# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0309/ # command:# Making conformation for sequence T0309 numbered 1 through 76 Created new target T0309 from T0309.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0309/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0309//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0309/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0309//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0309/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0309/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0309/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iz5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1iz5A expands to /projects/compbio/data/pdb/1iz5.pdb.gz 1iz5A:# T0309 read from 1iz5A/merged-good-all-a2m # 1iz5A read from 1iz5A/merged-good-all-a2m # adding 1iz5A to template set # found chain 1iz5A in template set T0309 13 :GFFDM 1iz5A 185 :GLLDI # choosing archetypes in rotamer library T0309 21 :EVTEQTK 1iz5A 190 :EVQEETK T0309 31 :YTYDFKEILSEFNG 1iz5A 197 :SAYGVSYLSDMVKG T0309 45 :KNVSITVKEENELPV 1iz5A 213 :KADEVTIKFGNEMPM Number of specific fragments extracted= 4 number of extra gaps= 0 total=4 Number of alignments=1 # 1iz5A read from 1iz5A/merged-good-all-a2m # found chain 1iz5A in template set T0309 13 :GFFDM 1iz5A 185 :GLLDI T0309 21 :EVTEQTK 1iz5A 190 :EVQEETK T0309 31 :YTYDFKEILSEFNG 1iz5A 197 :SAYGVSYLSDMVKG T0309 45 :KNVSITVKEENELPV 1iz5A 213 :KADEVTIKFGNEMPM Number of specific fragments extracted= 4 number of extra gaps= 0 total=8 Number of alignments=2 # 1iz5A read from 1iz5A/merged-good-all-a2m # found chain 1iz5A in template set T0309 13 :GFFDM 1iz5A 185 :GLLDI T0309 21 :EVTEQTK 1iz5A 190 :EVQEETK T0309 31 :YTYDFKEILSEFNG 1iz5A 197 :SAYGVSYLSDMVKG T0309 45 :KNVSITVKEENELPV 1iz5A 213 :KADEVTIKFGNEMPM Number of specific fragments extracted= 4 number of extra gaps= 0 total=12 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wmhB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0309 read from 1wmhB/merged-good-all-a2m # 1wmhB read from 1wmhB/merged-good-all-a2m # found chain 1wmhB in training set T0309 8 :QINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEF 1wmhB 15 :IVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAV T0309 43 :NGKNVSITVKEE 1wmhB 53 :PGLDVLLGYTDA T0309 55 :NELPV 1wmhB 67 :DLLPL Number of specific fragments extracted= 3 number of extra gaps= 0 total=15 Number of alignments=4 # 1wmhB read from 1wmhB/merged-good-all-a2m # found chain 1wmhB in training set T0309 8 :QINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEF 1wmhB 15 :IVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAV T0309 43 :NGKNVSITVKEE 1wmhB 53 :PGLDVLLGYTDA T0309 55 :NELPV 1wmhB 67 :DLLPL Number of specific fragments extracted= 3 number of extra gaps= 0 total=18 Number of alignments=5 # 1wmhB read from 1wmhB/merged-good-all-a2m # found chain 1wmhB in training set T0309 8 :QINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEF 1wmhB 15 :IVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAV T0309 43 :NGKNVSITVKEE 1wmhB 53 :PGLDVLLGYTDA T0309 55 :NELPV 1wmhB 67 :DLLPL Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fvtA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fvtA expands to /projects/compbio/data/pdb/2fvt.pdb.gz 2fvtA:# T0309 read from 2fvtA/merged-good-all-a2m # 2fvtA read from 2fvtA/merged-good-all-a2m # adding 2fvtA to template set # found chain 2fvtA in template set T0309 34 :DFKEILSE 2fvtA 108 :TYNIMIGE T0309 44 :GKNVSITVKE 2fvtA 116 :RRRVAAALIA T0309 67 :DPLEHHHHHH 2fvtA 126 :VPLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=7 # 2fvtA read from 2fvtA/merged-good-all-a2m # found chain 2fvtA in template set T0309 34 :DFKEILSE 2fvtA 108 :TYNIMIGE T0309 44 :GKNVSITVKE 2fvtA 116 :RRRVAAALIA T0309 67 :DPLEHHHHHH 2fvtA 126 :VPLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=8 # 2fvtA read from 2fvtA/merged-good-all-a2m # found chain 2fvtA in template set T0309 34 :DFKEILSE 2fvtA 108 :TYNIMIGE T0309 44 :GKNVSITVKE 2fvtA 116 :RRRVAAALIA T0309 67 :DPLEHHHHHH 2fvtA 126 :VPLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=30 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m93A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0309 read from 1m93A/merged-good-all-a2m # 1m93A read from 1m93A/merged-good-all-a2m # found chain 1m93A in training set T0309 35 :FKEILSEFNGKNVSI 1m93A 4 :FREIASSMKGENVFI Number of specific fragments extracted= 1 number of extra gaps= 0 total=31 # 1m93A read from 1m93A/merged-good-all-a2m # found chain 1m93A in training set T0309 35 :FKEILSEFNGKNVSI 1m93A 4 :FREIASSMKGENVFI Number of specific fragments extracted= 1 number of extra gaps= 0 total=32 # 1m93A read from 1m93A/merged-good-all-a2m # found chain 1m93A in training set T0309 35 :FKEILSEFNGKNVSI 1m93A 4 :FREIASSMKGENVFI Number of specific fragments extracted= 1 number of extra gaps= 0 total=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dyqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0309 read from 1dyqA/merged-good-all-a2m # 1dyqA read from 1dyqA/merged-good-all-a2m # found chain 1dyqA in training set T0309 5 :KVHQINVKGFFDMD 1dyqA 48 :RQHTILFKGFFTDH T0309 24 :EQTKEAEYTYDFKEILSEFNGKNVSITVKE 1dyqA 62 :SWYNDLLVRFDSKDIVDKYKGKKVDLYGAY Number of specific fragments extracted= 2 number of extra gaps= 0 total=35 Number of alignments=10 # 1dyqA read from 1dyqA/merged-good-all-a2m # found chain 1dyqA in training set T0309 5 :KVHQINVKGFFDMD 1dyqA 48 :RQHTILFKGFFTDH T0309 24 :EQTKEAEYTYDFKEILSEFNGKNVSITVKE 1dyqA 62 :SWYNDLLVRFDSKDIVDKYKGKKVDLYGAY Number of specific fragments extracted= 2 number of extra gaps= 0 total=37 Number of alignments=11 # 1dyqA read from 1dyqA/merged-good-all-a2m # found chain 1dyqA in training set T0309 5 :KVHQINVKGFFDMD 1dyqA 48 :RQHTILFKGFFTDH T0309 24 :EQTKEAEYTYDFKEILSEFNGKNVSITVKE 1dyqA 62 :SWYNDLLVRFDSKDIVDKYKGKKVDLYGAY Number of specific fragments extracted= 2 number of extra gaps= 0 total=39 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2snv/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2snv expands to /projects/compbio/data/pdb/2snv.pdb.gz 2snv:Warning: there is no chain 2snv will retry with 2snvA # T0309 read from 2snv/merged-good-all-a2m # 2snv read from 2snv/merged-good-all-a2m # adding 2snv to template set # found chain 2snv in template set Warning: unaligning (T0309)V6 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)V227 Warning: unaligning (T0309)H7 because of BadResidue code BAD_PEPTIDE at template residue (2snv)V227 Warning: unaligning (T0309)T23 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)S249 Warning: unaligning (T0309)E24 because of BadResidue code BAD_PEPTIDE at template residue (2snv)S249 Warning: unaligning (T0309)E28 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)I254 Warning: unaligning (T0309)A29 because of BadResidue code BAD_PEPTIDE at template residue (2snv)I254 T0309 2 :ASKK 2snv 222 :NSGR T0309 8 :QINVKG 2snv 228 :AIVLGG T0309 14 :FFDMDVMEV 2snv 239 :RTALSVVTW T0309 25 :QTK 2snv 250 :KGK T0309 30 :EYT 2snv 255 :KTT Number of specific fragments extracted= 5 number of extra gaps= 3 total=44 Number of alignments=13 # 2snv read from 2snv/merged-good-all-a2m # found chain 2snv in template set Warning: unaligning (T0309)V6 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)V227 Warning: unaligning (T0309)H7 because of BadResidue code BAD_PEPTIDE at template residue (2snv)V227 Warning: unaligning (T0309)T23 