constraint((T0321)Q215.CB, (T0321)T248.CB) [> 2.3103 = 3.8505 < 5.0057] w=0.0376 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)I240.CB) [> 4.2974 = 7.1624 < 9.3111] w=0.0376 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)Q245.CB) [> 3.3853 = 5.6421 < 7.3348] w=0.0376 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)K246.CB) [> 4.5250 = 7.5416 < 9.8041] w=0.0376 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)V247.CB) [> 3.4077 = 5.6795 < 7.3834] w=0.0376 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)T248.CB) [> 4.7475 = 7.9125 < 10.2863] w=0.0376 to align # Constraint # added constraint: constraint((T0321)E20.CB, (T0321)V36.CB) [> 4.3399 = 7.2331 < 9.4031] w=0.0374 to align # Constraint # added constraint: constraint((T0321)L21.CB, (T0321)V36.CB) [> 3.6576 = 6.0959 < 7.9247] w=0.0374 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)L79.CB) [> 4.1879 = 6.9799 < 9.0739] w=0.0371 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)Y72.CB) [> 4.1052 = 6.8419 < 8.8945] w=0.0371 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)A75.CB) [> 2.9330 = 4.8883 < 6.3548] w=0.0371 to align # Constraint # added constraint: constraint((T0321)I12.CB, (T0321)P207.CB) [> 4.2164 = 7.0273 < 9.1355] w=0.0371 to align # Constraint # added constraint: constraint((T0321)I4.CB, (T0321)M221.CB) [> 4.4785 = 7.4641 < 9.7034] w=0.0371 to align # Constraint # added constraint: constraint((T0321)I4.CB, (T0321)C23.CB) [> 4.6360 = 7.7266 < 10.0446] w=0.0371 to align # Constraint # added constraint: constraint((T0321)I4.CB, (T0321)L21.CB) [> 3.0687 = 5.1145 < 6.6489] w=0.0371 to align # Constraint # added constraint: constraint((T0321)L187.CB, (T0321)E216.CB) [> 4.6219 = 7.7031 < 10.0141] w=0.0371 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)P140.CB) [> 2.2643 = 3.7739 < 4.9061] w=0.0371 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)S218.CB) [> 3.0885 = 5.1475 < 6.6917] w=0.0371 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)L79.CB) [> 4.4344 = 7.3907 < 9.6079] w=0.0371 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)Y172.CB) [> 4.0901 = 6.8169 < 8.8620] w=0.0361 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)T174.CB) [> 4.4075 = 7.3458 < 9.5496] w=0.0361 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)V222.CB) [> 3.0847 = 5.1412 < 6.6836] w=0.0361 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)M221.CB) [> 4.3657 = 7.2762 < 9.4590] w=0.0361 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)F220.CB) [> 4.2685 = 7.1142 < 9.2485] w=0.0361 to align # Constraint # added constraint: constraint((T0321)I77.CB, (T0321)R108.CB) [> 4.4183 = 7.3638 < 9.5729] w=0.0360 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)R31.CB) [> 4.4038 = 7.3397 < 9.5416] w=0.0353 to align # Constraint # added constraint: constraint((T0321)L21.CB, (T0321)R31.CB) [> 3.9040 = 6.5067 < 8.4587] w=0.0353 to align # Constraint # added constraint: constraint((T0321)E20.CB, (T0321)R31.CB) [> 3.4940 = 5.8234 < 7.5704] w=0.0353 to align # Constraint # added constraint: constraint((T0321)V29.CB, (T0321)P40.CB) [> 4.4044 = 7.3407 < 9.5429] w=0.0352 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)G57.CA) [> 3.8558 = 6.4264 < 8.3543] w=0.0350 to align # Constraint # added constraint: constraint((T0321)W70.CB, (T0321)H133.CB) [> 4.0412 = 6.7353 < 8.7558] w=0.0349 to align # Constraint # added constraint: constraint((T0321)F99.CB, (T0321)R108.CB) [> 3.5622 = 5.9371 < 7.7182] w=0.0347 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)S116.CB) [> 3.3422 = 5.5703 < 7.2414] w=0.0347 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)F113.CB) [> 3.8434 = 6.4057 < 8.3274] w=0.0347 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)M115.CB) [> 4.3473 = 7.2455 < 9.4191] w=0.0347 to align # Constraint # added constraint: constraint((T0321)R42.CB, (T0321)A75.CB) [> 4.4008 = 7.3346 < 9.5350] w=0.0347 to align # Constraint # added constraint: constraint((T0321)M8.CB, (T0321)T25.CB) [> 3.7769 = 6.2948 < 8.1833] w=0.0347 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)P43.CB) [> 4.1740 = 6.9566 < 9.0436] w=0.0345 to align # Constraint # added constraint: constraint((T0321)F220.CB, (T0321)Q245.CB) [> 3.5652 = 5.9419 < 7.7245] w=0.0342 to align # Constraint # added constraint: constraint((T0321)G219.CA, (T0321)T248.CB) [> 4.2815 = 7.1358 < 9.2766] w=0.0342 to align # Constraint # added constraint: constraint((T0321)G219.CA, (T0321)V247.CB) [> 2.8005 = 4.6675 < 6.0677] w=0.0342 to align # Constraint # added constraint: constraint((T0321)S218.CB, (T0321)I249.CB) [> 4.7062 = 7.8437 < 10.1968] w=0.0342 to align # Constraint # added constraint: constraint((T0321)S218.CB, (T0321)T248.CB) [> 2.4903 = 4.1505 < 5.3956] w=0.0342 to align # Constraint # added constraint: constraint((T0321)S218.CB, (T0321)V247.CB) [> 3.7425 = 6.2375 < 8.1087] w=0.0342 to align # Constraint # added constraint: constraint((T0321)S218.CB, (T0321)K246.CB) [> 4.4743 = 7.4573 < 9.6944] w=0.0342 to align # Constraint # added constraint: constraint((T0321)L217.CB, (T0321)I249.CB) [> 3.0499 = 5.0832 < 6.6082] w=0.0342 to align # Constraint # added constraint: constraint((T0321)L217.CB, (T0321)T248.CB) [> 3.8505 = 6.4174 < 8.3426] w=0.0342 to align # Constraint # added constraint: constraint((T0321)L217.CB, (T0321)V247.CB) [> 4.1896 = 6.9826 < 9.0774] w=0.0342 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)I249.CB) [> 4.6192 = 7.6987 < 10.0084] w=0.0342 to align # Constraint # added constraint: constraint((T0321)P201.CB, (T0321)T248.CB) [> 4.7341 = 7.8902 < 10.2573] w=0.0342 to align # Constraint # added constraint: constraint((T0321)I231.CB, (T0321)A243.CB) [> 3.6954 = 6.1590 < 8.0066] w=0.0342 to align # Constraint # added constraint: constraint((T0321)I231.CB, (T0321)I240.CB) [> 4.7810 = 7.9684 < 10.3589] w=0.0342 to align # Constraint # added constraint: constraint((T0321)V222.CB, (T0321)K246.CB) [> 3.9483 = 6.5806 < 8.5548] w=0.0342 to align # Constraint # added constraint: constraint((T0321)V222.CB, (T0321)G244.CA) [> 3.3892 = 5.6486 < 7.3432] w=0.0342 to align # Constraint # added constraint: constraint((T0321)V222.CB, (T0321)A243.CB) [> 3.8429 = 6.4048 < 8.3262] w=0.0342 to align # Constraint # added constraint: constraint((T0321)F220.CB, (T0321)T248.CB) [> 4.7775 = 7.9626 < 10.3513] w=0.0342 to align # Constraint # added constraint: constraint((T0321)F220.CB, (T0321)V247.CB) [> 4.5247 = 7.5412 < 9.8036] w=0.0342 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)F220.CB) [> 4.6186 = 7.6977 < 10.0070] w=0.0339 to align # Constraint # added constraint: constraint((T0321)M221.CB, (T0321)I240.CB) [> 2.9500 = 4.9166 < 6.3916] w=0.0329 to align # Constraint # added constraint: constraint((T0321)Y85.CB, (T0321)M109.CB) [> 4.3114 = 7.1856 < 9.3413] w=0.0327 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)M109.CB) [> 3.4101 = 5.6836 < 7.3886] w=0.0327 to align # Constraint # added constraint: constraint((T0321)I98.CB, (T0321)R108.CB) [> 3.4522 = 5.7536 < 7.4797] w=0.0327 to align # Constraint # added constraint: constraint((T0321)L55.CB, (T0321)V97.CB) [> 2.7124 = 4.5207 < 5.8769] w=0.0325 to align # Constraint # added constraint: constraint((T0321)L55.CB, (T0321)G96.CA) [> 3.2213 = 5.3687 < 6.9794] w=0.0325 to align # Constraint # added constraint: constraint((T0321)T52.CB, (T0321)V97.CB) [> 3.4074 = 5.6790 < 7.3827] w=0.0325 to align # Constraint # added constraint: constraint((T0321)V18.CB, (T0321)V29.CB) [> 3.0315 = 5.0524 < 6.5681] w=0.0325 to align # Constraint # added constraint: constraint((T0321)F16.CB, (T0321)R31.CB) [> 3.1509 = 5.2516 < 6.8270] w=0.0325 to align # Constraint # added constraint: constraint((T0321)I98.CB, (T0321)F113.CB) [> 4.5371 = 7.5619 < 9.8305] w=0.0325 to align # Constraint # added constraint: constraint((T0321)I98.CB, (T0321)M115.CB) [> 4.2027 = 7.0046 < 9.1059] w=0.0325 to align # Constraint # added constraint: constraint((T0321)I98.CB, (T0321)S116.CB) [> 2.7412 = 4.5687 < 5.9393] w=0.0325 to align # Constraint # added constraint: constraint((T0321)D143.CB, (T0321)Y170.CB) [> 4.4141 = 7.3568 < 9.5638] w=0.0325 to align # Constraint # added constraint: constraint((T0321)I12.CB, (T0321)L21.CB) [> 4.4522 = 7.4204 < 9.6465] w=0.0322 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)M48.CB) [> 4.7114 = 7.8523 < 10.2080] w=0.0322 to align # Constraint # added constraint: constraint((T0321)M48.CB, (T0321)L58.CB) [> 2.6686 = 4.4476 < 5.7819] w=0.0322 to align # Constraint # added constraint: constraint((T0321)L55.CB, (T0321)S177.CB) [> 4.0556 = 6.7594 < 8.7872] w=0.0322 to align # Constraint # added constraint: constraint((T0321)L56.CB, (T0321)S177.CB) [> 3.7402 = 6.2337 < 8.1038] w=0.0322 to align # Constraint # added constraint: constraint((T0321)V178.CB, (T0321)G202.CA) [> 4.2182 = 7.0303 < 9.1394] w=0.0322 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)N41.CB) [> 4.2599 = 7.0998 < 9.2297] w=0.0319 to align # Constraint # added constraint: constraint((T0321)H27.CB, (T0321)N41.CB) [> 4.0345 = 6.7241 < 8.7414] w=0.0319 to align # Constraint # added constraint: constraint((T0321)A64.CB, (T0321)I231.CB) [> 2.9185 = 4.8641 < 6.3233] w=0.0318 to align # Constraint # added constraint: constraint((T0321)L38.CB, (T0321)R61.CB) [> 3.9111 = 6.5185 < 8.4741] w=0.0318 to align # Constraint # added constraint: constraint((T0321)L38.CB, (T0321)L60.CB) [> 3.3813 = 5.6355 < 7.3261] w=0.0318 to align # Constraint # added constraint: constraint((T0321)V36.CB, (T0321)T52.CB) [> 4.4302 = 7.3837 < 9.5988] w=0.0318 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)L56.CB) [> 4.4905 = 7.4841 < 9.7294] w=0.0318 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)V62.CB) [> 4.0890 = 6.8150 < 8.8595] w=0.0318 to align # Constraint # added constraint: constraint((T0321)T26.CB, (T0321)L38.CB) [> 4.7328 = 7.8880 < 10.2544] w=0.0318 to align # Constraint # added constraint: constraint((T0321)T25.CB, (T0321)R61.CB) [> 4.1102 = 6.8503 < 8.9055] w=0.0318 to align # Constraint # added constraint: constraint((T0321)I173.CB, (T0321)L187.CB) [> 3.8663 = 6.4439 < 8.3770] w=0.0318 to align # Constraint # added constraint: constraint((T0321)G126.CA, (T0321)S190.CB) [> 4.7912 = 7.9854 < 10.3810] w=0.0318 to align # Constraint # added constraint: constraint((T0321)W70.CB, (T0321)P140.CB) [> 4.1140 = 6.8567 < 8.9137] w=0.0318 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)F220.CB) [> 3.2835 = 5.4725 < 7.1142] w=0.0316 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)G219.CA) [> 3.8220 = 6.3701 < 8.2811] w=0.0316 to align # Constraint # added constraint: constraint((T0321)E216.CB, (T0321)V238.CB) [> 2.9860 = 4.9766 < 6.4696] w=0.0313 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)I196.CB) [> 4.6960 = 7.8266 < 10.1746] w=0.0313 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)T197.CB) [> 4.3992 = 7.3320 < 9.5316] w=0.0313 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)I196.CB) [> 3.0798 = 5.1330 < 6.6729] w=0.0313 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)S190.CB) [> 4.5420 = 7.5700 < 9.8411] w=0.0313 to align # Constraint # added constraint: constraint((T0321)D143.CB, (T0321)R195.CB) [> 3.9255 = 6.5425 < 8.5053] w=0.0313 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)V199.CB) [> 4.3132 = 7.1886 < 9.3452] w=0.0313 to align # Constraint # added constraint: constraint((T0321)V125.CB, (T0321)T197.CB) [> 4.7501 = 7.9168 < 10.2918] w=0.0313 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)P112.CB) [> 3.9602 = 6.6004 < 8.5805] w=0.0313 to align # Constraint # added constraint: constraint((T0321)M221.CB, (T0321)I231.CB) [> 3.8524 = 6.4207 < 8.3469] w=0.0313 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)V199.CB) [> 4.3510 = 7.2516 < 9.4271] w=0.0313 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)L183.CB) [> 4.0054 = 6.6756 < 8.6783] w=0.0313 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)S218.CB) [> 4.7199 = 7.8665 < 10.2265] w=0.0313 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)T197.CB) [> 2.8773 = 4.7955 < 6.2342] w=0.0313 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)G219.CA) [> 4.0868 = 6.8113 < 8.8547] w=0.0303 to align # Constraint # added constraint: constraint((T0321)R104.CB, (T0321)I114.CB) [> 4.2263 = 7.0438 < 9.1569] w=0.0299 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)I173.CB) [> 3.1676 = 5.2793 < 6.8631] w=0.0293 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)Y172.CB) [> 4.0304 = 6.7174 < 8.7326] w=0.0293 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)S145.CB) [> 4.0546 = 6.7576 < 8.7849] w=0.0293 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)V247.CB) [> 3.6523 = 6.0872 < 7.9133] w=0.0288 to align # Constraint # added constraint: constraint((T0321)G219.CA, (T0321)I249.CB) [> 4.5042 = 7.5070 < 9.7592] w=0.0288 to align # Constraint # added constraint: constraint((T0321)V238.CB, (T0321)I249.CB) [> 2.6237 = 4.3729 < 5.6848] w=0.0288 to align # Constraint # added constraint: constraint((T0321)I240.CB, (T0321)I249.CB) [> 3.7754 = 6.2923 < 8.1800] w=0.0288 to align # Constraint # added constraint: constraint((T0321)L137.CB, (T0321)I146.CB) [> 4.1529 = 6.9214 < 8.9978] w=0.0282 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)I196.CB) [> 4.0852 = 6.8087 < 8.8513] w=0.0276 to align # Constraint # added constraint: constraint((T0321)P112.CB, (T0321)V128.CB) [> 4.0638 = 6.7731 < 8.8050] w=0.0272 to align # Constraint # added constraint: constraint((T0321)P112.CB, (T0321)H133.CB) [> 2.9255 = 4.8758 < 6.3386] w=0.0272 to align # Constraint # added constraint: constraint((T0321)P112.CB, (T0321)S136.CB) [> 3.8521 = 6.4201 < 8.3461] w=0.0272 to align # Constraint # added constraint: constraint((T0321)P112.CB, (T0321)L137.CB) [> 3.7529 = 6.2548 < 8.1312] w=0.0272 to align # Constraint # added constraint: constraint((T0321)I114.CB, (T0321)P140.CB) [> 4.1208 = 6.8680 < 8.9284] w=0.0272 to align # Constraint # added constraint: constraint((T0321)S116.CB, (T0321)G126.CA) [> 3.6164 = 6.0274 < 7.8356] w=0.0272 to align # Constraint # added constraint: constraint((T0321)S116.CB, (T0321)V128.CB) [> 4.3922 = 7.3203 < 9.5164] w=0.0272 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)Y172.CB) [> 3.0315 = 5.0526 < 6.5683] w=0.0272 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)L205.CB) [> 2.7212 = 4.5353 < 5.8959] w=0.0229 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)V199.CB) [> 4.6138 = 7.6896 < 9.9965] w=0.0194 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)F229.CB) [> 4.0310 = 6.7184 < 8.7339] w=0.0194 to align # Constraint # added constraint: constraint((T0321)I4.CB, (T0321)H27.CB) [> 4.3531 = 7.2552 < 9.4318] w=0.0190 to align # Constraint # added constraint: constraint((T0321)I4.CB, (T0321)V18.CB) [> 4.6653 = 7.7755 < 10.1081] w=0.0190 to align # Constraint # added constraint: constraint((T0321)S28.CB, (T0321)A92.CB) [> 4.1271 = 6.8785 < 8.9421] w=0.0190 to align # Constraint # added constraint: constraint((T0321)H27.CB, (T0321)L56.CB) [> 3.8704 = 6.4506 < 8.3858] w=0.0190 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)S32.CB) [> 4.2442 = 7.0736 < 9.1957] w=0.0190 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)S190.CB) [> 3.3587 = 5.5978 < 7.2771] w=0.0190 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)S190.CB) [> 3.2621 = 5.4369 < 7.0680] w=0.0190 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)S116.CB) [> 4.3078 = 7.1797 < 9.3336] w=0.0190 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)P112.CB) [> 3.7032 = 6.1719 < 8.0235] w=0.0190 to align # Constraint # added constraint: constraint((T0321)S177.CB, (T0321)L205.CB) [> 3.0681 = 5.1136 < 6.6476] w=0.0190 to align # Constraint # added constraint: constraint((T0321)I141.CB, (T0321)A233.CB) [> 4.7428 = 7.9046 < 10.2760] w=0.0190 to align # Constraint # added constraint: constraint((T0321)L137.CB, (T0321)F229.CB) [> 3.4171 = 5.6952 < 7.4038] w=0.0190 to align # Constraint # added constraint: constraint((T0321)E74.CB, (T0321)H95.CB) [> 4.2166 = 7.0277 < 9.1360] w=0.0190 to align # Constraint # added constraint: constraint((T0321)W70.CB, (T0321)E167.CB) [> 4.5836 = 7.6393 < 9.9311] w=0.0190 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)H95.CB) [> 4.2430 = 7.0716 < 9.1931] w=0.0190 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)S190.CB) [> 3.3877 = 5.6462 < 7.3401] w=0.0190 to align # Constraint # added constraint: constraint((T0321)C23.CB, (T0321)L55.CB) [> 4.2270 = 7.0450 < 9.1585] w=0.0189 to align # Constraint # added constraint: constraint((T0321)G24.CA, (T0321)L55.CB) [> 2.7518 = 4.5863 < 5.9622] w=0.0189 to align # Constraint # added constraint: constraint((T0321)W2.CB, (T0321)L21.CB) [> 4.7639 = 7.9398 < 10.3217] w=0.0189 to align # Constraint # added constraint: constraint((T0321)M8.CB, (T0321)H27.CB) [> 4.2873 = 7.1455 < 9.2891] w=0.0189 to align # Constraint # added constraint: constraint((T0321)M8.CB, (T0321)V36.CB) [> 4.3903 = 7.3171 < 9.5122] w=0.0189 to align # Constraint # added constraint: constraint((T0321)I9.CB, (T0321)H27.CB) [> 4.3937 = 7.3229 < 9.5197] w=0.0189 to align # Constraint # added constraint: constraint((T0321)I9.CB, (T0321)V36.CB) [> 4.5450 = 7.5750 < 9.8475] w=0.0189 to align # Constraint # added constraint: constraint((T0321)D19.CB, (T0321)S28.CB) [> 4.4597 = 7.4328 < 9.6627] w=0.0189 to align # Constraint # added constraint: constraint((T0321)E20.CB, (T0321)G37.CA) [> 3.5460 = 5.9101 < 7.6831] w=0.0189 to align # Constraint # added constraint: constraint((T0321)L21.CB, (T0321)G37.CA) [> 3.9198 = 6.5329 < 8.4928] w=0.0189 to align # Constraint # added constraint: constraint((T0321)V22.CB, (T0321)L38.CB) [> 4.1779 = 6.9632 < 9.0521] w=0.0189 to align # Constraint # added constraint: constraint((T0321)F44.CB, (T0321)P59.CB) [> 3.7552 = 6.2586 < 8.1362] w=0.0189 to align # Constraint # added constraint: constraint((T0321)P13.CB, (T0321)T25.CB) [> 3.4038 = 5.6730 < 7.3749] w=0.0188 to align # Constraint # added constraint: constraint((T0321)I12.CB, (T0321)T25.CB) [> 4.4517 = 7.4194 < 9.6453] w=0.0188 to align # Constraint # added constraint: constraint((T0321)Y5.CB, (T0321)V29.CB) [> 2.8493 = 4.7488 < 6.1734] w=0.0188 to align # Constraint # added constraint: constraint((T0321)Y5.CB, (T0321)T25.CB) [> 4.0755 = 6.7926 < 8.8303] w=0.0188 to align # Constraint # added constraint: constraint((T0321)E3.CB, (T0321)S177.CB) [> 4.3095 = 7.1825 < 9.3372] w=0.0188 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)S177.CB) [> 4.7672 = 7.9453 < 10.3288] w=0.0188 to align # Constraint # added constraint: constraint((T0321)A84.CB, (T0321)G244.CA) [> 4.3373 = 7.2288 < 9.3975] w=0.0188 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)G202.CA) [> 4.6559 = 7.7599 < 10.0879] w=0.0188 to align # Constraint # added constraint: constraint((T0321)G37.CA, (T0321)V178.CB) [> 4.7421 = 7.9035 < 10.2745] w=0.0185 to align # Constraint # added constraint: constraint((T0321)H27.CB, (T0321)N225.CB) [> 3.6943 = 6.1571 < 8.0043] w=0.0181 to align # Constraint # added constraint: constraint((T0321)V29.CB, (T0321)F229.CB) [> 3.4804 = 5.8007 < 7.5409] w=0.0181 to align # Constraint # added constraint: constraint((T0321)V29.CB, (T0321)V232.CB) [> 3.5991 = 5.9984 < 7.7979] w=0.0181 to align # Constraint # added constraint: constraint((T0321)I30.CB, (T0321)F229.CB) [> 4.1024 = 6.8373 < 8.8885] w=0.0181 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)S136.CB) [> 3.7354 = 6.2257 < 8.0934] w=0.0181 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)A235.CB) [> 3.7016 = 6.1693 < 8.0201] w=0.0181 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)I231.CB) [> 2.8827 = 4.8045 < 6.2458] w=0.0181 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)G126.CA) [> 4.7699 = 7.9499 < 10.3349] w=0.0181 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)V127.CB) [> 3.8342 = 6.3903 < 8.3074] w=0.0181 to align # Constraint # added constraint: constraint((T0321)D180.CB, (T0321)L209.CB) [> 2.6281 = 4.3801 < 5.6942] w=0.0171 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)L209.CB) [> 4.7883 = 7.9805 < 10.3746] w=0.0171 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)P207.CB) [> 3.2250 = 5.3750 < 6.9875] w=0.0170 to align # Constraint # added constraint: constraint((T0321)F229.CB, (T0321)Y241.CB) [> 4.3271 = 7.2119 < 9.3754] w=0.0170 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)G200.CA) [> 4.3604 = 7.2673 < 9.4474] w=0.0169 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)I196.CB) [> 4.5686 = 7.6143 < 9.8986] w=0.0169 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)L198.CB) [> 3.6695 = 6.1158 < 7.9506] w=0.0169 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)H133.CB) [> 3.5303 = 5.8839 < 7.6490] w=0.0165 to align # Constraint # added constraint: constraint((T0321)I30.CB, (T0321)P40.CB) [> 4.2181 = 7.0302 < 9.1393] w=0.0163 to align # Constraint # added constraint: constraint((T0321)L17.CB, (T0321)N34.CB) [> 4.6180 = 7.6966 < 10.0056] w=0.0163 to align # Constraint # added constraint: constraint((T0321)T25.CB, (T0321)E45.CB) [> 3.2620 = 5.4367 < 7.0678] w=0.0161 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)T197.CB) [> 3.1887 = 5.3144 < 6.9088] w=0.0161 to align # Constraint # added constraint: constraint((T0321)I12.CB, (T0321)C23.CB) [> 4.4635 = 7.4392 < 9.6710] w=0.0159 to align # Constraint # added constraint: constraint((T0321)V171.CB, (T0321)L187.CB) [> 4.7515 = 7.9191 < 10.2948] w=0.0159 to align # Constraint # added constraint: constraint((T0321)L79.CB, (T0321)G202.CA) [> 4.7670 = 7.9451 < 10.3286] w=0.0157 to align # Constraint # added constraint: constraint((T0321)H95.CB, (T0321)V128.CB) [> 4.3081 = 7.1802 < 9.3343] w=0.0157 to align # Constraint # added constraint: constraint((T0321)G96.CA, (T0321)M109.CB) [> 4.4779 = 7.4631 < 9.7020] w=0.0157 to align # Constraint # added constraint: constraint((T0321)V127.CB, (T0321)Y170.CB) [> 4.7097 = 7.8495 < 10.2043] w=0.0157 to align # Constraint # added constraint: constraint((T0321)L158.CB, (T0321)S177.CB) [> 3.5307 = 5.8845 < 7.6498] w=0.0157 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)T197.CB) [> 4.5481 = 7.5802 < 9.8542] w=0.0157 to align # Constraint # added constraint: constraint((T0321)V178.CB, (T0321)T197.CB) [> 3.2055 = 5.3425 < 6.9453] w=0.0157 to align # Constraint # added constraint: constraint((T0321)S145.CB, (T0321)I173.CB) [> 3.8412 = 6.4021 < 8.3227] w=0.0157 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)T174.CB) [> 4.3644 = 7.2740 < 9.4561] w=0.0157 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)C175.CB) [> 3.5403 = 5.9005 < 7.6706] w=0.0157 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)I173.CB) [> 4.1143 = 6.8572 < 8.9143] w=0.0157 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)T174.CB) [> 3.0357 = 5.0594 < 6.5773] w=0.0157 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)C175.CB) [> 3.0857 = 5.1428 < 6.6856] w=0.0157 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)A176.CB) [> 2.9233 = 4.8722 < 6.3338] w=0.0157 to align # Constraint # added constraint: constraint((T0321)L147.CB, (T0321)S177.CB) [> 3.5503 = 5.9171 < 7.6922] w=0.0157 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)P201.CB) [> 3.9469 = 6.5782 < 8.5517] w=0.0146 to align # Constraint # added constraint: constraint((T0321)A81.CB, (T0321)S218.CB) [> 2.3926 = 3.9877 < 5.1840] w=0.0146 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)T197.CB) [> 3.4634 = 5.7724 < 7.5041] w=0.0146 to align # Constraint # added constraint: constraint((T0321)I82.CB, (T0321)S218.CB) [> 4.5918 = 7.6530 < 9.9489] w=0.0146 to align # Constraint # added constraint: constraint((T0321)Y86.CB, (T0321)E216.CB) [> 4.5868 = 7.6447 < 9.9382] w=0.0146 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)E216.CB) [> 4.6550 = 7.7584 < 10.0859] w=0.0146 to align # Constraint # added constraint: constraint((T0321)Y172.CB, (T0321)L217.CB) [> 2.5473 = 4.2454 < 5.5191] w=0.0146 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)L217.CB) [> 4.6027 = 7.6712 < 9.9725] w=0.0146 to align # Constraint # added constraint: constraint((T0321)T174.CB, (T0321)S218.CB) [> 4.2916 = 7.1527 < 9.2985] w=0.0146 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)S218.CB) [> 3.5130 = 5.8551 < 7.6116] w=0.0146 to align # Constraint # added constraint: constraint((T0321)C175.CB, (T0321)F220.CB) [> 3.4486 = 5.7477 < 7.4720] w=0.0146 to align # Constraint # added constraint: constraint((T0321)A176.CB, (T0321)F220.CB) [> 3.1649 = 5.2748 < 6.8573] w=0.0146 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)I231.CB) [> 4.7025 = 7.8375 < 10.1888] w=0.0146 to align # Constraint # added constraint: constraint((T0321)H133.CB, (T0321)A176.CB) [> 4.0052 = 6.6754 < 8.6780] w=0.0144 to align # Constraint # added constraint: constraint((T0321)F220.CB, (T0321)G244.CA) [> 3.9901 = 6.6501 < 8.6452] w=0.0144 to align # Constraint # added constraint: constraint((T0321)F220.CB, (T0321)Y241.CB) [> 4.2071 = 7.0119 < 9.1154] w=0.0144 to align # Constraint # added constraint: constraint((T0321)G219.CA, (T0321)G244.CA) [> 3.7508 = 6.2513 < 8.1267] w=0.0144 to align # Constraint # added constraint: constraint((T0321)S218.CB, (T0321)Y241.CB) [> 4.2867 = 7.1445 < 9.2878] w=0.0144 to align # Constraint # added constraint: constraint((T0321)A80.CB, (T0321)P201.CB) [> 4.4467 = 7.4111 < 9.6344] w=0.0138 to align # Constraint # added constraint: constraint((T0321)M109.CB, (T0321)S136.CB) [> 2.4591 = 4.0984 < 5.3280] w=0.0136 to align # Constraint # added constraint: constraint((T0321)V97.CB, (T0321)H133.CB) [> 4.6952 = 7.8253 < 10.1728] w=0.0136 to align # Constraint # added constraint: constraint((T0321)V97.CB, (T0321)G129.CA) [> 3.3047 = 5.5079 < 7.1602] w=0.0136 to align # Constraint # added constraint: constraint((T0321)V97.CB, (T0321)V128.CB) [> 3.8050 = 6.3417 < 8.2442] w=0.0136 to align # Constraint # added constraint: constraint((T0321)I146.CB, (T0321)Y172.CB) [> 2.9409 = 4.9015 < 6.3720] w=0.0136 to align # Constraint # added constraint: constraint((T0321)F131.CB, (T0321)S145.CB) [> 4.5406 = 7.5677 < 9.8380] w=0.0136 to align # Constraint # added constraint: constraint((T0321)G129.CA, (T0321)A206.CB) [> 4.4538 = 7.4229 < 9.6498] w=0.0058 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)V222.CB) [> 4.1050 = 6.8417 < 8.8942] w=0.0058 to align # Constraint # added constraint: constraint((T0321)L198.CB, (T0321)M221.CB) [> 3.1271 = 5.2119 < 6.7754] w=0.0058 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)V222.CB) [> 3.2691 = 5.4485 < 7.0830] w=0.0058 to align # Constraint # added constraint: constraint((T0321)S190.CB, (T0321)G219.CA) [> 4.2602 = 7.1003 < 9.2304] w=0.0058 to align # Constraint # added constraint: constraint((T0321)R195.CB, (T0321)F220.CB) [> 3.8681 = 6.4468 < 8.3808] w=0.0058 to align # Constraint # added constraint: constraint((T0321)I196.CB, (T0321)G219.CA) [> 3.0819 = 5.1365 < 6.6775] w=0.0058 to align # Constraint # added constraint: constraint((T0321)I196.CB, (T0321)F220.CB) [> 4.1022 = 6.8371 < 8.8882] w=0.0058 to align # Constraint # added constraint: constraint((T0321)T197.CB, (T0321)M221.CB) [> 4.3394 = 7.2323 < 9.4020] w=0.0058 to align # Constraint # added constraint: constraint((T0321)L137.CB, (T0321)T174.CB) [> 3.6828 = 6.1379 < 7.9793] w=0.0039 to align # Constraint # added constraint: constraint((T0321)L137.CB, (T0321)C175.CB) [> 3.8982 = 6.4971 < 8.4462] w=0.0039 to align # Constraint # added constraint: constraint((T0321)L137.CB, (T0321)G202.CA) [> 3.5902 = 5.9836 < 7.7787] w=0.0039 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0321/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0321/decoys/ # ReadConformPDB reading from PDB file chimera-domains.pdb.gz looking for model 1 # Found a chain break before 240 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file chimera-domains2.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 182 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 211 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 173 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 173 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 216 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 247 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 245 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 247 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 162 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 244 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # Found a chain break before 240 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 218 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)L138.C and (T0321)E139.