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)S249 Warning: unaligning (T0309)E24 because of BadResidue code BAD_PEPTIDE at template residue (2snv)S249 Warning: unaligning (T0309)E28 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)I254 Warning: unaligning (T0309)A29 because of BadResidue code BAD_PEPTIDE at template residue (2snv)I254 T0309 2 :ASKK 2snv 222 :NSGR T0309 8 :QINVKG 2snv 228 :AIVLGG T0309 14 :FFDMDVMEV 2snv 239 :RTALSVVTW T0309 25 :QTK 2snv 250 :KGK T0309 30 :EYT 2snv 255 :KTT Number of specific fragments extracted= 5 number of extra gaps= 3 total=49 Number of alignments=14 # 2snv read from 2snv/merged-good-all-a2m # found chain 2snv in template set Warning: unaligning (T0309)V6 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)V227 Warning: unaligning (T0309)H7 because of BadResidue code BAD_PEPTIDE at template residue (2snv)V227 Warning: unaligning (T0309)T23 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)S249 Warning: unaligning (T0309)E24 because of BadResidue code BAD_PEPTIDE at template residue (2snv)S249 Warning: unaligning (T0309)E28 because of BadResidue code BAD_PEPTIDE in next template residue (2snv)I254 Warning: unaligning (T0309)A29 because of BadResidue code BAD_PEPTIDE at template residue (2snv)I254 T0309 2 :ASKK 2snv 222 :NSGR T0309 8 :QINVKG 2snv 228 :AIVLGG T0309 14 :FFDMDVMEV 2snv 239 :RTALSVVTW T0309 25 :QTK 2snv 250 :KGK T0309 30 :EYT 2snv 255 :KTT Number of specific fragments extracted= 5 number of extra gaps= 3 total=54 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2rslA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2rslA expands to /projects/compbio/data/pdb/2rsl.pdb.gz 2rslA:Skipped atom 455, because occupancy 0.27 <= existing 0.730 in 2rslA Skipped atom 457, because occupancy 0.270 <= existing 0.730 in 2rslA Skipped atom 459, because occupancy 0.270 <= existing 0.730 in 2rslA Skipped atom 461, because occupancy 0.270 <= existing 0.730 in 2rslA # T0309 read from 2rslA/merged-good-all-a2m # 2rslA read from 2rslA/merged-good-all-a2m # adding 2rslA to template set # found chain 2rslA in template set T0309 31 :YTYDFKEILSEFNGKNVSITV 2rslA 72 :DTADMIQLIKEFDAQGVSIRF Number of specific fragments extracted= 1 number of extra gaps= 0 total=55 Number of alignments=16 # 2rslA read from 2rslA/merged-good-all-a2m # found chain 2rslA in template set T0309 31 :YTYDFKEILSEFNGKNVSITV 2rslA 72 :DTADMIQLIKEFDAQGVSIRF Number of specific fragments extracted= 1 number of extra gaps= 0 total=56 Number of alignments=17 # 2rslA read from 2rslA/merged-good-all-a2m # found chain 2rslA in template set T0309 31 :YTYDFKEILSEFNGKNVSITV 2rslA 72 :DTADMIQLIKEFDAQGVSIRF Number of specific fragments extracted= 1 number of extra gaps= 0 total=57 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bdqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0309/2bdqA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0309/2bdqA/merged-good-all-a2m.gz for input Trying 2bdqA/merged-good-all-a2m Error: Couldn't open file 2bdqA/merged-good-all-a2m or 2bdqA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a2pA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a2pA expands to /projects/compbio/data/pdb/2a2p.pdb.gz 2a2pA:# T0309 read from 2a2pA/merged-good-all-a2m # 2a2pA read from 2a2pA/merged-good-all-a2m # adding 2a2pA to template set # found chain 2a2pA in template set T0309 15 :FDMDVMEVTEQTKEAEYT 2a2pA 78 :ADPELVLLSRNYQELERI T0309 34 :DFKEILSEFNGKNVS 2a2pA 104 :EINALVQELGFYRKS T0309 52 :KEENELPVKGVEMAG 2a2pA 119 :APEAQVPPEYLWAPA T0309 67 :DPLEHHHHHH 2a2pA 143 :DDLEHHHHHH Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=19 # 2a2pA read from 2a2pA/merged-good-all-a2m # found chain 2a2pA in template set T0309 15 :FDMDVMEVTEQTKEAEYT 2a2pA 78 :ADPELVLLSRNYQELERI T0309 34 :DFKEILSEFNGKNVS 2a2pA 104 :EINALVQELGFYRKS T0309 52 :KEENELPVKGVEMAG 2a2pA 119 :APEAQVPPEYLWAPA T0309 67 :DPLEHHHHHH 2a2pA 143 :DDLEHHHHHH Number of specific fragments extracted= 4 number of extra gaps= 0 total=65 Number of alignments=20 # 2a2pA read from 2a2pA/merged-good-all-a2m # found chain 2a2pA in template set T0309 15 :FDMDVMEVTEQTKEAEYT 2a2pA 78 :ADPELVLLSRNYQELERI T0309 34 :DFKEILSEFNGKNVS 2a2pA 104 :EINALVQELGFYRKS T0309 52 :KEENELPVKGVEMAG 2a2pA 119 :APEAQVPPEYLWAPA T0309 67 :DPLEHHHHHH 2a2pA 143 :DDLEHHHHHH Number of specific fragments extracted= 4 number of extra gaps= 0 total=69 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tzaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tzaA expands to /projects/compbio/data/pdb/1tza.pdb.gz 1tzaA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0309 read from 1tzaA/merged-good-all-a2m # 1tzaA read from 1tzaA/merged-good-all-a2m # adding 1tzaA to template set # found chain 1tzaA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVT 1tzaA 77 :PNTAYQYTSGTVLDTPFGIMY T0309 29 :AEYT 1tzaA 98 :GTYG T0309 43 :NGKNVSITVKE 1tzaA 106 :SGEHFNAIIKP T0309 55 :NELPVKGV 1tzaA 117 :FRLATPGL T0309 67 :DPLEHHHHHH 1tzaA 125 :LHLEHHHHHH Number of specific fragments extracted= 5 number of extra gaps= 0 total=74 Number of alignments=22 # 1tzaA read from 1tzaA/merged-good-all-a2m # found chain 1tzaA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVT 1tzaA 77 :PNTAYQYTSGTVLDTPFGIMY T0309 29 :AEYT 1tzaA 98 :GTYG T0309 43 :NGKNVSITVKE 1tzaA 106 :SGEHFNAIIKP T0309 55 :NELPVKGV 1tzaA 117 :FRLATPGL T0309 67 :DPLEHHHHHH 1tzaA 125 :LHLEHHHHHH Number of specific fragments extracted= 5 number of extra gaps= 0 total=79 Number of alignments=23 # 1tzaA read from 1tzaA/merged-good-all-a2m # found chain 1tzaA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVT 1tzaA 77 :PNTAYQYTSGTVLDTPFGIMY T0309 29 :AEYT 1tzaA 98 :GTYG T0309 43 :NGKNVSITVKE 1tzaA 106 :SGEHFNAIIKP T0309 55 :NELPVKGV 1tzaA 117 :FRLATPGL T0309 67 :DPLEHHHHHH 1tzaA 125 :LHLEHHHHHH Number of specific fragments extracted= 5 number of extra gaps= 0 total=84 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ma3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ma3A expands to /projects/compbio/data/pdb/1ma3.pdb.gz 1ma3A:# T0309 read from 1ma3A/merged-good-all-a2m # 1ma3A read from 1ma3A/merged-good-all-a2m # adding 1ma3A to template set # found chain 1ma3A in template set T0309 15 :FDMDVMEVTEQT 1ma3A 119 :GSMDKLDCLDCH T0309 31 :YTYDFKEILSEFNGKNV 1ma3A 131 :ETYDWSEFVEDFNKGEI T0309 52 :KEENELPVKGVEMAGDPL 1ma3A 152 :KCGSYYVKPRVVLFGEPL Number of specific fragments extracted= 3 number of extra gaps= 0 total=87 Number of alignments=25 # 1ma3A read from 1ma3A/merged-good-all-a2m # found chain 1ma3A in template set T0309 15 :FDMDVMEVTEQT 1ma3A 119 :GSMDKLDCLDCH T0309 31 :YTYDFKEILSEFNGKNV 1ma3A 131 :ETYDWSEFVEDFNKGEI T0309 52 :KEENELPVKGVEMAGDPL 1ma3A 152 :KCGSYYVKPRVVLFGEPL Number of specific fragments extracted= 3 number of extra gaps= 0 total=90 Number of alignments=26 # 1ma3A read from 1ma3A/merged-good-all-a2m # found chain 1ma3A in template set T0309 15 :FDMDVMEVTEQT 1ma3A 119 :GSMDKLDCLDCH T0309 31 :YTYDFKEILSEFNGKNV 1ma3A 131 :ETYDWSEFVEDFNKGEI T0309 52 :KEENELPVKGVEMAGDPL 1ma3A 152 :KCGSYYVKPRVVLFGEPL Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1a53/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1a53 expands to /projects/compbio/data/pdb/1a53.pdb.gz 1a53:Warning: there is no chain 1a53 will retry with 1a53A # T0309 read from 1a53/merged-good-all-a2m # 1a53 read from 1a53/merged-good-all-a2m # adding 1a53 to template set # found chain 1a53 in template set T0309 33 :YDFKEILSEFNGKNVSITV 1a53 192 :ENQRKLISMIPSNVVKVAE