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.CA only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.CA only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.CB only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.CB only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.CB only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E139.CG only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.CG only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.CG only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.CG only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E139.CD only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E139.CD only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.CD only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.CD only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.CD only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E139.OE1 only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E139.OE1 only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E139.OE1 only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.OE1 only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.OE1 only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.OE1 only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E139.OE2 only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E139.OE2 only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E139.OE2 only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E139.OE2 only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.OE2 only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.OE2 only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.OE2 only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.O only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E139.C only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)P140.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)P140.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)P140.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)P140.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)P140.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)P140.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)P140.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)P140.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)P140.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)P140.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)P140.N and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)P140.CA only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.N and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.C and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.O and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)P140.CG only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.N and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.C and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.O and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)E139.N and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)L138.C and (T0321)P140.CD only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)P140.O only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)P140.C only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.CA only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.CB only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.CG1 only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.CG2 only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.CD1 only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.O only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I141.C only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)C142.N only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)C142.N only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)C142.N only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)C142.N only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)C142.N only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)C142.N only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)C142.N only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)C142.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)P140.C and (T0321)C142.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)C142.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)C142.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)C142.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)C142.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)C142.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)C142.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)C142.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)C142.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)C142.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)C142.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)C142.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)C142.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)C142.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)C142.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)C142.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)C142.N only 0.000 apart, marking (T0321)C142.N as missing WARNING: atoms too close: (T0321)C142.N and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.C and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.O and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)C142.CA only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.N and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.C and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.O and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)C142.CB only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.N and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.C and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.O and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)I141.N and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)P140.C and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)P140.O and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)P140.N and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.C and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.O and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)C142.SG only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.N and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.C and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)C142.O only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.O and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.N and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)C142.C only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.N only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.N only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.N only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.N only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.N only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.N only 0.000 apart, marking (T0321)C142.N as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.N only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.N only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.N only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.N only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.N only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.N only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.N only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.N only 0.000 apart, marking (T0321)D143.N as missing WARNING: atoms too close: (T0321)D143.N and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.CA only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)D143.N and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.CB only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.N and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.CG only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.OD1 only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.OD2 only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.N and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.O only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.O and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.N and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)C142.C and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)C142.N and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)D143.C only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.N only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.N only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.N only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.N only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.N only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.N only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.N only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.N only 0.000 apart, marking (T0321)D143.N as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.N only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.N only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.N only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.N only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.N only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.N only 0.000 apart, marking (T0321)C142.N as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.N only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.N only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.N only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.N only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.N only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.N only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.N only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.N only 0.000 apart, marking (T0321)L144.N as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.CA only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.CG only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.CD1 only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.CD2 only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.O only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L144.C only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.C and (T0321)S145.N only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)S145.N only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)S145.N only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)S145.N only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)S145.N only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)S145.N only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)S145.N only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)S145.N only 0.000 apart, marking (T0321)L144.N as missing WARNING: atoms too close: (T0321)D143.C and (T0321)S145.N only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)S145.N only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)S145.N only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)S145.N only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)S145.N only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)S145.N only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)S145.N only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)S145.N only 0.000 apart, marking (T0321)D143.N as missing WARNING: atoms too close: (T0321)C142.C and (T0321)S145.N only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)S145.N only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)S145.N only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)S145.N only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)S145.N only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)S145.N only 0.000 apart, marking (T0321)C142.N as missing WARNING: atoms too close: (T0321)I141.C and (T0321)S145.N only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)S145.N only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)S145.N only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)S145.N only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)S145.N only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)S145.N only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)S145.N only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)S145.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)P140.C and (T0321)S145.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)S145.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)S145.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)S145.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)S145.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)S145.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)S145.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)S145.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)S145.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)S145.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)S145.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)S145.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)S145.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)S145.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)S145.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)S145.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)S145.N only 0.000 apart, marking (T0321)S145.N as missing WARNING: atoms too close: (T0321)S145.N and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.C and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.O and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.C and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.O and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)C142.C and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)C142.O and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.C and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.O and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)S145.CA only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)S145.N and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.C and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.O and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L144.N and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.C and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.O and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)D143.N and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)C142.C and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)C142.O and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)C142.N and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.C and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.O and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)S145.N and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.C and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.O and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L144.N and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.C and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.O and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)D143.N and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)C142.C and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)C142.O and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)C142.N and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.C and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.O and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)I141.N and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)P140.C and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)P140.O and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)P140.N and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.C and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.O and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)S145.OG only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)S145.N and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.C and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.O and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L144.N and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.C and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.O and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)D143.N and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)C142.C and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)C142.O and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)C142.N and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.C and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)S145.O only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)S145.O and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.N and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.C and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L144.N and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.C and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)D143.N and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)C142.C and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)C142.N and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)S145.C only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.N only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.N only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.N only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.N only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.N only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.N only 0.000 apart, marking (T0321)S145.N as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.N only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.N only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.N only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.N only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.N only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.N only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.N only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.N only 0.000 apart, marking (T0321)L144.N as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.N only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.N only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.N only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.N only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.N only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.N only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.N only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.N only 0.000 apart, marking (T0321)D143.N as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.N only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.N only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.N only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.N only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.N only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.N only 0.000 apart, marking (T0321)C142.N as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.N only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.N only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.N only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.N only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.N only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.N only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.N only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.N only 0.000 apart, marking (T0321)I146.N as missing WARNING: atoms too close: (T0321)I146.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.CA only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I146.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I146.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.CG1 only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I146.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.CG2 only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I146.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.CD1 only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.O only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)S145.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)S145.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)S145.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L144.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)D143.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)C142.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)C142.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)I146.C only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.N only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.N only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.N only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.N only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.N only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.N only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.N only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.N only 0.000 apart, marking (T0321)I146.N as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.N only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.N only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.N only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.N only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.N only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.N only 0.000 apart, marking (T0321)S145.N as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.N only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.N only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.N only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.N only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.N only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.N only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.N only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.N only 0.000 apart, marking (T0321)L144.N as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.N only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.N only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.N only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.N only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.N only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.N only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.N only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.N only 0.000 apart, marking (T0321)D143.N as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.N only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.N only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.N only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.N only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.N only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.N only 0.000 apart, marking (T0321)C142.N as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.N only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.N only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.N only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.N only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.N only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.N only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.N only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.N only 0.000 apart, marking (T0321)L147.N as missing WARNING: atoms too close: (T0321)L147.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.CA only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L147.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.CB only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L147.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.CG only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L147.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.CD1 only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L147.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.CD2 only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L147.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.O only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L147.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I146.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)S145.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)S145.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)S145.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L144.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)D143.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)C142.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)C142.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)L147.C only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.N only 0.000 apart, marking (T0321)L147.C as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.N only 0.000 apart, marking (T0321)L147.O as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.N only 0.000 apart, marking (T0321)L147.CD2 as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.N only 0.000 apart, marking (T0321)L147.CD1 as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.N only 0.000 apart, marking (T0321)L147.CG as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.N only 0.000 apart, marking (T0321)L147.CB as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.N only 0.000 apart, marking (T0321)L147.CA as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.N only 0.000 apart, marking (T0321)L147.N as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.N only 0.000 apart, marking (T0321)I146.C as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.N only 0.000 apart, marking (T0321)I146.O as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.N only 0.000 apart, marking (T0321)I146.CD1 as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.N only 0.000 apart, marking (T0321)I146.CG2 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.N only 0.000 apart, marking (T0321)I146.CG1 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.N only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.N only 0.000 apart, marking (T0321)I146.CA as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.N only 0.000 apart, marking (T0321)I146.N as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.N only 0.000 apart, marking (T0321)S145.C as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.N only 0.000 apart, marking (T0321)S145.O as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.N only 0.000 apart, marking (T0321)S145.OG as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.N only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.N only 0.000 apart, marking (T0321)S145.CA as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.N only 0.000 apart, marking (T0321)S145.N as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.N only 0.000 apart, marking (T0321)L144.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.N only 0.000 apart, marking (T0321)L144.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.N only 0.000 apart, marking (T0321)L144.CD2 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.N only 0.000 apart, marking (T0321)L144.CD1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.N only 0.000 apart, marking (T0321)L144.CG as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.N only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.N only 0.000 apart, marking (T0321)L144.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.N only 0.000 apart, marking (T0321)L144.N as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.N only 0.000 apart, marking (T0321)D143.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.N only 0.000 apart, marking (T0321)D143.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.N only 0.000 apart, marking (T0321)D143.OD2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.N only 0.000 apart, marking (T0321)D143.OD1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.N only 0.000 apart, marking (T0321)D143.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.N only 0.000 apart, marking (T0321)D143.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.N only 0.000 apart, marking (T0321)D143.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.N only 0.000 apart, marking (T0321)D143.N as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.N only 0.000 apart, marking (T0321)C142.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.N only 0.000 apart, marking (T0321)C142.