Number of specific fragments extracted= 1 number of extra gaps= 0 total=94 # 1a53 read from 1a53/merged-good-all-a2m # found chain 1a53 in template set T0309 33 :YDFKEILSEFNGKNVSITV 1a53 192 :ENQRKLISMIPSNVVKVAE Number of specific fragments extracted= 1 number of extra gaps= 0 total=95 # 1a53 read from 1a53/merged-good-all-a2m # found chain 1a53 in template set T0309 33 :YDFKEILSEFNGKNVSITV 1a53 192 :ENQRKLISMIPSNVVKVAE Number of specific fragments extracted= 1 number of extra gaps= 0 total=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ghtA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ghtA expands to /projects/compbio/data/pdb/1ght.pdb.gz 1ghtA:# T0309 read from 1ghtA/merged-good-all-a2m # 1ghtA read from 1ghtA/merged-good-all-a2m # adding 1ghtA to template set # found chain 1ghtA in template set T0309 22 :VTEQTKEAEYTYDFKEILSEFN 1ghtA 63 :VKKLDRLGRDTADMIQLIKEFD Number of specific fragments extracted= 1 number of extra gaps= 0 total=97 Number of alignments=28 # 1ghtA read from 1ghtA/merged-good-all-a2m # found chain 1ghtA in template set T0309 22 :VTEQTKEAEYTYDFKEILSEFN 1ghtA 63 :VKKLDRLGRDTADMIQLIKEFD Number of specific fragments extracted= 1 number of extra gaps= 0 total=98 Number of alignments=29 # 1ghtA read from 1ghtA/merged-good-all-a2m # found chain 1ghtA in template set T0309 22 :VTEQTKEAEYTYDFKEILSEFN 1ghtA 63 :VKKLDRLGRDTADMIQLIKEFD Number of specific fragments extracted= 1 number of extra gaps= 0 total=99 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2aioA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2aioA expands to /projects/compbio/data/pdb/2aio.pdb.gz 2aioA:# T0309 read from 2aioA/merged-good-all-a2m # 2aioA read from 2aioA/merged-good-all-a2m # adding 2aioA to template set # found chain 2aioA in template set T0309 43 :NGKNVSITVK 2aioA 210 :NGKPVRIAYA T0309 55 :NELPVKGVEMAGDPL 2aioA 220 :DSLSAPGYQLQGNPR Number of specific fragments extracted= 2 number of extra gaps= 0 total=101 Number of alignments=31 # 2aioA read from 2aioA/merged-good-all-a2m # found chain 2aioA in template set T0309 43 :NGKNVSITVK 2aioA 210 :NGKPVRIAYA T0309 55 :NELPVKGVEMAGDPL 2aioA 220 :DSLSAPGYQLQGNPR Number of specific fragments extracted= 2 number of extra gaps= 0 total=103 Number of alignments=32 # 2aioA read from 2aioA/merged-good-all-a2m # found chain 2aioA in template set T0309 43 :NGKNVSITVK 2aioA 210 :NGKPVRIAYA T0309 55 :NELPVKGVEMAGDPL 2aioA 220 :DSLSAPGYQLQGNPR Number of specific fragments extracted= 2 number of extra gaps= 0 total=105 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y96B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y96B expands to /projects/compbio/data/pdb/1y96.pdb.gz 1y96B:# T0309 read from 1y96B/merged-good-all-a2m # 1y96B read from 1y96B/merged-good-all-a2m # adding 1y96B to template set # found chain 1y96B in template set T0309 24 :EQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPV 1y96B 55 :EQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAA Number of specific fragments extracted= 1 number of extra gaps= 0 total=106 Number of alignments=34 # 1y96B read from 1y96B/merged-good-all-a2m # found chain 1y96B in template set T0309 24 :EQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPV 1y96B 55 :EQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAA Number of specific fragments extracted= 1 number of extra gaps= 0 total=107 Number of alignments=35 # 1y96B read from 1y96B/merged-good-all-a2m # found chain 1y96B in template set T0309 24 :EQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPV 1y96B 55 :EQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAA Number of specific fragments extracted= 1 number of extra gaps= 0 total=108 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bdtA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0309/2bdtA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0309/2bdtA/merged-good-all-a2m.gz for input Trying 2bdtA/merged-good-all-a2m Error: Couldn't open file 2bdtA/merged-good-all-a2m or 2bdtA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0309/1tf7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0309/1tf7A/merged-good-all-a2m.gz for input Trying 1tf7A/merged-good-all-a2m Error: Couldn't open file 1tf7A/merged-good-all-a2m or 1tf7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pe0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pe0A expands to /projects/compbio/data/pdb/1pe0.pdb.gz 1pe0A:# T0309 read from 1pe0A/merged-good-all-a2m # 1pe0A read from 1pe0A/merged-good-all-a2m # adding 1pe0A to template set # found chain 1pe0A in template set Warning: unaligning (T0309)A2 because first residue in template chain is (1pe0A)A2 T0309 3 :SKKVHQINVKGFFDMDVM 1pe0A 3 :SKRALVILAKGAEEMETV T0309 34 :DFKEILSEFNGKNVSITVKEENELP 1pe0A 21 :IPVDVMRRAGIKVTVAGLAGKDPVQ T0309 64 :MAGD 1pe0A 46 :CSRD Number of specific fragments extracted= 3 number of extra gaps= 0 total=111 Number of alignments=37 # 1pe0A read from 1pe0A/merged-good-all-a2m # found chain 1pe0A in template set Warning: unaligning (T0309)A2 because first residue in template chain is (1pe0A)A2 T0309 3 :SKKVHQINVKGFFDMDVM 1pe0A 3 :SKRALVILAKGAEEMETV T0309 34 :DFKEILSEFNGKNVSITVKEENELP 1pe0A 21 :IPVDVMRRAGIKVTVAGLAGKDPVQ T0309 64 :MAGD 1pe0A 46 :CSRD Number of specific fragments extracted= 3 number of extra gaps= 0 total=114 Number of alignments=38 # 1pe0A read from 1pe0A/merged-good-all-a2m # found chain 1pe0A in template set Warning: unaligning (T0309)A2 because first residue in template chain is (1pe0A)A2 T0309 3 :SKKVHQINVKGFFDMDVM 1pe0A 3 :SKRALVILAKGAEEMETV T0309 34 :DFKEILSEFNGKNVSITVKEENEL 1pe0A 21 :IPVDVMRRAGIKVTVAGLAGKDPV T0309 63 :EMAGD 1pe0A 45 :QCSRD Number of specific fragments extracted= 3 number of extra gaps= 0 total=117 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d2oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1d2oA expands to /projects/compbio/data/pdb/1d2o.pdb.gz 1d2oA:# T0309 read from 1d2oA/merged-good-all-a2m # 1d2oA read from 1d2oA/merged-good-all-a2m # adding 1d2oA to template set # found chain 1d2oA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKE 1d2oA 553 :GKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKD T0309 43 :NGKNVSITVKEE 1d2oA 593 :EGKKIEYTVTED T0309 58 :PVKGVE 1d2oA 605 :HVKDYT Number of specific fragments extracted= 3 number of extra gaps= 0 total=120 Number of alignments=40 # 1d2oA read from 1d2oA/merged-good-all-a2m # found chain 1d2oA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKE 1d2oA 553 :GKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKD T0309 43 :NGKNVSITVKEE 1d2oA 593 :EGKKIEYTVTED T0309 58 :PVKGVE 1d2oA 605 :HVKDYT Number of specific fragments extracted= 3 number of extra gaps= 0 total=123 Number of alignments=41 # 1d2oA read from 1d2oA/merged-good-all-a2m # found chain 1d2oA in template set T0309 4 :KKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKE 1d2oA 554 :KRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKD T0309 43 :NGKNVSITVKEE 1d2oA 593 :EGKKIEYTVTED T0309 58 :PVKGVE 1d2oA 605 :HVKDYT Number of specific fragments extracted= 3 number of extra gaps= 0 total=126 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zynA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zynA expands to /projects/compbio/data/pdb/1zyn.pdb.gz 1zynA:# T0309 read from 1zynA/merged-good-all-a2m # 1zynA read from 1zynA/merged-good-all-a2m # adding 1zynA to template set # found chain 1zynA in template set T0309 9 :INVKGFFDM 1zynA 21 :VELIATLDD T0309 25 :QTK 1zynA 30 :SAK T0309 32 :TYDFKEILSEFNGKNVSITVKEENELPV 1zynA 33 :SAEIKELLAEIAELSDKVTFKEDNTLPV T0309 60 :KGVEMAGDPLEH 1zynA 74 :QGPRFAGSPLGH Number of specific fragments extracted= 4 number of extra gaps= 0 total=130 Number of alignments=43 # 1zynA read from 1zynA/merged-good-all-a2m # found chain 1zynA in template set T0309 9 :INVKGFFDM 1zynA 21 :VELIATLDD T0309 25 :QTK 1zynA 30 :SAK T0309 32 :TYDFKEILSEFNGKNVSITVKEENELPV 1zynA 33 :SAEIKELLAEIAELSDKVTFKEDNTLPV T0309 60 :KGVEMAGDPLEH 1zynA 74 :QGPRFAGSPLGH Number of specific fragments extracted= 4 number of extra gaps= 0 total=134 Number of alignments=44 # 1zynA read from 1zynA/merged-good-all-a2m # found chain 1zynA in template set T0309 9 :INVKGFFDM 1zynA 21 :VELIATLDD T0309 25 :QTK 1zynA 30 :SAK T0309 32 :TYDFKEILSEFNGKNVSITVKEENELPV 1zynA 33 :SAEIKELLAEIAELSDKVTFKEDNTLPV T0309 60 :KGVEMAGDPLEH 1zynA 74 :QGPRFAGSPLGH Number of specific fragments extracted= 4 number of extra gaps= 0 total=138 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q59A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1q59A expands to /projects/compbio/data/pdb/1q59.pdb.gz 1q59A:# T0309 read from 1q59A/merged-good-all-a2m # 1q59A read from 1q59A/merged-good-all-a2m # adding 1q59A to template set # found chain 1q59A in template set T0309 35 :FKEILSEFNG 1q59A 140 :LDGWIHQQGG T0309 54 :ENELP 1q59A 155 :EDNIP T0309 64 :MAGDPLEHHHHHH 1q59A 160 :GDDDDLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=141 Number of alignments=46 # 1q59A read from 1q59A/merged-good-all-a2m # found chain 1q59A in template set T0309 35 :FKEILSEFNG 1q59A 140 :LDGWIHQQGG T0309 54 :ENELP 1q59A 155 :EDNIP T0309 64 :MAGDPLEHHHHHH 1q59A 160 :GDDDDLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=144 Number of alignments=47 # 1q59A read from 1q59A/merged-good-all-a2m # found chain 1q59A in template set T0309 35 :FKEILSEFNG 1q59A 140 :LDGWIHQQGG T0309 54 :EN 1q59A 155 :ED T0309 61 :GVEMAGDPLEHHHHHH 1q59A 157 :NIPGDDDDLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=147 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kkdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kkdA expands to /projects/compbio/data/pdb/1kkd.pdb.gz 1kkdA:# T0309 read from 1kkdA/merged-good-all-a2m # 1kkdA read from 1kkdA/merged-good-all-a2m # adding 1kkdA to template set # found chain 1kkdA in template set Warning: unaligning (T0309)P68 because last residue in template chain is (1kkdA)Q92 T0309 54 :ENELPVKGVEMAGD 1kkdA 78 :LNDQANTLVDLAKT Number of specific fragments extracted= 1 number of extra gaps= 0 total=148 # 1kkdA read from 1kkdA/merged-good-all-a2m # found chain 1kkdA in template set Warning: unaligning (T0309)P68 because last residue in template chain is (1kkdA)Q92 T0309 54 :ENELPVKGVEMAGD 1kkdA 78 :LNDQANTLVDLAKT Number of specific fragments extracted= 1 number of extra gaps= 0 total=149 # 1kkdA read from 1kkdA/merged-good-all-a2m # found chain 1kkdA in template set Warning: unaligning (T0309)P68 because last residue in template chain is (1kkdA)Q92 T0309 53 :EENELPVKGVEMAGD 1kkdA 77 :KLNDQANTLVDLAKT Number of specific fragments extracted= 1 number of extra gaps= 0 total=150 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d2pA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1d2pA expands to /projects/compbio/data/pdb/1d2p.pdb.gz 1d2pA:# T0309 read from 1d2pA/merged-good-all-a2m # 1d2pA read from 1d2pA/merged-good-all-a2m # adding 1d2pA to template set # found chain 1d2pA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEI 1d2pA 740 :GKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDL T0309 43 :NGKNVSITVKEE 1d2pA 780 :EGKKIEYTVTED T0309 58 :PVKGVE 1d2pA 792 :HVKDYT Number of specific fragments extracted= 3 number of extra gaps= 0 total=153 Number of alignments=49 # 1d2pA read from 1d2pA/merged-good-all-a2m # found chain 1d2pA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEI 1d2pA 740 :GKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDL T0309 43 :NGKNVSITVKEE 1d2pA 780 :EGKKIEYTVTED T0309 58 :PVKGVE 1d2pA 792 :HVKDYT Number of specific fragments extracted= 3 number of extra gaps= 0 total=156 Number of alignments=50 # 1d2pA read from 1d2pA/merged-good-all-a2m # found chain 1d2pA in template set T0309 3 :SKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEI 1d2pA 740 :GKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDL T0309 43 :NGKNVSITVKEEN 1d2pA 780 :EGKKIEYTVTEDH T0309 59 :VKGVE 1d2pA 793 :VKDYT Number of specific fragments extracted= 3 number of extra gaps= 0 total=159 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kxrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kxrA expands to /projects/compbio/data/pdb/1kxr.pdb.gz 1kxrA:# T0309 read from 1kxrA/merged-good-all-a2m # 1kxrA read from 1kxrA/merged-good-all-a2m # adding 1kxrA to template set # found chain 1kxrA in template set Warning: unaligning (T0309)E53 because last residue in template chain is (1kxrA)N352 T0309 23 :TEQTKEAEYTYDFKEILSEFN 1kxrA 326 :RVKMEDGEFWMSFRDFIREFT T0309 48 :SITVK 1kxrA 347 :KLEIC Number of specific fragments extracted= 2 number of extra gaps= 0 total=161 Number of alignments=52 # 1kxrA read from 1kxrA/merged-good-all-a2m # found chain 1kxrA in template set Warning: unaligning (T0309)E53 because last residue in template chain is (1kxrA)N352 T0309 23 :TEQTKEAEYTYDFKEILSEFN 1kxrA 326 :RVKMEDGEFWMSFRDFIREFT T0309 48 :SITVK 1kxrA 347 :KLEIC Number of specific fragments extracted= 2 number of extra gaps= 0 total=163 Number of alignments=53 # 1kxrA read from 1kxrA/merged-good-all-a2m # found chain 1kxrA in template set Warning: unaligning (T0309)E53 because last residue in template chain is (1kxrA)N352 T0309 23 :TEQTKEAEYTYDFKEILSEFN 1kxrA 326 :RVKMEDGEFWMSFRDFIREFT T0309 48 :SITVK 1kxrA 347 :KLEIC Number of specific fragments extracted= 2 number of extra gaps= 0 total=165 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d1rA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1d1rA expands to /projects/compbio/data/pdb/1d1r.pdb.gz 1d1rA:# T0309 read from 1d1rA/merged-good-all-a2m # 1d1rA read from 1d1rA/merged-good-all-a2m # adding 1d1rA to template set # found chain 1d1rA in template set Warning: unaligning (T0309)E70 because last residue in template chain is (1d1rA)E111 T0309 14 :FFDMDVMEVTEQTKE 1d1rA 77 :AVKDGVIEIQGDKRD T0309 34 :DFKEILSEFNGK 1d1rA 92 :LLKSLLEAKGMK T0309 62 :VEMAGD 1d1rA 104 :VKLAGG T0309 69 :L 1d1rA 110 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=169 Number of alignments=55 # 1d1rA read from 1d1rA/merged-good-all-a2m # found chain 1d1rA in template set Warning: unaligning (T0309)E70 because last residue in template chain is (1d1rA)E111 T0309 14 :FFDMDVMEVTEQTKE 1d1rA 77 :AVKDGVIEIQGDKRD T0309 34 :DFKEILSEFNGK 1d1rA 92 :LLKSLLEAKGMK T0309 62 :VEMAGD 1d1rA 104 :VKLAGG T0309 69 :L 1d1rA 110 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=173 Number of alignments=56 # 1d1rA read from 1d1rA/merged-good-all-a2m # found chain 1d1rA in template set Warning: unaligning (T0309)E70 because last residue in template chain is (1d1rA)E111 T0309 14 :FFDMDVMEVTEQTKE 1d1rA 77 :AVKDGVIEIQGDKRD T0309 34 :DFKEILSEFNGK 1d1rA 92 :LLKSLLEAKGMK T0309 62 :VEMAGD 1d1rA 104 :VKLAGG T0309 69 :L 1d1rA 110 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=177 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2d1uA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2d1uA expands to /projects/compbio/data/pdb/2d1u.pdb.gz 2d1uA:# T0309 read from 2d1uA/merged-good-all-a2m # 2d1uA read from 