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.N only 0.000 apart, marking (T0321)C142.SG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.N only 0.000 apart, marking (T0321)C142.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.N only 0.000 apart, marking (T0321)C142.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.N only 0.000 apart, marking (T0321)C142.N as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.N only 0.000 apart, marking (T0321)I141.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.N only 0.000 apart, marking (T0321)I141.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.N only 0.000 apart, marking (T0321)I141.CD1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.N only 0.000 apart, marking (T0321)I141.CG2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.N only 0.000 apart, marking (T0321)I141.CG1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.N only 0.000 apart, marking (T0321)I141.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.N only 0.000 apart, marking (T0321)I141.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.N only 0.000 apart, marking (T0321)I141.N as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.N only 0.000 apart, marking (T0321)P140.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.N only 0.000 apart, marking (T0321)P140.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.N only 0.000 apart, marking (T0321)P140.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.N only 0.000 apart, marking (T0321)P140.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.N only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.N only 0.000 apart, marking (T0321)P140.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.N only 0.000 apart, marking (T0321)P140.N as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.N only 0.000 apart, marking (T0321)E139.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.N only 0.000 apart, marking (T0321)E139.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.N only 0.000 apart, marking (T0321)E139.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.N only 0.000 apart, marking (T0321)E139.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.N only 0.000 apart, marking (T0321)E139.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.N only 0.000 apart, marking (T0321)E139.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.N only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.N only 0.000 apart, marking (T0321)E139.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.N only 0.000 apart, marking (T0321)E139.N as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.N only 0.000 apart, marking (T0321)E148.N as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.CA only 0.000 apart, marking (T0321)E148.CA as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)E148.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.CG only 0.000 apart, marking (T0321)E148.CG as missing WARNING: atoms too close: (T0321)E148.CG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E148.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.CD only 0.000 apart, marking (T0321)E148.CD as missing WARNING: atoms too close: (T0321)E148.CD and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E148.CG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E148.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.OE1 only 0.000 apart, marking (T0321)E148.OE1 as missing WARNING: atoms too close: (T0321)E148.OE1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E148.CD and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E148.CG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E148.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.OE2 only 0.000 apart, marking (T0321)E148.OE2 as missing WARNING: atoms too close: (T0321)E148.OE2 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E148.OE1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E148.CD and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E148.CG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E148.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.O only 0.000 apart, marking (T0321)E148.O as missing WARNING: atoms too close: (T0321)E148.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E148.OE2 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E148.OE1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E148.CD and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E148.CG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E148.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E148.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.CD2 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.CD1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.CG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L147.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.CD1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.CG2 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.CG1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I146.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)S145.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)S145.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)S145.OG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)S145.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)S145.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.CD2 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.CD1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.CG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L144.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.OD2 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.OD1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.CG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)D143.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)C142.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)C142.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)C142.SG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)C142.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)C142.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)C142.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.CD1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.CG2 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.CG1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)I141.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)P140.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)P140.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)P140.CD and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)P140.CG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)P140.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)P140.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.O and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.OE2 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.OE1 and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.CD and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.CG and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.CB and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)E139.N and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing WARNING: atoms too close: (T0321)L138.C and (T0321)E148.C only 0.000 apart, marking (T0321)E148.C as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 218 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 210 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 138 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 204 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 240 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 240 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 169 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 241 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 217 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 233 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # Found a chain break before 194 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # Found a chain break before 12 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 244 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # Found a chain break before 72 # copying to AlignedFragments data structure # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 72 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # Found a chain break before 177 # copying to AlignedFragments data structure # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/MIG_FROST_AL1.pdb.gz looking for model 1 Error: Reading chain '' from PDB file servers/MIG_FROST_AL1.pdb.gz failed---no such chain. # naming current conformation MIG_FROST_AL1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS1.pdb.gz looking for model 1 # Found a chain break before 44 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS2.pdb.gz looking for model 1 # Found a chain break before 220 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS3.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS4.pdb.gz looking for model 1 # Found a chain break before 230 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS5.pdb.gz looking for model 1 # Found a chain break before 132 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 229 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 238 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 230 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS1.pdb.gz looking for model 1 # Found a chain break before 208 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS2.pdb.gz looking for model 1 WARNING: atom 1 has residue number 3 < previous residue 251 in servers/POMYSL_TS2.pdb.gz # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation POMYSL_TS2 # ReadConformPDB reading from PDB file servers/POMYSL_TS3.pdb.gz looking for model 1 WARNING: atom 1 has residue number 84 < previous residue 251 in servers/POMYSL_TS3.pdb.gz # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation POMYSL_TS3 # ReadConformPDB reading from PDB file servers/POMYSL_TS4.pdb.gz looking for model 1 # Found a chain break before 207 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS4 # ReadConformPDB reading from PDB file servers/POMYSL_TS5.pdb.gz looking for model 1 WARNING: atom 1 has residue number 3 < previous residue 251 in servers/POMYSL_TS5.pdb.gz # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation POMYSL_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # Found a chain break before 88 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # Found a chain break before 246 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # Found a chain break before 246 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 182 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 117 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 225 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 133 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 241 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 245 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 246 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 59 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 237 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 170 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 235 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 237 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 237 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 229 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 237 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)N41.CA and (T0321)N41.CB only 0.000 apart, marking (T0321)N41.CB as missing WARNING: atoms too close: (T0321)R42.CA and (T0321)R42.CB only 0.000 apart, marking (T0321)R42.CB as missing WARNING: atoms too close: (T0321)Q53.CA and (T0321)Q53.CB only 0.000 apart, marking (T0321)Q53.CB as missing WARNING: atoms too close: (T0321)N54.CA and (T0321)N54.CB only 0.000 apart, marking (T0321)N54.CB as missing WARNING: atoms too close: (T0321)V62.CA and (T0321)V62.CB only 0.000 apart, marking (T0321)V62.CB as missing WARNING: atoms too close: (T0321)A81.CA and (T0321)A81.CB only 0.000 apart, marking (T0321)A81.CB as missing WARNING: atoms too close: (T0321)N83.CA and (T0321)N83.CB only 0.000 apart, marking (T0321)N83.CB as missing WARNING: atoms too close: (T0321)R104.CA and (T0321)R104.CB only 0.000 apart, marking (T0321)R104.CB as missing WARNING: atoms too close: (T0321)E119.CA and (T0321)E119.CB only 0.000 apart, marking (T0321)E119.CB as missing WARNING: atoms too close: (T0321)S136.CA and (T0321)S136.CB only 0.000 apart, marking (T0321)S136.CB as missing WARNING: atoms too close: (T0321)P140.CA and (T0321)P140.CB only 0.000 apart, marking (T0321)P140.CB as missing WARNING: atoms too close: (T0321)D155.CA and (T0321)D155.CB only 0.000 apart, marking (T0321)D155.CB as missing WARNING: atoms too close: (T0321)Y156.CA and (T0321)Y156.CB only 0.000 apart, marking (T0321)Y156.CB as missing WARNING: atoms too close: (T0321)P159.CA and (T0321)P159.CB only 0.000 apart, marking (T0321)P159.CB as missing WARNING: atoms too close: (T0321)A160.CA and (T0321)A160.CB only 0.000 apart, marking (T0321)A160.CB as missing WARNING: atoms too close: (T0321)F163.CA and (T0321)F163.CB only 0.000 apart, marking (T0321)F163.CB as missing WARNING: atoms too close: (T0321)I164.CA and (T0321)I164.CB only 0.000 apart, marking (T0321)I164.CB as missing WARNING: atoms too close: (T0321)Y170.CA and (T0321)Y170.CB only 0.000 apart, marking (T0321)Y170.CB as missing WARNING: atoms too close: (T0321)Y172.CA and (T0321)Y172.CB only 0.000 apart, marking (T0321)Y172.CB as missing WARNING: atoms too close: (T0321)T182.CA and (T0321)T182.CB only 0.000 apart, marking (T0321)T182.CB as missing WARNING: atoms too close: (T0321)R185.CA and (T0321)R185.CB only 0.000 apart, marking (T0321)R185.CB as missing WARNING: atoms too close: (T0321)N192.CA and (T0321)N192.CB only 0.000 apart, marking (T0321)N192.CB as missing WARNING: atoms too close: (T0321)R195.CA and (T0321)R195.CB only 0.000 apart, marking (T0321)R195.CB as missing WARNING: atoms too close: (T0321)T197.CA and (T0321)T197.CB only 0.000 apart, marking (T0321)T197.CB as missing WARNING: atoms too close: (T0321)T203.CA and (T0321)T203.CB only 0.000 apart, marking (T0321)T203.CB as missing WARNING: atoms too close: (T0321)E216.CA and (T0321)E216.CB only 0.000 apart, marking (T0321)E216.CB as missing WARNING: atoms too close: (T0321)S242.CA and (T0321)S242.CB only 0.000 apart, marking (T0321)S242.CB as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)I9.CA and (T0321)I9.CB only 0.000 apart, marking (T0321)I9.CB as missing WARNING: atoms too close: (T0321)F16.CA and (T0321)F16.CB only 0.000 apart, marking (T0321)F16.CB as missing WARNING: atoms too close: (T0321)N41.CA and (T0321)N41.CB only 0.000 apart, marking (T0321)N41.CB as missing WARNING: atoms too close: (T0321)Q53.CA and (T0321)Q53.CB only 0.000 apart, marking (T0321)Q53.CB as missing WARNING: atoms too close: (T0321)V62.CA and (T0321)V62.CB only 0.000 apart, marking (T0321)V62.CB as missing WARNING: atoms too close: (T0321)I77.CA and (T0321)I77.CB only 0.000 apart, marking (T0321)I77.CB as missing WARNING: atoms too close: (T0321)S100.CA and (T0321)S100.CB only 0.000 apart, marking (T0321)S100.CB as missing WARNING: atoms too close: (T0321)R104.CA and (T0321)R104.CB only 0.000 apart, marking (T0321)R104.CB as missing WARNING: atoms too close: (T0321)E119.CA and (T0321)E119.CB only 0.000 apart, marking (T0321)E119.CB as missing WARNING: atoms too close: (T0321)K124.CA and (T0321)K124.CB only 0.000 apart, marking (T0321)K124.CB as missing WARNING: atoms too close: (T0321)V127.CA and (T0321)V127.CB only 0.000 apart, marking (T0321)V127.CB as missing WARNING: atoms too close: (T0321)L138.CA and (T0321)L138.CB only 0.000 apart, marking (T0321)L138.