2d1uA/merged-good-all-a2m # adding 2d1uA to template set # found chain 2d1uA in template set T0309 24 :EQTKEAEYTYDFKEILSE 2d1uA 35 :KQSNGLHGDYDVESGLQQ T0309 42 :FNGKNV 2d1uA 54 :LDGSGL T0309 48 :SITVKEENELPVKGVEMAGD 2d1uA 68 :SWTLEPAPAPKEDALTVVGD T0309 68 :PLEHHHHHH 2d1uA 96 :DLEHHHHHH Number of specific fragments extracted= 4 number of extra gaps= 0 total=181 Number of alignments=58 # 2d1uA read from 2d1uA/merged-good-all-a2m # found chain 2d1uA in template set T0309 24 :EQTKEAEYTYDFKEILSE 2d1uA 35 :KQSNGLHGDYDVESGLQQ T0309 42 :FNGKNV 2d1uA 54 :LDGSGL T0309 48 :SITVKEENELPVKGVEMAGD 2d1uA 68 :SWTLEPAPAPKEDALTVVGD T0309 68 :PLEHHHHHH 2d1uA 96 :DLEHHHHHH Number of specific fragments extracted= 4 number of extra gaps= 0 total=185 Number of alignments=59 # 2d1uA read from 2d1uA/merged-good-all-a2m # found chain 2d1uA in template set T0309 24 :EQTKEAEYTYDFKEILSE 2d1uA 35 :KQSNGLHGDYDVESGLQQ T0309 42 :FNGKNV 2d1uA 54 :LDGSGL T0309 48 :SITVKEENELPVKGVEMAGD 2d1uA 68 :SWTLEPAPAPKEDALTVVGD T0309 68 :PLEHHHHHH 2d1uA 96 :DLEHHHHHH Number of specific fragments extracted= 4 number of extra gaps= 0 total=189 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1repC/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1repC expands to /projects/compbio/data/pdb/1rep.pdb.gz 1repC:# T0309 read from 1repC/merged-good-all-a2m # 1repC read from 1repC/merged-good-all-a2m # adding 1repC to template set # found chain 1repC in template set Warning: unaligning (T0309)T50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1repC)E110 T0309 27 :KEAEYTYDFKEILSEFNGKNVSI 1repC 74 :TSAEASKDIRQALKSFAGKEVVF Number of specific fragments extracted= 1 number of extra gaps= 0 total=190 Number of alignments=61 # 1repC read from 1repC/merged-good-all-a2m # found chain 1repC in template set Warning: unaligning (T0309)T50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1repC)E110 T0309 27 :KEAEYTYDFKEILSEFNGKNVSI 1repC 74 :TSAEASKDIRQALKSFAGKEVVF Number of specific fragments extracted= 1 number of extra gaps= 0 total=191 Number of alignments=62 # 1repC read from 1repC/merged-good-all-a2m # found chain 1repC in template set Warning: unaligning (T0309)T50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1repC)E110 Warning: unaligning (T0309)E63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1repC)E110 T0309 27 :KEAEYTYDFKEILSEFNGKNVSI 1repC 74 :TSAEASKDIRQALKSFAGKEVVF Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mejA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1mejA expands to /projects/compbio/data/pdb/1mej.pdb.gz 1mejA:# T0309 read from 1mejA/merged-good-all-a2m # 1mejA read from 1mejA/merged-good-all-a2m # adding 1mejA to template set # found chain 1mejA in template set T0309 32 :TYDFKEILSEFNGKNVSITV 1mejA 117 :GSNAHEQALETGVTVTGCTV Number of specific fragments extracted= 1 number of extra gaps= 0 total=193 Number of alignments=64 # 1mejA read from 1mejA/merged-good-all-a2m # found chain 1mejA in template set T0309 32 :TYDFKEILSEFNGKNVSITV 1mejA 117 :GSNAHEQALETGVTVTGCTV Number of specific fragments extracted= 1 number of extra gaps= 0 total=194 Number of alignments=65 # 1mejA read from 1mejA/merged-good-all-a2m # found chain 1mejA in template set T0309 32 :TYDFKEILSEFNGKNVSITV 1mejA 117 :GSNAHEQALETGVTVTGCTV Number of specific fragments extracted= 1 number of extra gaps= 0 total=195 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hyuA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hyuA expands to /projects/compbio/data/pdb/1hyu.pdb.gz 1hyuA:# T0309 read from 1hyuA/merged-good-all-a2m # 1hyuA read from 1hyuA/merged-good-all-a2m # adding 1hyuA to template set # found chain 1hyuA in template set T0309 5 :KVHQI 1hyuA 20 :PVELI T0309 20 :MEVTEQTKEA 1hyuA 25 :ATLDDSAKSA T0309 34 :DFKEILSEFNGKNVSITVKEENELPV 1hyuA 35 :EIKELLAEIAELSDKVTFKEDNTLPV T0309 60 :KGVEMAGDPLEHH 1hyuA 74 :QGPRFAGSPLGHE Number of specific fragments extracted= 4 number of extra gaps= 0 total=199 Number of alignments=67 # 1hyuA read from 1hyuA/merged-good-all-a2m # found chain 1hyuA in template set T0309 5 :KVHQI 1hyuA 20 :PVELI T0309 20 :MEVTEQTKEA 1hyuA 25 :ATLDDSAKSA T0309 34 :DFKEILSEFNGKNVSITVKEENELPV 1hyuA 35 :EIKELLAEIAELSDKVTFKEDNTLPV T0309 60 :KGVEMAGDPLEHH 1hyuA 74 :QGPRFAGSPLGHE Number of specific fragments extracted= 4 number of extra gaps= 0 total=203 Number of alignments=68 # 1hyuA read from 1hyuA/merged-good-all-a2m # found chain 1hyuA in template set T0309 5 :KVHQI 1hyuA 20 :PVELI T0309 20 :MEVTEQTKEA 1hyuA 25 :ATLDDSAKSA T0309 34 :DFKEILSEFNGKNVSITVKEENELPV 1hyuA 35 :EIKELLAEIAELSDKVTFKEDNTLPV T0309 60 :KGVEMAGDPLEHH 1hyuA 74 :QGPRFAGSPLGHE Number of specific fragments extracted= 4 number of extra gaps= 0 total=207 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bg5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bg5A expands to /projects/compbio/data/pdb/2bg5.pdb.gz 2bg5A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0309 read from 2bg5A/merged-good-all-a2m # 2bg5A read from 2bg5A/merged-good-all-a2m # adding 2bg5A to template set # found chain 2bg5A in template set T0309 20 :MEVTEQTKEAEYTYDFKEILSEFNGKNVSITV 2bg5A 302 :MDRNSLPSEEEQFEAYKEVVEKMGGRPVTIRT T0309 52 :KEENELPVKGVEMAGDPLEHHHH 2bg5A 335 :DIGGDKELPYLDMPKEMNPFLGY Number of specific fragments extracted= 2 number of extra gaps= 0 total=209 Number of alignments=70 # 2bg5A read from 2bg5A/merged-good-all-a2m # found chain 2bg5A in template set T0309 20 :MEVTEQTKEAEYTYDFKEILSEFNGKNVSITV 2bg5A 302 :MDRNSLPSEEEQFEAYKEVVEKMGGRPVTIRT T0309 52 :KEENELPVKGVEMAGDPLEHHHH 2bg5A 335 :DIGGDKELPYLDMPKEMNPFLGY Number of specific fragments extracted= 2 number of extra gaps= 0 total=211 Number of alignments=71 # 2bg5A read from 2bg5A/merged-good-all-a2m # found chain 2bg5A in template set T0309 20 :MEVTEQTKEAEYTYDFKEILSEFNGKNVSITV 2bg5A 302 :MDRNSLPSEEEQFEAYKEVVEKMGGRPVTIRT T0309 52 :KEENELPVKGVEMAGDPLEHHHH 2bg5A 335 :DIGGDKELPYLDMPKEMNPFLGY Number of specific fragments extracted= 2 number of extra gaps= 0 total=213 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1souA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1souA expands to /projects/compbio/data/pdb/1sou.pdb.gz 1souA:# T0309 read from 1souA/merged-good-all-a2m # 1souA read from 1souA/merged-good-all-a2m # adding 1souA to template set # found chain 1souA in template set T0309 33 :YDFKEILSEFNG 1souA 134 :GYYDRLLKRVKG T0309 45 :KNVSITVKEENELPVK 1souA 167 :IPVDVLVTEKNVRRLR T0309 65 :AGDPLEHHHHHH 1souA 183 :DGRSLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=216 Number of alignments=73 # 1souA read from 1souA/merged-good-all-a2m # found chain 1souA in template set T0309 33 :YDFKEILSEFNG 1souA 134 :GYYDRLLKRVKG T0309 45 :KNVSITVKEENELPVK 1souA 167 :IPVDVLVTEKNVRRLR T0309 65 :AGDPLEHHHHHH 1souA 183 :DGRSLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=219 Number of alignments=74 # 1souA read from 1souA/merged-good-all-a2m # found chain 1souA in template set T0309 34 :DFKEILSEFNG 1souA 135 :YYDRLLKRVKG T0309 45 :KNVSITVKEENELPVK 1souA 167 :IPVDVLVTEKNVRRLR T0309 65 :AGDPLEHHHHHH 1souA 183 :DGRSLEHHHHHH Number of specific fragments extracted= 3 number of extra gaps= 0 total=222 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1esfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1esfA expands to /projects/compbio/data/pdb/1esf.pdb.gz 1esfA:# T0309 read from 1esfA/merged-good-all-a2m # 1esfA read from 1esfA/merged-good-all-a2m # adding 1esfA to template set # found chain 1esfA in template set Warning: unaligning (T0309)D16 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1esfA)Y64 Warning: unaligning (T0309)T26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1esfA)Y64 T0309 7 :HQINVKGFF 1esfA 50 :HTILFKGFF T0309 27 :KEAEYTYDFKEILSEFNGKNVSITV 1esfA 65 :NDLLVDFDSKDIVDKYKGKKVDLYG Number of specific fragments extracted= 2 number of extra gaps= 0 total=224 Number of alignments=76 # 1esfA read from 1esfA/merged-good-all-a2m # found chain 1esfA in template set Warning: unaligning (T0309)D16 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1esfA)Y64 Warning: unaligning (T0309)T26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1esfA)Y64 T0309 7 :HQINVKGFF 1esfA 50 :HTILFKGFF T0309 27 :KEAEYTYDFKEILSEFNGKNVSITV 1esfA 65 :NDLLVDFDSKDIVDKYKGKKVDLYG Number of specific fragments extracted= 2 number of extra gaps= 0 total=226 Number of alignments=77 # 1esfA read from 1esfA/merged-good-all-a2m # found chain 1esfA in template set Warning: unaligning (T0309)D16 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1esfA)Y64 Warning: unaligning (T0309)T26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1esfA)Y64 T0309 7 :HQINVKGFF 1esfA 50 :HTILFKGFF T0309 27 :KEAEYTYDFKEILSEFNGKNVSITV 1esfA 65 :NDLLVDFDSKDIVDKYKGKKVDLYG Number of specific fragments extracted= 2 number of extra gaps= 0 total=228 Number of alignments=78 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0309//projects/compbio/experiments/protein-predict/casp7/T0309/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0309//projects/compbio/experiments/protein-predict/casp7/T0309/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0309/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0309/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0309)K12.CB, (T0309)K52.CB) [> 3.2179 = 5.3632 < 6.9722] w=1.0000 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)K52.CB) [> 4.2688 = 7.1147 < 9.2491] w=1.0000 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)V51.CB) [> 2.8552 = 4.7586 < 6.1862] w=1.0000 to align # Constraint # added constraint: constraint((T0309)M20.CB, (T0309)F35.CB) [> 4.1672 = 6.9453 < 9.0288] w=0.7965 to align # Constraint # added constraint: constraint((T0309)F42.CB, (T0309)V51.CB) [> 4.2005 = 7.0008 < 9.1011] w=0.7815 to align # Constraint # added constraint: constraint((T0309)K12.CB, (T0309)V51.CB) [> 4.1521 = 6.9201 < 8.9961] w=0.7759 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)F35.CB) [> 4.3487 = 7.2478 < 9.4221] w=0.7424 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)E54.CB) [> 4.0901 = 6.8168 < 8.8619] w=0.7074 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)E53.CB) [> 3.8160 = 6.3600 < 8.2680] w=0.7074 to align # Constraint # added constraint: constraint((T0309)I38.CB, (T0309)V47.CB) [> 3.5358 = 5.8930 < 7.6609] w=0.6887 to align # Constraint # added constraint: constraint((T0309)F35.CB, (T0309)I49.CB) [> 3.7740 = 6.2900 < 8.1770] w=0.6887 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)F35.CB) [> 4.1214 = 6.8691 < 8.9298] w=0.6631 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)V51.CB) [> 3.6188 = 6.0313 < 7.8407] w=0.6631 to align # Constraint # added constraint: constraint((T0309)T23.CB, (T0309)N55.CB) [> 4.2704 = 7.1173 < 9.2525] w=0.6443 to align # Constraint # added constraint: constraint((T0309)V22.CB, (T0309)N55.CB) [> 3.3923 = 5.6539 < 7.3501] w=0.6443 to align # Constraint # added constraint: constraint((T0309)E21.CB, (T0309)T32.CB) [> 3.9076 = 6.5127 < 8.4664] w=0.6330 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)T32.CB) [> 3.2277 = 5.3795 < 6.9934] w=0.6330 to align # Constraint # added constraint: constraint((T0309)H7.CB, (T0309)I49.CB) [> 3.9671 = 6.6119 < 8.5955] w=0.6053 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)S48.CB) [> 4.4425 = 7.4041 < 9.6254] w=0.5893 to align # Constraint # added constraint: constraint((T0309)N10.CB, (T0309)V19.CB) [> 3.5585 = 5.9308 < 7.7100] w=0.5645 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)Y31.CB) [> 3.6654 = 6.1090 < 7.9417] w=0.5610 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)L57.CB) [> 3.6000 = 6.0000 < 7.8000] w=0.5610 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)T50.CB) [> 4.5451 = 7.5751 < 9.8476] w=0.5610 to align # Constraint # added constraint: constraint((T0309)N10.CB, (T0309)V51.CB) [> 4.2290 = 7.0483 < 9.1628] w=0.5610 to align # Constraint # added constraint: constraint((T0309)N10.CB, (T0309)T50.CB) [> 3.2184 = 5.3640 < 6.9732] w=0.5610 to align # Constraint # added constraint: constraint((T0309)N10.CB, (T0309)I49.CB) [> 4.1265 = 6.8776 < 8.9408] w=0.5610 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)I49.CB) [> 3.2785 = 5.4641 < 7.1034] w=0.5610 to align # Constraint # added constraint: constraint((T0309)Q8.CB, (T0309)T26.CB) [> 2.8984 = 4.8306 < 6.2798] w=0.5578 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)E24.CB) [> 4.0835 = 6.8059 < 8.8476] w=0.5578 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)Q25.CB) [> 3.2154 = 5.3590 < 6.9667] w=0.5578 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)T26.CB) [> 4.3882 = 7.3136 < 9.5077] w=0.5578 to align # Constraint # added constraint: constraint((T0309)N10.CB, (T0309)T23.CB) [> 3.8822 = 6.4704 < 8.4115] w=0.5578 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)V22.CB) [> 3.9648 = 6.6081 < 8.5905] w=0.5578 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)T23.CB) [> 3.4146 = 5.6910 < 7.3982] w=0.5578 to align # Constraint # added constraint: constraint((T0309)K12.CB, (T0309)E21.CB) [> 4.0589 = 6.7648 < 8.7943] w=0.5578 to align # Constraint # added constraint: constraint((T0309)Q8.CB, (T0309)L39.CB) [> 3.5087 = 5.8479 < 7.6022] w=0.5543 to align # Constraint # added constraint: constraint((T0309)L39.CB, (T0309)I49.CB) [> 4.3412 = 7.2353 < 9.4059] w=0.5412 to align # Constraint # added constraint: constraint((T0309)D18.CB, (T0309)F35.CB) [> 3.9674 = 6.6123 < 8.5960] w=0.5282 to align # Constraint # added constraint: constraint((T0309)I49.CB, (T0309)V59.CB) [> 3.6031 = 6.0051 < 7.8067] w=0.5272 to align # Constraint # added constraint: constraint((T0309)I49.CB, (T0309)P58.CB) [> 3.9693 = 6.6155 < 8.6002] w=0.5272 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)Y31.CB) [> 4.3292 = 7.2153 < 9.3799] w=0.5135 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)M20.CB) [> 3.4948 = 5.8246 < 7.5721] w=0.4959 to align # Constraint # added constraint: constraint((T0309)F35.CB, (T0309)G66.CA) [> 3.8608 = 6.4347 < 8.3652] w=0.4924 to align # Constraint # added constraint: constraint((T0309)F35.CB, (T0309)D67.CB) [> 4.5148 = 7.5247 < 9.7821] w=0.4924 to align # Constraint # added constraint: constraint((T0309)I38.CB, (T0309)P68.CB) [> 4.4863 = 7.4772 < 9.7204] w=0.4924 to align # Constraint # added constraint: constraint((T0309)I38.CB, (T0309)L69.CB) [> 4.4998 = 7.4997 < 9.7496] w=0.4924 to align # Constraint # added constraint: constraint((T0309)L39.CB, (T0309)V51.CB) [> 2.6694 = 4.4489 < 5.7836] w=0.4924 to align # Constraint # added constraint: constraint((T0309)Y31.CB, (T0309)V51.CB) [> 4.4454 = 7.4090 < 9.6317] w=0.4706 to align # Constraint # added constraint: constraint((T0309)E21.CB, (T0309)V59.CB) [> 3.2811 = 5.4685 < 7.1090] w=0.4596 to align # Constraint # added constraint: constraint((T0309)E21.CB, (T0309)L57.CB) [> 3.3475 = 5.5792 < 7.2530] w=0.4530 to align # Constraint # added constraint: constraint((T0309)E21.CB, (T0309)E56.CB) [> 4.0968 = 6.8280 < 8.8763] w=0.4530 to align # Constraint # added constraint: constraint((T0309)E21.CB, (T0309)N55.CB) [> 3.6804 = 6.1340 < 7.9743] w=0.4530 to align # Constraint # added constraint: constraint((T0309)D18.CB, (T0309)Y31.CB) [> 3.6178 = 6.0297 < 7.8386] w=0.4418 to align # Constraint # added constraint: constraint((T0309)D18.CB, (T0309)T32.CB) [> 3.8593 = 6.4321 < 8.3618] w=0.4418 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)Y31.CB) [> 4.2287 = 7.0478 < 9.1621] w=0.4418 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)Q25.CB) [> 3.4814 = 5.8024 < 7.5431] w=0.4390 to align # Constraint # added constraint: constraint((T0309)N10.CB, (T0309)V22.CB) [> 3.3039 = 5.5064 < 7.1584] w=0.4390 to align # Constraint # added constraint: constraint((T0309)I9.CB, (T0309)V59.CB) [> 3.9796 = 6.6327 < 8.6225] w=0.4390 to align # Constraint # added constraint: constraint((T0309)V6.CB, (T0309)K60.CB) [> 4.5851 = 7.6419 < 9.9345] w=0.4390 to align # Constraint # added constraint: constraint((T0309)V6.CB, (T0309)V59.CB) [> 3.6477 = 6.0795 < 7.9034] w=0.4390 to align # Constraint # added constraint: constraint((T0309)K4.CB, (T0309)G61.CA) [> 4.2038 = 7.0063 < 9.1081] w=0.4390 to align # Constraint # added constraint: constraint((T0309)K4.CB, (T0309)K60.CB) [> 4.7291 = 7.8818 < 10.2463] w=0.4390 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)V22.CB) [> 4.2846 = 7.1411 < 9.2834] w=0.4390 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)I49.CB) [> 4.0881 = 6.8134 < 8.8575] w=0.4390 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)T50.CB) [> 4.1151 = 6.8586 < 8.9161] w=0.4390 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)I49.CB) [> 4.1228 = 6.8713 < 8.9327] w=0.4390 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)T50.CB) [> 2.8114 = 4.6856 < 6.0914] w=0.4390 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)V51.CB) [> 4.2236 = 7.0393 < 9.1510] w=0.4390 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)V47.CB) [> 3.0300 = 5.0500 < 6.5650] w=0.4390 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)I49.CB) [> 3.6348 = 6.0580 < 7.8755] w=0.4390 to align # Constraint # added constraint: constraint((T0309)D16.CB, (T0309)V47.CB) [> 3.5601 = 5.9335 < 7.7135] w=0.4390 to align # Constraint # added constraint: constraint((T0309)M17.CB, (T0309)T50.CB) [> 4.5684 = 7.6140 < 9.8982] w=0.4390 to align # Constraint # added constraint: constraint((T0309)M20.CB, (T0309)T32.CB) [> 4.2425 = 7.0709 < 9.1922] w=0.4188 to align # Constraint # added constraint: constraint((T0309)F35.CB, (T0309)V47.CB) [> 4.1107 = 6.8512 < 8.9066] w=0.4136 to align # Constraint # added constraint: constraint((T0309)V47.CB, (T0309)V59.CB) [> 3.8989 = 6.4981 < 8.4476] w=0.4085 to align # Constraint # added constraint: constraint((T0309)V22.CB, (T0309)L57.CB) [> 3.8866 = 6.4777 < 8.4210] w=0.3759 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)M20.CB) [> 4.1793 = 6.9655 < 9.0552] w=0.3463 to align # Constraint # added constraint: constraint((T0309)V6.CB, (T0309)V47.CB) [> 4.2943 = 7.1572 < 9.3043] w=0.3369 to align # Constraint # added constraint: constraint((T0309)V6.CB, (T0309)N46.CB) [> 2.6996 = 4.4994 < 5.8492] w=0.3369 to align # Constraint # added constraint: constraint((T0309)V6.CB, (T0309)K45.CB) [> 4.1269 = 6.8783 < 8.9417] w=0.3369 to align # Constraint # added constraint: constraint((T0309)V6.CB, (T0309)G44.CA) [> 3.7063 = 6.1772 < 8.0304] w=0.3369 to align # Constraint # added constraint: constraint((T0309)V6.CB, (T0309)L39.CB) [> 3.1196 = 5.1994 < 6.7592] w=0.3369 to align # Constraint # added constraint: constraint((T0309)K5.CB, (T0309)N46.CB) [> 4.6880 = 7.8133 < 10.1573] w=0.3369 to align # Constraint # added constraint: constraint((T0309)K5.CB, (T0309)K45.CB) [> 2.9097 = 4.8495 < 6.3043] w=0.3369 to align # Constraint # added constraint: constraint((T0309)S3.CB, (T0309)G44.CA) [> 3.0290 = 5.0484 < 6.5629] w=0.3369 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)M64.CB) [> 4.2070 = 7.0116 < 9.1151] w=0.3369 to align # Constraint # added constraint: constraint((T0309)M17.CB, (T0309)D34.CB) [> 3.5711 = 5.9519 < 7.7375] w=0.3369 to align # Constraint # added constraint: constraint((T0309)D16.CB, (T0309)G66.CA) [> 3.8670 = 6.4451 < 8.3786] w=0.3369 to align # Constraint # added constraint: constraint((T0309)D16.CB, (T0309)A65.CB) [> 3.9401 = 6.5669 < 8.5369] w=0.3369 to align # Constraint # added constraint: constraint((T0309)D16.CB, (T0309)M64.CB) [> 2.2113 = 3.6854 < 4.7910] w=0.3369 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)A65.CB) [> 2.8788 = 4.7979 < 6.2373] w=0.3369 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)M64.CB) [> 4.0592 = 6.7654 < 8.7950] w=0.3369 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)A65.CB) [> 3.9351 = 6.5586 < 8.5262] w=0.3369 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)M64.CB) [> 3.3034 = 5.5057 < 7.1573] w=0.3369 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)A65.CB) [> 2.8498 = 4.7497 < 6.1746] w=0.3369 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)M64.CB) [> 3.3530 = 5.5884 < 7.2649] w=0.3369 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)L57.CB) [> 4.5397 = 7.5661 < 9.8359] w=0.3369 to align # Constraint # added constraint: constraint((T0309)T50.CB, (T0309)V59.CB) [> 3.6158 = 6.0264 < 7.8343] w=0.3129 to align # Constraint # added constraint: constraint((T0309)K27.CB, (T0309)E41.CB) [> 4.6700 = 7.7833 < 10.1183] w=0.2891 to align # Constraint # added constraint: constraint((T0309)A29.CB, (T0309)I38.CB) [> 3.0212 = 5.0354 < 6.5460] w=0.2891 to align # Constraint # added constraint: constraint((T0309)H7.CB, (T0309)Y33.CB) [> 2.6352 = 4.3920 < 5.7096] w=0.2859 to align # Constraint # added constraint: constraint((T0309)A29.CB, (T0309)I49.CB) [> 4.7689 = 7.9481 < 10.3326] w=0.2859 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)A29.CB) [> 4.0706 = 6.7843 < 8.8196] w=0.2859 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)K27.CB) [> 3.1741 = 5.2902 < 6.8773] w=0.2859 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)A29.CB) [> 2.2754 = 3.7924 < 4.9301] w=0.2859 to align # Constraint # added constraint: constraint((T0309)G13.CA, (T0309)A29.CB) [> 4.6416 = 7.7361 < 10.0569] w=0.2859 to align # Constraint # added constraint: constraint((T0309)V11.CB, (T0309)E30.CB) [> 4.5961 = 7.6601 < 9.9581] w=0.2859 to align # Constraint # added constraint: constraint((T0309)E53.CB, (T0309)L69.CB) [> 4.7736 = 7.9559 < 10.3427] w=0.2792 to align # Constraint # added constraint: constraint((T0309)K5.CB, (T0309)S48.CB) [> 3.0557 = 5.0928 < 6.6206] w=0.2684 to align # Constraint # added constraint: constraint((T0309)H7.CB, (T0309)V51.CB) [> 4.6577 = 7.7629 < 10.0917] w=0.2684 to align # Constraint # added constraint: constraint((T0309)K36.CB, (T0309)V62.CB) [> 3.5598 = 5.9329 < 7.7128] w=0.2538 to align # Constraint # added constraint: constraint((T0309)G44.CA, (T0309)V62.CB) [> 4.2206 = 7.0344 < 9.1447] w=0.2538 to align # Constraint # added constraint: constraint((T0309)Y33.CB, (T0309)F42.CB) [> 4.7376 = 7.8960 < 10.2648] w=0.2522 to align # Constraint # added constraint: constraint((T0309)F14.CB, (T0309)E54.CB) [> 3.7350 = 6.2250 < 8.0925] w=0.2241 to align # Constraint # added constraint: constraint((T0309)M17.CB, (T0309)T32.CB) [> 3.9655 = 6.6092 < 8.5920] w=0.2241 to align # Constraint # added constraint: constraint((T0309)F42.CB, (T0309)A65.CB) [> 3.2132 = 5.3554 < 6.9620] w=0.2142 to align # Constraint # added constraint: constraint((T0309)K45.CB, (T0309)G61.CA) [> 3.4535 = 5.7558 < 7.4826] w=0.2142 