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.CB only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)D155.CA and (T0321)D155.CB only 0.000 apart, marking (T0321)D155.CB as missing WARNING: atoms too close: (T0321)Y156.CA and (T0321)Y156.CB only 0.000 apart, marking (T0321)Y156.CB as missing WARNING: atoms too close: (T0321)I164.CA and (T0321)I164.CB only 0.000 apart, marking (T0321)I164.CB as missing WARNING: atoms too close: (T0321)C168.CA and (T0321)C168.CB only 0.000 apart, marking (T0321)C168.CB as missing WARNING: atoms too close: (T0321)Y170.CA and (T0321)Y170.CB only 0.000 apart, marking (T0321)Y170.CB as missing WARNING: atoms too close: (T0321)A176.CA and (T0321)A176.CB only 0.000 apart, marking (T0321)A176.CB as missing WARNING: atoms too close: (T0321)R185.CA and (T0321)R185.CB only 0.000 apart, marking (T0321)R185.CB as missing WARNING: atoms too close: (T0321)T203.CA and (T0321)T203.CB only 0.000 apart, marking (T0321)T203.CB as missing WARNING: atoms too close: (T0321)A206.CA and (T0321)A206.CB only 0.000 apart, marking (T0321)A206.CB as missing WARNING: atoms too close: (T0321)L209.CA and (T0321)L209.CB only 0.000 apart, marking (T0321)L209.CB as missing WARNING: atoms too close: (T0321)H212.CA and (T0321)H212.CB only 0.000 apart, marking (T0321)H212.CB as missing WARNING: atoms too close: (T0321)K223.CA and (T0321)K223.CB only 0.000 apart, marking (T0321)K223.CB as missing WARNING: atoms too close: (T0321)F229.CA and (T0321)F229.CB only 0.000 apart, marking (T0321)F229.CB as missing WARNING: atoms too close: (T0321)S242.CA and (T0321)S242.CB only 0.000 apart, marking (T0321)S242.CB as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)M8.CA and (T0321)M8.CB only 0.000 apart, marking (T0321)M8.CB as missing WARNING: atoms too close: (T0321)I9.CA and (T0321)I9.CB only 0.000 apart, marking (T0321)I9.CB as missing WARNING: atoms too close: (T0321)L17.CA and (T0321)L17.CB only 0.000 apart, marking (T0321)L17.CB as missing WARNING: atoms too close: (T0321)F44.CA and (T0321)F44.CB only 0.000 apart, marking (T0321)F44.CB as missing WARNING: atoms too close: (T0321)P49.CA and (T0321)P49.CB only 0.000 apart, marking (T0321)P49.CB as missing WARNING: atoms too close: (T0321)L56.CA and (T0321)L56.CB only 0.000 apart, marking (T0321)L56.CB as missing WARNING: atoms too close: (T0321)S69.CA and (T0321)S69.CB only 0.000 apart, marking (T0321)S69.CB as missing WARNING: atoms too close: (T0321)Y72.CA and (T0321)Y72.CB only 0.000 apart, marking (T0321)Y72.CB as missing WARNING: atoms too close: (T0321)I82.CA and (T0321)I82.CB only 0.000 apart, marking (T0321)I82.CB as missing WARNING: atoms too close: (T0321)A84.CA and (T0321)A84.CB only 0.000 apart, marking (T0321)A84.CB as missing WARNING: atoms too close: (T0321)Y85.CA and (T0321)Y85.CB only 0.000 apart, marking (T0321)Y85.CB as missing WARNING: atoms too close: (T0321)Q90.CA and (T0321)Q90.CB only 0.000 apart, marking (T0321)Q90.CB as missing WARNING: atoms too close: (T0321)S100.CA and (T0321)S100.CB only 0.000 apart, marking (T0321)S100.CB as missing WARNING: atoms too close: (T0321)V120.CA and (T0321)V120.CB only 0.000 apart, marking (T0321)V120.CB as missing WARNING: atoms too close: (T0321)V125.CA and (T0321)V125.CB only 0.000 apart, marking (T0321)V125.CB as missing WARNING: atoms too close: (T0321)V127.CA and (T0321)V127.CB only 0.000 apart, marking (T0321)V127.CB as missing WARNING: atoms too close: (T0321)E139.CA and (T0321)E139.CB only 0.000 apart, marking (T0321)E139.CB as missing WARNING: atoms too close: (T0321)L144.CA and (T0321)L144.CB only 0.000 apart, marking (T0321)L144.CB as missing WARNING: atoms too close: (T0321)P151.CA and (T0321)P151.CB only 0.000 apart, marking (T0321)P151.CB as missing WARNING: atoms too close: (T0321)E152.CA and (T0321)E152.CB only 0.000 apart, marking (T0321)E152.CB as missing WARNING: atoms too close: (T0321)E153.CA and (T0321)E153.CB only 0.000 apart, marking (T0321)E153.CB as missing WARNING: atoms too close: (T0321)I164.CA and (T0321)I164.CB only 0.000 apart, marking (T0321)I164.CB as missing WARNING: atoms too close: (T0321)L165.CA and (T0321)L165.CB only 0.000 apart, marking (T0321)L165.CB as missing WARNING: atoms too close: (T0321)T174.CA and (T0321)T174.CB only 0.000 apart, marking (T0321)T174.CB as missing WARNING: atoms too close: (T0321)R191.CA and (T0321)R191.CB only 0.000 apart, marking (T0321)R191.CB as missing WARNING: atoms too close: (T0321)N192.CA and (T0321)N192.CB only 0.000 apart, marking (T0321)N192.CB as missing WARNING: atoms too close: (T0321)T203.CA and (T0321)T203.CB only 0.000 apart, marking (T0321)T203.CB as missing WARNING: atoms too close: (T0321)H212.CA and (T0321)H212.CB only 0.000 apart, marking (T0321)H212.CB as missing WARNING: atoms too close: (T0321)E216.CA and (T0321)E216.CB only 0.000 apart, marking (T0321)E216.CB as missing WARNING: atoms too close: (T0321)L217.CA and (T0321)L217.CB only 0.000 apart, marking (T0321)L217.CB as missing WARNING: atoms too close: (T0321)A226.CA and (T0321)A226.CB only 0.000 apart, marking (T0321)A226.CB as missing WARNING: atoms too close: (T0321)F229.CA and (T0321)F229.CB only 0.000 apart, marking (T0321)F229.CB as missing WARNING: atoms too close: (T0321)A235.CA and (T0321)A235.CB only 0.000 apart, marking (T0321)A235.CB as missing WARNING: atoms too close: (T0321)K237.CA and (T0321)K237.CB only 0.000 apart, marking (T0321)K237.CB as missing WARNING: atoms too close: (T0321)K239.CA and (T0321)K239.CB only 0.000 apart, marking (T0321)K239.CB as missing WARNING: atoms too close: (T0321)S242.CA and (T0321)S242.CB only 0.000 apart, marking (T0321)S242.CB as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)M1.CA and (T0321)M1.CB only 0.000 apart, marking (T0321)M1.CB as missing WARNING: atoms too close: (T0321)W2.CA and (T0321)W2.CB only 0.000 apart, marking (T0321)W2.CB as missing WARNING: atoms too close: (T0321)F16.CA and (T0321)F16.CB only 0.000 apart, marking (T0321)F16.CB as missing WARNING: atoms too close: (T0321)C23.CA and (T0321)C23.CB only 0.000 apart, marking (T0321)C23.CB as missing WARNING: atoms too close: (T0321)L55.CA and (T0321)L55.CB only 0.000 apart, marking (T0321)L55.CB as missing WARNING: atoms too close: (T0321)L58.CA and (T0321)L58.CB only 0.000 apart, marking (T0321)L58.CB as missing WARNING: atoms too close: (T0321)C66.CA and (T0321)C66.CB only 0.000 apart, marking (T0321)C66.CB as missing WARNING: atoms too close: (T0321)I77.CA and (T0321)I77.CB only 0.000 apart, marking (T0321)I77.CB as missing WARNING: atoms too close: (T0321)I82.CA and (T0321)I82.CB only 0.000 apart, marking (T0321)I82.CB as missing WARNING: atoms too close: (T0321)Y86.CA and (T0321)Y86.CB only 0.000 apart, marking (T0321)Y86.CB as missing WARNING: atoms too close: (T0321)N87.CA and (T0321)N87.CB only 0.000 apart, marking (T0321)N87.CB as missing WARNING: atoms too close: (T0321)S100.CA and (T0321)S100.CB only 0.000 apart, marking (T0321)S100.CB as missing WARNING: atoms too close: (T0321)R104.CA and (T0321)R104.CB only 0.000 apart, marking (T0321)R104.CB as missing WARNING: atoms too close: (T0321)E119.CA and (T0321)E119.CB only 0.000 apart, marking (T0321)E119.CB as missing WARNING: atoms too close: (T0321)H133.CA and (T0321)H133.CB only 0.000 apart, marking (T0321)H133.CB as missing WARNING: atoms too close: (T0321)D155.CA and (T0321)D155.CB only 0.000 apart, marking (T0321)D155.CB as missing WARNING: atoms too close: (T0321)Y156.CA and (T0321)Y156.CB only 0.000 apart, marking (T0321)Y156.CB as missing WARNING: atoms too close: (T0321)I164.CA and (T0321)I164.CB only 0.000 apart, marking (T0321)I164.CB as missing WARNING: atoms too close: (T0321)Y172.CA and (T0321)Y172.CB only 0.000 apart, marking (T0321)Y172.CB as missing WARNING: atoms too close: (T0321)T197.CA and (T0321)T197.CB only 0.000 apart, marking (T0321)T197.CB as missing WARNING: atoms too close: (T0321)L209.CA and (T0321)L209.CB only 0.000 apart, marking (T0321)L209.CB as missing WARNING: atoms too close: (T0321)E216.CA and (T0321)E216.CB only 0.000 apart, marking (T0321)E216.CB as missing WARNING: atoms too close: (T0321)K223.CA and (T0321)K223.CB only 0.000 apart, marking (T0321)K223.CB as missing WARNING: atoms too close: (T0321)F229.CA and (T0321)F229.CB only 0.000 apart, marking (T0321)F229.CB as missing WARNING: atoms too close: (T0321)S242.CA and (T0321)S242.CB only 0.000 apart, marking (T0321)S242.CB as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)M1.CA and (T0321)M1.CB only 0.000 apart, marking (T0321)M1.CB as missing WARNING: atoms too close: (T0321)W2.CA and (T0321)W2.CB only 0.000 apart, marking (T0321)W2.CB as missing WARNING: atoms too close: (T0321)D6.CA and (T0321)D6.CB only 0.000 apart, marking (T0321)D6.CB as missing WARNING: atoms too close: (T0321)I9.CA and (T0321)I9.CB only 0.000 apart, marking (T0321)I9.CB as missing WARNING: atoms too close: (T0321)E14.CA and (T0321)E14.CB only 0.000 apart, marking (T0321)E14.CB as missing WARNING: atoms too close: (T0321)C23.CA and (T0321)C23.CB only 0.000 apart, marking (T0321)C23.CB as missing WARNING: atoms too close: (T0321)T26.CA and (T0321)T26.CB only 0.000 apart, marking (T0321)T26.CB as missing WARNING: atoms too close: (T0321)S32.CA and (T0321)S32.CB only 0.000 apart, marking (T0321)S32.CB as missing WARNING: atoms too close: (T0321)N34.CA and (T0321)N34.CB only 0.000 apart, marking (T0321)N34.CB as missing WARNING: atoms too close: (T0321)N41.CA and (T0321)N41.CB only 0.000 apart, marking (T0321)N41.CB as missing WARNING: atoms too close: (T0321)R42.CA and (T0321)R42.CB only 0.000 apart, marking (T0321)R42.CB as missing WARNING: atoms too close: (T0321)L51.CA and (T0321)L51.CB only 0.000 apart, marking (T0321)L51.CB as missing WARNING: atoms too close: (T0321)L56.CA and (T0321)L56.CB only 0.000 apart, marking (T0321)L56.CB as missing WARNING: atoms too close: (T0321)R61.CA and (T0321)R61.CB only 0.000 apart, marking (T0321)R61.CB as missing WARNING: atoms too close: (T0321)C66.CA and (T0321)C66.CB only 0.000 apart, marking (T0321)C66.CB as missing WARNING: atoms too close: (T0321)K68.CA and (T0321)K68.CB only 0.000 apart, marking (T0321)K68.CB as missing WARNING: atoms too close: (T0321)A84.CA and (T0321)A84.CB only 0.000 apart, marking (T0321)A84.CB as missing WARNING: atoms too close: (T0321)Y85.CA and (T0321)Y85.CB only 0.000 apart, marking (T0321)Y85.CB as missing WARNING: atoms too close: (T0321)Y86.CA and (T0321)Y86.CB only 0.000 apart, marking (T0321)Y86.CB as missing WARNING: atoms too close: (T0321)V91.CA and (T0321)V91.CB only 0.000 apart, marking (T0321)V91.CB as missing WARNING: atoms too close: (T0321)R93.CA and (T0321)R93.CB only 0.000 apart, marking (T0321)R93.CB as missing WARNING: atoms too close: (T0321)S100.CA and (T0321)S100.CB only 0.000 apart, marking (T0321)S100.CB as missing WARNING: atoms too close: (T0321)R104.CA and (T0321)R104.CB only 0.000 apart, marking (T0321)R104.CB as missing WARNING: atoms too close: (T0321)E119.CA and (T0321)E119.CB only 0.000 apart, marking (T0321)E119.CB as missing WARNING: atoms too close: (T0321)V127.CA and (T0321)V127.CB only 0.000 apart, marking (T0321)V127.CB as missing WARNING: atoms too close: (T0321)S136.CA and (T0321)S136.CB only 0.000 apart, marking (T0321)S136.CB as missing WARNING: atoms too close: (T0321)L138.CA and (T0321)L138.CB only 0.000 apart, marking (T0321)L138.CB as missing WARNING: atoms too close: (T0321)S145.CA and (T0321)S145.CB only 0.000 apart, marking (T0321)S145.CB as missing WARNING: atoms too close: (T0321)I146.CA and (T0321)I146.CB only 0.000 apart, marking (T0321)I146.CB as missing WARNING: atoms too close: (T0321)E148.CA and (T0321)E148.CB only 0.000 apart, marking (T0321)E148.CB as missing WARNING: atoms too close: (T0321)W149.CA and (T0321)W149.CB only 0.000 apart, marking (T0321)W149.CB as missing WARNING: atoms too close: (T0321)P151.CA and (T0321)P151.CB only 0.000 apart, marking (T0321)P151.CB as missing WARNING: atoms too close: (T0321)E152.CA and (T0321)E152.CB only 0.000 apart, marking (T0321)E152.CB as missing WARNING: atoms too close: (T0321)Y156.CA and (T0321)Y156.CB only 0.000 apart, marking (T0321)Y156.CB as missing WARNING: atoms too close: (T0321)L158.CA and (T0321)L158.CB only 0.000 apart, marking (T0321)L158.CB as missing WARNING: atoms too close: (T0321)L165.CA and (T0321)L165.CB only 0.000 apart, marking (T0321)L165.CB as missing WARNING: atoms too close: (T0321)Y170.CA and (T0321)Y170.CB only 0.000 apart, marking (T0321)Y170.CB as missing WARNING: atoms too close: (T0321)A176.CA and (T0321)A176.CB only 0.000 apart, marking (T0321)A176.CB as missing WARNING: atoms too close: (T0321)K181.CA and (T0321)K181.CB only 0.000 apart, marking (T0321)K181.CB as missing WARNING: atoms too close: (T0321)L186.CA and (T0321)L186.CB