to align # Constraint # added constraint: constraint((T0309)S48.CB, (T0309)V59.CB) [> 3.5904 = 5.9840 < 7.7791] w=0.1941 to align # Constraint # added constraint: constraint((T0309)S48.CB, (T0309)K60.CB) [> 3.8115 = 6.3526 < 8.2583] w=0.1941 to align # Constraint # added constraint: constraint((T0309)I49.CB, (T0309)K60.CB) [> 4.1971 = 6.9951 < 9.0936] w=0.1941 to align # Constraint # added constraint: constraint((T0309)M20.CB, (T0309)G61.CA) [> 4.0498 = 6.7497 < 8.7746] w=0.1912 to align # Constraint # added constraint: constraint((T0309)M20.CB, (T0309)K60.CB) [> 3.1540 = 5.2567 < 6.8337] w=0.1912 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)G61.CA) [> 3.2131 = 5.3552 < 6.9618] w=0.1912 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)K60.CB) [> 4.2398 = 7.0664 < 9.1863] w=0.1912 to align # Constraint # added constraint: constraint((T0309)D18.CB, (T0309)G61.CA) [> 4.6352 = 7.7253 < 10.0429] w=0.1912 to align # Constraint # added constraint: constraint((T0309)M17.CB, (T0309)V62.CB) [> 3.8472 = 6.4121 < 8.3357] w=0.1912 to align # Constraint # added constraint: constraint((T0309)M17.CB, (T0309)G61.CA) [> 4.5647 = 7.6078 < 9.8902] w=0.1912 to align # Constraint # added constraint: constraint((T0309)M17.CB, (T0309)K60.CB) [> 3.0408 = 5.0680 < 6.5884] w=0.1912 to align # Constraint # added constraint: constraint((T0309)D16.CB, (T0309)V62.CB) [> 3.8510 = 6.4184 < 8.3439] w=0.1912 to align # Constraint # added constraint: constraint((T0309)D16.CB, (T0309)G61.CA) [> 4.2271 = 7.0452 < 9.1587] w=0.1912 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)E63.CB) [> 3.8613 = 6.4355 < 8.3661] w=0.1912 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)V62.CB) [> 3.2724 = 5.4539 < 7.0901] w=0.1912 to align # Constraint # added constraint: constraint((T0309)F15.CB, (T0309)G61.CA) [> 3.0126 = 5.0211 < 6.5274] w=0.1912 to align # Constraint # added constraint: constraint((T0309)I38.CB, (T0309)P58.CB) [> 4.3751 = 7.2918 < 9.4794] w=0.1912 to align # Constraint # added constraint: constraint((T0309)Y33.CB, (T0309)P58.CB) [> 4.2478 = 7.0798 < 9.2037] w=0.1912 to align # Constraint # added constraint: constraint((T0309)V22.CB, (T0309)Y33.CB) [> 4.5935 = 7.6558 < 9.9526] w=0.1912 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)V62.CB) [> 3.6393 = 6.0654 < 7.8850] w=0.1847 to align # Constraint # added constraint: constraint((T0309)V19.CB, (T0309)L57.CB) [> 4.0705 = 6.7842 < 8.8194] w=0.1847 to align # Constraint # added constraint: constraint((T0309)D18.CB, (T0309)V62.CB) [> 3.3890 = 5.6483 < 7.3427] w=0.1847 to align # Constraint # added constraint: constraint((T0309)D18.CB, (T0309)P58.CB) [> 4.0943 = 6.8238 < 8.8709] w=0.1847 to align # Constraint # added constraint: constraint((T0309)T23.CB, (T0309)K60.CB) [> 4.2511 = 7.0852 < 9.2107] w=0.1344 to align # Constraint # added constraint: constraint((T0309)V22.CB, (T0309)F42.CB) [> 3.4374 = 5.7290 < 7.4477] w=0.1188 to align # Constraint # added constraint: constraint((T0309)K12.CB, (T0309)E63.CB) [> 3.4793 = 5.7989 < 7.5385] w=0.1123 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0309/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0309/decoys/ # ReadConformPDB reading from PDB file chimera1.pdb.gz looking for model 1 # Found a chain break before 66 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file chimera2.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file chimera3.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file chimera4.pdb.gz looking for model 1 # Found a chain break before 73 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # Found a chain break before 63 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # Found a chain break before 57 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # Found a chain break before 63 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # Found a chain break before 59 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # Found a chain break before 57 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # Found a chain break before 65 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # Found a chain break before 65 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 36 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 8 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 50 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 55 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 36 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 50 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 71 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 50 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 74 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 35 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 35 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 35 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 35 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 35 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 68 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # Found a chain break before 68 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0309)A29.C and (T0309)E30.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.CA only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.CA only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E30.CB only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.CB only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.CB only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E30.CG only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E30.CG only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.CG only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.CG only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E30.CD only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E30.CD only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E30.CD only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.CD only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.CD only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E30.OE1 only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E30.OE1 only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E30.OE1 only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E30.OE1 only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.OE1 only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.OE1 only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E30.OE2 only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E30.OE2 only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E30.OE2 only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E30.OE2 only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E30.OE2 only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.OE2 only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.OE2 only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.O only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E30.C only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CA only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CB only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CG only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CD1 only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CD2 only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CE1 only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CE2 only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.CZ only