only 0.000 apart, marking (T0321)L186.CB as missing WARNING: atoms too close: (T0321)S190.CA and (T0321)S190.CB only 0.000 apart, marking (T0321)S190.CB as missing WARNING: atoms too close: (T0321)A193.CA and (T0321)A193.CB only 0.000 apart, marking (T0321)A193.CB as missing WARNING: atoms too close: (T0321)T197.CA and (T0321)T197.CB only 0.000 apart, marking (T0321)T197.CB as missing WARNING: atoms too close: (T0321)T203.CA and (T0321)T203.CB only 0.000 apart, marking (T0321)T203.CB as missing WARNING: atoms too close: (T0321)L205.CA and (T0321)L205.CB only 0.000 apart, marking (T0321)L205.CB as missing WARNING: atoms too close: (T0321)A206.CA and (T0321)A206.CB only 0.000 apart, marking (T0321)A206.CB as missing WARNING: atoms too close: (T0321)P207.CA and (T0321)P207.CB only 0.000 apart, marking (T0321)P207.CB as missing WARNING: atoms too close: (T0321)L209.CA and (T0321)L209.CB only 0.000 apart, marking (T0321)L209.CB as missing WARNING: atoms too close: (T0321)H212.CA and (T0321)H212.CB only 0.000 apart, marking (T0321)H212.CB as missing WARNING: atoms too close: (T0321)E216.CA and (T0321)E216.CB only 0.000 apart, marking (T0321)E216.CB as missing WARNING: atoms too close: (T0321)F220.CA and (T0321)F220.CB only 0.000 apart, marking (T0321)F220.CB as missing WARNING: atoms too close: (T0321)K239.CA and (T0321)K239.CB only 0.000 apart, marking (T0321)K239.CB as missing WARNING: atoms too close: (T0321)S242.CA and (T0321)S242.CB only 0.000 apart, marking (T0321)S242.CB as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 247 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 236 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 156 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 203 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 167 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 216 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 203 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 171 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 231 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 77 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 156 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 164 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 239 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 247 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 247 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 244 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 241 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 79 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 151 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)P13.O and (T0321)E14.N only 0.000 apart, marking (T0321)E14.N as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0321)L56.O and (T0321)G57.N only 0.000 apart, marking (T0321)G57.N as missing # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 WARNING: atom 519 has residue number 1 < previous residue 251 in servers/mGen-3D_TS1.pdb.gz # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 251 in servers/nFOLD_TS4.pdb.gz # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/panther2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation panther2_TS1 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0321 can't currently be optimized by undertaker # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score 0.4000 model score 0.3854 model score 1.4821 model score 1.5252 model score 1.5676 model score 1.8544 model score 1.8739 model score 1.7322 model score 1.6754 model score 1.4830 model score 1.4620 model score 1.6773 model score 1.8899 model score 0.8325 model score 1.5795 model score 1.8176 model score 1.4686 model score 1.0464 model score 1.8881 model score 1.6461 model score 1.4292 model score 1.3798 model score 1.2254 model score 1.2501 model score 1.5393 model score 1.2851 model score 1.0600 model score 0.8315 model score 0.7804 model score 1.5161 model score 0.7827 model score 0.7797 model score 0.7834 model score 1.3130 model score 0.4181 model score 1.0979 model score 1.4929 model score 1.0093 model score 1.8201 model score 0.7884 model score 1.5835 model score 1.5337 model score 1.7893 model score 1.2776 model score 1.2709 model score 1.2735 model score 1.2704 model score 1.2712 model score 1.5098 model score 1.0109 model score 1.9624 model score 0.7690 model score 2.0165 model score 1.0979 model score 1.0093 model score 1.0093 model score 1.0109 model score 0.7690 model score 2.0622 model score 1.3846 model score 1.6191 model score 2.4019 model score 1.7191 model score 1.2710 model score 1.2717 model score 1.2771 model score 1.2834 model score 1.2723 model score 1.2710 model score 1.2717 model score 1.2771 model score 1.2723 model score 1.2823 model score 1.9891 model score 2.0912 model score 2.0339 model score 2.1528 model score 2.4998 model score 1.7057 model score 1.7347 model score 1.7681 model score 0.9601 model score 1.1485 model score 1.2825 model score 1.2815 model score 1.2804 model score 1.2764 model score 1.2749 model score 2.3405 model score 2.1835 model score 1.9802 model score 2.3959 model score 1.8871 model score 0.1696 model score 0.2065 model score 0.1614 model score 0.4311 model score 0.5051 model score 0.4567 model score 0.4567 model score 1.0185 model score 1.2815 model score 1.6239 model score 1.6875 model score 1.5950 model score 1.5517 model score 0.1936 model score 0.2927 model score 0.3600 model score 0.3485 model score 1.2606 model score 0.5316 model score 1.1953 model score 0.7365 model score 1.4255 model score 0.7716 model score 0.6969 model score 0.7365 model score 0.5518 model score 0.3998 model score 1.4255 model score 0.2624 model score 0.2239 model score 0.2634 model score 0.2551 model score 0.9761 model score 0.1936 model score 1.7751 model score 1.3031 model score 1.3020 model score 1.8161 model score 1.0716 model score 1.7022 model score 1.6698 model score 1.7160 model score 1.7511 model score 1.6199 model score 0.3776 model score 0.3625 model score 0.4078 model score 0.3755 model score 1.7058 model score 0.5729 model score 0.5491 model score 0.6044 model score 0.7305 model score 0.5743 model score 0.9681 model score 1.4246 model score 1.4381 model score 1.4221 model score 1.4169 model score 1.4423 model score 0.5743 model score 0.5341 model score 0.5459 model score 0.6464 model score 0.5385 model score 0.2520 model score 0.3537 model score 0.3737 model score 0.3101 model score 0.3621 model score 0.2713 model score 0.4564 model score 0.4460 model score 0.7596 model score 1.1094 model score 0.2465 model score 0.4411 model score 0.4099 model score 0.7343 model score 1.0882 model score 0.4043 model score 0.2917 model score 0.3817 model score 0.3031 model score 0.3687 model score 1.6230 model score 1.5660 model score 1.6853 model score 1.9161 model score 1.7225 model score 1.2821 model score 1.2782 model score 1.2771 model score 1.2777 model score 1.2771 model score 0.3827 model score 0.3541 model score 0.1964 model score 0.3657 model score 0.9969 model score 1.1422 model score 1.0871 model score 0.4049 model score 0.8104 model score 0.6864 model score 1.1627 model score 1.2867 model score 1.2647 model score 1.3973 model score 1.3223 model score 1.1546 model score 0.1870 model score 0.4049 model score 0.6818 model score 0.3138 model score 1.2792 model score 1.2827 model score 1.2822 model score 1.2824 model score 1.2800 model score 1.4141 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 0.9611 model score 0.1885 model score 0.9395 model score 0.4326 model score 1.0789 model score 0.4466 model score 0.6920 model score 1.2771 model score 1.2791 model score 1.2771 model score 1.2771 model score 1.2771 model score 0.8685 model score 1.3854 model score 0.9716 model score 1.0920 model score 1.8704 model score 2.1288 model score 2.0709 model score 2.0533 model score 2.3119 model score 2.2947 model score 1.2341 model score 0.2445 model score 0.1843 model score 0.1489 model score 0.7993 model score 0.4010 model score 0.3591 model score 0.1770 model score 0.4179 model score 0.7429 model score 1.2960 model score 0.6172 model score 1.4023 model score 0.7469 model score 0.1853 model score 0.7029 model score 1.4171 model score 0.5968 USE_META, weight: 0.9039 cost: 0.4000 min: 0.1489 max: 2.4998 USE_META, weight: 0.9094 cost: 0.3854 min: 0.1489 max: 2.4998 USE_META, weight: 0.4896 cost: 1.4821 min: 0.1489 max: 2.4998 USE_META, weight: 0.4731 cost: 1.5252 min: 0.1489 max: 2.4998 USE_META, weight: 0.4569 cost: 1.5676 min: 0.1489 max: 2.4998 USE_META, weight: 0.3471 cost: 1.8544 min: 0.1489 max: 2.4998 USE_META, weight: 0.3396 cost: 1.8739 min: 0.1489 max: 2.4998 USE_META, weight: 0.3939 cost: 1.7322 min: 0.1489 max: 2.4998 USE_META, weight: 0.4156 cost: 1.6754 min: 0.1489 max: 2.4998 USE_META, weight: 0.4893 cost: 1.4830 min: 0.1489 max: 2.4998 USE_META, weight: 0.4973 cost: 1.4620 min: 0.1489 max: 2.4998 USE_META, weight: 0.4149 cost: 1.6773 min: 0.1489 max: 2.4998 USE_META, weight: 0.3335 cost: 1.8899 min: 0.1489 max: 2.4998 USE_META, weight: 0.7383 cost: 0.8325 min: 0.1489 max: 2.4998 USE_META, weight: 0.4523 cost: 1.5795 min: 0.1489 max: 2.4998 USE_META, weight: 0.3612 cost: 1.8176 min: 0.1489 max: 2.4998 USE_META, weight: 0.4948 cost: 1.4686 min: 0.1489 max: 2.4998 USE_META, weight: 0.6564 cost: 1.0464 min: 0.1489 max: 2.4998 USE_META, weight: 0.3342 cost: 1.8881 min: 0.1489 max: 2.4998 USE_META, weight: 0.4268 cost: 1.6461 min: 0.1489 max: 2.4998 USE_META, weight: 0.5099 cost: 1.4292 min: 0.1489 max: 2.4998 USE_META, weight: 0.5288 cost: 1.3798 min: 0.1489 max: 2.4998 USE_META, weight: 0.5879 cost: 1.2254 min: 0.1489 max: 2.4998 USE_META, weight: 0.5784 cost: 1.2501 min: 0.1489 max: 2.4998 USE_META, weight: 0.4677 cost: 1.5393 min: 0.1489 max: 2.4998 USE_META, weight: 0.5650 cost: 1.2851 min: 0.1489 max: 2.4998 USE_META, weight: 0.6512 cost: 1.0600 min: 0.1489 max: 2.4998 USE_META, weight: 0.7387 cost: 0.8315 min: 0.1489 max: 2.4998 USE_META, weight: 0.7582 cost: 0.7804 min: 0.1489 max: 2.4998 USE_META, weight: 0.4766 cost: 1.5161 min: 0.1489 max: 2.4998 USE_META, weight: 0.7574 cost: 0.7827 min: 0.1489 max: 2.4998 USE_META, weight: 0.7585 cost: 0.7797 min: 0.1489 max: 2.4998 USE_META, weight: 0.7571 cost: 0.7834 min: 0.1489 max: 2.4998 USE_META, weight: 0.5543 cost: 1.3130 min: 0.1489 max: 2.4998 USE_META, weight: 0.8969 cost: 0.4181 min: 0.1489 max: 2.4998 USE_META, weight: 0.6367 cost: 1.0979 min: 0.1489 max: 2.4998 USE_META, weight: 0.4855 cost: 1.4929 min: 0.1489 max: 2.4998 USE_META, weight: 0.6706 cost: 1.0093 min: 0.1489 max: 2.4998 USE_META, weight: 0.3602 cost: 1.8201 min: 0.1489 max: 2.4998 USE_META, weight: 0.7552 cost: 0.7884 min: 0.1489 max: 2.4998 USE_META, weight: 0.4508 cost: 1.5835 min: 0.1489 max: 2.4998 USE_META, weight: 0.4698 cost: 1.5337 min: 0.1489 max: 2.4998 USE_META, weight: 0.3720 cost: 1.7893 min: 0.1489 max: 2.4998 USE_META, weight: 0.5679 cost: 1.2776 min: 0.1489 max: 2.4998 USE_META, weight: 0.5705 cost: 1.2709 min: 0.1489 max: 2.4998 USE_META, weight: 0.5695 cost: 1.2735 min: 0.1489 max: 2.4998 USE_META, weight: 0.5707 cost: 1.2704 min: 0.1489 max: 2.4998 USE_META, weight: 0.5703 cost: 1.2712 min: 0.1489 max: 2.4998 USE_META, weight: 0.4790 cost: 1.5098 min: 0.1489 max: 2.4998 USE_META, weight: 0.6700 cost: 1.0109 min: 0.1489 max: 2.4998 USE_META, weight: 0.3057 cost: 1.9624 min: 0.1489 max: 2.4998 USE_META, weight: 0.7626 cost: 0.7690 min: 0.1489 max: 2.4998 USE_META, weight: 0.2850 cost: 2.0165 min: 0.1489 max: 2.4998 USE_META, weight: 0.6367 cost: 1.0979 min: 0.1489 max: 2.4998 USE_META, weight: 0.6706 cost: 1.0093 min: 0.1489 max: 2.4998 USE_META, weight: 0.6706 cost: 1.0093 min: 0.1489 max: 2.4998 USE_META, weight: 0.6700 cost: 1.0109 min: 0.1489 max: 2.4998 USE_META, weight: 0.7626 cost: 0.7690 min: 0.1489 max: 2.4998 USE_META, weight: 0.2675 cost: 2.0622 min: 0.1489 max: 2.4998 USE_META, weight: 0.5269 cost: 1.3846 min: 0.1489 max: 2.4998 USE_META, weight: 0.4371 cost: 1.6191 min: 0.1489 max: 2.4998 USE_META, weight: 0.1375 cost: 2.4019 min: 0.1489 max: 2.4998 USE_META, weight: 0.3989 cost: 1.7191 min: 0.1489 max: 2.4998 USE_META, weight: 0.5704 cost: 1.2710 min: 0.1489 max: 2.4998 USE_META, weight: 0.5702 cost: 1.2717 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5657 cost: 1.2834 min: 0.1489 max: 2.4998 USE_META, weight: 0.5699 cost: 1.2723 min: 0.1489 max: 2.4998 USE_META, weight: 0.5704 cost: 1.2710 min: 0.1489 max: 2.4998 USE_META, weight: 0.5702 cost: 1.2717 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5699 cost: 1.2723 min: 0.1489 max: 2.4998 USE_META, weight: 0.5661 cost: 1.2823 min: 0.1489 max: 2.4998 USE_META, weight: 0.2955 cost: 1.9891 min: 0.1489 max: 2.4998 USE_META, weight: 0.2564 cost: 2.0912 min: 0.1489 max: 2.4998 USE_META, weight: 0.2784 cost: 2.0339 min: 0.1489 max: 2.4998 USE_META, weight: 0.2328 cost: 2.1528 min: 0.1489 max: 2.4998 USE_META, weight: 0.1000 cost: 2.4998 min: 0.1489 max: 2.4998 USE_META, weight: 0.4040 cost: 1.7057 min: 0.1489 max: 2.4998 USE_META, weight: 0.3929 cost: 1.7347 min: 0.1489 max: 2.4998 USE_META, weight: 0.3801 cost: 1.7681 min: 0.1489 max: 2.4998 USE_META, weight: 0.6894 cost: 0.9601 min: 0.1489 max: 2.4998 USE_META, weight: 0.6173 cost: 1.1485 min: 0.1489 max: 2.4998 USE_META, weight: 0.5660 cost: 1.2825 min: 0.1489 max: 2.4998 USE_META, weight: 0.5664 cost: 1.2815 min: 0.1489 max: 2.4998 USE_META, weight: 0.5668 cost: 1.2804 min: 0.1489 max: 2.4998 USE_META, weight: 0.5683 cost: 1.2764 min: 0.1489 max: 2.4998 USE_META, weight: 0.5689 cost: 1.2749 min: 0.1489 max: 2.4998 USE_META, weight: 0.1610 cost: 2.3405 min: 0.1489 max: 2.4998 USE_META, weight: 0.2211 cost: 2.1835 min: 0.1489 max: 2.4998 USE_META, weight: 0.2989 cost: 1.9802 min: 0.1489 max: 2.4998 USE_META, weight: 0.1398 cost: 2.3959 min: 0.1489 max: 2.4998 USE_META, weight: 0.3346 cost: 1.8871 min: 0.1489 max: 2.4998 USE_META, weight: 0.9921 cost: 0.1696 min: 0.1489 max: 2.4998 USE_META, weight: 0.9780 cost: 0.2065 min: 0.1489 max: 2.4998 USE_META, weight: 0.9952 cost: 0.1614 min: 0.1489 max: 2.4998 USE_META, weight: 0.8920 cost: 0.4311 min: 0.1489 max: 2.4998 USE_META, weight: 0.8636 cost: 0.5051 min: 0.1489 max: 2.4998 USE_META, weight: 0.8821 cost: 0.4567 min: 0.1489 max: 2.4998 USE_META, weight: 0.8821 cost: 0.4567 min: 0.1489 max: 2.4998 USE_META, weight: 0.6671 cost: 1.0185 min: 0.1489 max: 2.4998 USE_META, weight: 0.5664 cost: 1.2815 min: 0.1489 max: 2.4998 USE_META, weight: 0.4353 cost: 1.6239 min: 0.1489 max: 2.4998 USE_META, weight: 0.4110 cost: 1.6875 min: 0.1489 max: 2.4998 USE_META, weight: 0.4464 cost: 1.5950 min: 0.1489 max: 2.4998 USE_META, weight: 0.4630 cost: 1.5517 min: 0.1489 max: 2.4998 USE_META, weight: 0.9829 cost: 0.1936 min: 0.1489 max: 2.4998 USE_META, weight: 0.9450 cost: 0.2927 min: 0.1489 max: 2.4998 USE_META, weight: 0.9192 cost: 0.3600 min: 0.1489 max: 2.4998 USE_META, weight: 0.9236 cost: 0.3485 min: 0.1489 max: 2.4998 USE_META, weight: 0.5744 cost: 1.2606 min: 0.1489 max: 2.4998 USE_META, weight: 0.8535 cost: 0.5316 min: 0.1489 max: 2.4998 USE_META, weight: 0.5994 cost: 1.1953 min: 0.1489 max: 2.4998 USE_META, weight: 0.7751 cost: 0.7365 min: 0.1489 max: 2.4998 USE_META, weight: 0.5113 cost: 1.4255 min: 0.1489 max: 2.4998 USE_META, weight: 0.7616 cost: 0.7716 min: 0.1489 max: 2.4998 USE_META, weight: 0.7902 cost: 0.6969 min: 0.1489 max: 2.4998 USE_META, weight: 0.7751 cost: 0.7365 min: 0.1489 max: 2.4998 USE_META, weight: 0.8458 cost: 0.5518 min: 0.1489 max: 2.4998 USE_META, weight: 0.9039 cost: 0.3998 min: 0.1489 max: 2.4998 USE_META, weight: 0.5113 cost: 1.4255 min: 0.1489 max: 2.4998 USE_META, weight: 0.9566 cost: 0.2624 min: 0.1489 max: 2.4998 USE_META, weight: 0.9713 cost: 0.2239 min: 0.1489 max: 2.4998 USE_META, weight: 0.9562 cost: 0.2634 min: 0.1489 max: 2.4998 USE_META, weight: 0.9593 cost: 0.2551 min: 0.1489 max: 2.4998 USE_META, weight: 0.6833 cost: 0.9761 min: 0.1489 max: 2.4998 USE_META, weight: 0.9829 cost: 0.1936 min: 0.1489 max: 2.4998 USE_META, weight: 0.3774 cost: 1.7751 min: 0.1489 max: 2.4998 USE_META, weight: 0.5581 cost: 1.3031 min: 0.1489 max: 2.4998 USE_META, weight: 0.5586 cost: 1.3020 min: 0.1489 max: 2.4998 USE_META, weight: 0.3618 cost: 1.8161 min: 0.1489 max: 2.4998 USE_META, weight: 0.6468 cost: 1.0716 min: 0.1489 max: 2.4998 USE_META, weight: 0.4053 cost: 1.7022 min: 0.1489 max: 2.4998 USE_META, weight: 0.4178 cost: 1.6698 min: 0.1489 max: 2.4998 USE_META, weight: 0.4001 cost: 1.7160 min: 0.1489 max: 2.4998 USE_META, weight: 0.3866 cost: 1.7511 min: 0.1489 max: 2.4998 USE_META, weight: 0.4369 cost: 1.6199 min: 0.1489 max: 2.4998 USE_META, weight: 0.9124 cost: 0.3776 min: 0.1489 max: 2.4998 USE_META, weight: 0.9182 cost: 0.3625 min: 0.1489 max: 2.4998 USE_META, weight: 0.9009 cost: 0.4078 min: 0.1489 max: 2.4998 USE_META, weight: 0.9132 cost: 0.3755 min: 0.1489 max: 2.4998 USE_META, weight: 0.4040 cost: 1.7058 min: 0.1489 max: 2.4998 USE_META, weight: 0.8377 cost: 0.5729 min: 0.1489 max: 2.4998 USE_META, weight: 0.8468 cost: 0.5491 min: 0.1489 max: 2.4998 USE_META, weight: 0.8256 cost: 0.6044 min: 0.1489 max: 2.4998 USE_META, weight: 0.7774 cost: 0.7305 min: 0.1489 max: 2.4998 USE_META, weight: 0.8371 cost: 0.5743 min: 0.1489 max: 2.4998 USE_META, weight: 0.6864 cost: 0.9681 min: 0.1489 max: 2.4998 USE_META, weight: 0.5116 cost: 1.4246 min: 0.1489 max: 2.4998 USE_META, weight: 0.5065 cost: 1.4381 min: 0.1489 max: 2.4998 USE_META, weight: 0.5126 cost: 1.4221 min: 0.1489 max: 2.4998 USE_META, weight: 0.5146 cost: 1.4169 min: 0.1489 max: 2.4998 USE_META, weight: 0.5048 cost: 1.4423 min: 0.1489 max: 2.4998 USE_META, weight: 0.8371 cost: 0.5743 min: 0.1489 max: 2.4998 USE_META, weight: 0.8525 cost: 0.5341 min: 0.1489 max: 2.4998 USE_META, weight: 0.8480 cost: 0.5459 min: 0.1489 max: 2.4998 USE_META, weight: 0.8096 cost: 0.6464 min: 0.1489 max: 2.4998 USE_META, weight: 0.8509 cost: 0.5385 min: 0.1489 max: 2.4998 USE_META, weight: 0.9605 cost: 0.2520 min: 0.1489 max: 2.4998 USE_META, weight: 0.9216 cost: 0.3537 min: 0.1489 max: 2.4998 USE_META, weight: 0.9139 cost: 0.3737 min: 0.1489 max: 2.4998 USE_META, weight: 0.9383 cost: 0.3101 min: 0.1489 max: 2.4998 USE_META, weight: 0.9184 cost: 0.3621 min: 0.1489 max: 2.4998 USE_META, weight: 0.9531 cost: 0.2713 min: 0.1489 max: 2.4998 USE_META, weight: 0.8823 cost: 0.4564 min: 0.1489 max: 2.4998 USE_META, weight: 0.8862 cost: 0.4460 min: 0.1489 max: 2.4998 USE_META, weight: 0.7662 cost: 0.7596 min: 0.1489 max: 2.4998 USE_META, weight: 0.6323 cost: 1.1094 min: 0.1489 max: 2.4998 USE_META, weight: 0.9626 cost: 0.2465 min: 0.1489 max: 2.4998 USE_META, weight: 0.8881 cost: 0.4411 min: 0.1489 max: 2.4998 USE_META, weight: 0.9001 cost: 0.4099 min: 0.1489 max: 2.4998 USE_META, weight: 0.7759 cost: 0.7343 min: 0.1489 max: 2.4998 USE_META, weight: 0.6404 cost: 1.0882 min: 0.1489 max: 2.4998 USE_META, weight: 0.9022 cost: 0.4043 min: 0.1489 max: 2.4998 USE_META, weight: 0.9453 cost: 0.2917 min: 0.1489 max: 2.4998 USE_META, weight: 0.9109 cost: 0.3817 min: 0.1489 max: 2.4998 USE_META, weight: 0.9410 cost: 0.3031 min: 0.1489 max: 2.4998 USE_META, weight: 0.9159 cost: 0.3687 min: 0.1489 max: 2.4998 USE_META, weight: 0.4357 cost: 1.6230 min: 0.1489 max: 2.4998 USE_META, weight: 0.4575 cost: 1.5660 min: 0.1489 max: 2.4998 USE_META, weight: 0.4118 cost: 1.6853 min: 0.1489 max: 2.4998 USE_META, weight: 0.3235 cost: 1.9161 min: 0.1489 max: 2.4998 USE_META, weight: 0.3976 cost: 1.7225 min: 0.1489 max: 2.4998 USE_META, weight: 0.5662 cost: 1.2821 min: 0.1489 max: 2.4998 USE_META, weight: 0.5677 cost: 1.2782 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5679 cost: 1.2777 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.9105 cost: 0.3827 min: 0.1489 max: 2.4998 USE_META, weight: 0.9214 cost: 0.3541 min: 0.1489 max: 2.4998 USE_META, weight: 0.9818 cost: 0.1964 min: 0.1489 max: 2.4998 USE_META, weight: 0.9170 cost: 0.3657 min: 0.1489 max: 2.4998 USE_META, weight: 0.6754 cost: 0.9969 min: 0.1489 max: 2.4998 USE_META, weight: 0.6197 cost: 1.1422 min: 0.1489 max: 2.4998 USE_META, weight: 0.6408 cost: 1.0871 min: 0.1489 max: 2.4998 USE_META, weight: 0.9020 cost: 0.4049 min: 0.1489 max: 2.4998 USE_META, weight: 0.7467 cost: 0.8104 min: 0.1489 max: 2.4998 USE_META, weight: 0.7942 cost: 0.6864 min: 0.1489 max: 2.4998 USE_META, weight: 0.6119 cost: 1.1627 min: 0.1489 max: 2.4998 USE_META, weight: 0.5644 cost: 1.2867 min: 0.1489 max: 2.4998 USE_META, weight: 0.5728 cost: 1.2647 min: 0.1489 max: 2.4998 USE_META, weight: 0.5221 cost: 1.3973 min: 0.1489 max: 2.4998 USE_META, weight: 0.5508 cost: 1.3223 min: 0.1489 max: 2.4998 USE_META, weight: 0.6150 cost: 1.1546 min: 0.1489 max: 2.4998 USE_META, weight: 0.9854 cost: 0.1870 min: 0.1489 max: 2.4998 USE_META, weight: 0.9020 cost: 0.4049 min: 0.1489 max: 2.4998 USE_META, weight: 0.7960 cost: 0.6818 min: 0.1489 max: 2.4998 USE_META, weight: 0.9369 cost: 0.3138 min: 0.1489 max: 2.4998 USE_META, weight: 0.5673 cost: 1.2792 min: 0.1489 max: 2.4998 USE_META, weight: 0.5659 cost: 1.2827 min: 0.1489 max: 2.4998 USE_META, weight: 0.5661 cost: 1.2822 min: 0.1489 max: 2.4998 USE_META, weight: 0.5661 cost: 1.2824 min: 0.1489 max: 2.4998 USE_META, weight: 0.5670 cost: 1.2800 min: 0.1489 max: 2.4998 USE_META, weight: 0.5156 cost: 1.4141 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.6891 cost: 0.9611 min: 0.1489 max: 2.4998 USE_META, weight: 0.9848 cost: 0.1885 min: 0.1489 max: 2.4998 USE_META, weight: 0.6973 cost: 0.9395 min: 0.1489 max: 2.4998 USE_META, weight: 0.8914 cost: 0.4326 min: 0.1489 max: 2.4998 USE_META, weight: 0.6440 cost: 1.0789 min: 0.1489 max: 2.4998 USE_META, weight: 0.8860 cost: 0.4466 min: 0.1489 max: 2.4998 USE_META, weight: 0.7921 cost: 0.6920 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5673 cost: 1.2791 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.5681 cost: 1.2771 min: 0.1489 max: 2.4998 USE_META, weight: 0.7245 cost: 0.8685 min: 0.1489 max: 2.4998 USE_META, weight: 0.5266 cost: 1.3854 min: 0.1489 max: 2.4998 USE_META, weight: 0.6851 cost: 0.9716 min: 0.1489 max: 2.4998 USE_META, weight: 0.6390 cost: 1.0920 min: 0.1489 max: 2.4998 USE_META, weight: 0.3409 cost: 1.8704 min: 0.1489 max: 2.4998 USE_META, weight: 0.2420 cost: 2.1288 min: 0.1489 max: 2.4998 USE_META, weight: 0.2642 cost: 2.0709 min: 0.1489 max: 2.4998 USE_META, weight: 0.2709 cost: 2.0533 min: 0.1489 max: 2.4998 USE_META, weight: 0.1719 cost: 2.3119 min: 0.1489 max: 2.4998 USE_META, weight: 0.1785 cost: 2.2947 min: 0.1489 max: 2.4998 USE_META, weight: 0.5846 cost: 1.2341 min: 0.1489 max: 2.4998 USE_META, weight: 0.9634 cost: 0.2445 min: 0.1489 max: 2.4998 USE_META, weight: 0.9865 cost: 0.1843 min: 0.1489 max: 2.4998 USE_META, weight: 1.0000 cost: 0.1489 min: 0.1489 max: 2.4998 USE_META, weight: 0.7510 cost: 0.7993 min: 0.1489 max: 2.4998 USE_META, weight: 0.9035 cost: 0.4010 min: 0.1489 max: 2.4998 USE_META, weight: 0.9195 cost: 0.3591 min: 0.1489 max: 2.4998 USE_META, weight: 0.9892 cost: 0.1770 min: 0.1489 max: 2.4998 USE_META, weight: 0.8970 cost: 0.4179 min: 0.1489 max: 2.4998 USE_META, weight: 0.7726 cost: 0.7429 min: 0.1489 max: 2.4998 USE_META, weight: 0.5609 cost: 1.2960 min: 0.1489 max: 2.4998 USE_META, weight: 0.8207 cost: 0.6172 min: 0.1489 max: 2.4998 USE_META, weight: 0.5202 cost: 1.4023 min: 0.1489 max: 2.4998 USE_META, weight: 0.7711 cost: 0.7469 min: 0.1489 max: 2.4998 USE_META, weight: 0.9861 cost: 0.1853 min: 0.1489 max: 2.4998 USE_META, weight: 0.7879 cost: 0.7029 min: 0.1489 max: 2.4998 USE_META, weight: 0.5145 cost: 1.4171 min: 0.1489 max: 2.4998 USE_META, weight: 0.8285 cost: 0.5968 min: 0.1489 max: 2.4998 USE_EVALUE, weight: 0.9711 eval: 0.1705 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9711 eval: 0.1705 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9711 eval: 0.1705 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7520 eval: 1.0558 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7520 eval: 1.0558 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7520 eval: 1.0558 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9290 eval: 0.3404 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9290 eval: 0.3404 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9290 eval: 0.3404 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8050 eval: 0.8413 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8050 eval: 0.8413 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8050 eval: 0.8413 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8178 eval: 0.7899 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8178 eval: 0.7899 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8178 eval: 0.7899 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7003 eval: 1.2645 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7003 eval: 1.2645 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7003 eval: 1.2645 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7399 eval: 1.1047 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7399 eval: 1.1047 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7399 eval: 1.1047 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8508 eval: 0.6563 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8508 eval: 0.6563 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8508 eval: 0.6563 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9667 eval: 0.1881 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9667 eval: 0.1881 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9667 eval: 0.1881 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8793 eval: 0.5414 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8793 eval: 0.5414 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8793 eval: 0.5414 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8451 eval: 0.6793 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8451 eval: 0.6793 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8451 eval: 0.6793 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8366 eval: 0.7138 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8366 eval: 0.7138 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8366 eval: 0.7138 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9717 eval: 0.1679 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9717 eval: 0.1679 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9717 eval: 0.1679 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8701 eval: 0.5784 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8701 eval: 0.5784 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8701 eval: 0.5784 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9798 eval: 0.1352 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9798 eval: 0.1352 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9798 eval: 0.1352 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8289 eval: 0.7448 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8289 eval: 0.7448 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8289 eval: 0.7448 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7105 eval: 1.2231 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7105 eval: 1.2231 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.7105 eval: 1.2231 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8726 eval: 0.5685 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8726 eval: 0.5685 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.8726 eval: 0.5685 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 1.0000 eval: 0.0536 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 1.0000 eval: 0.0536 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 1.0000 eval: 0.0536 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.1000 eval: 3.6900 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.1000 eval: 3.6900 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.1000 eval: 3.6900 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9530 eval: 0.2436 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9530 eval: 0.2436 min: 0.0536 max: 3.6900 USE_EVALUE, weight: 0.9530 eval: 0.2436 min: 0.0536 max: 3.6900 Number of contacts in models: 259 Number of contacts in alignments: 63 NUMB_ALIGNS: 63 Adding 18808 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -449.6579, CN propb: -449.6579 weights: 0.1085 constraints: 1581 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 1581 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 1581 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 17227 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 17227 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 18808 # command: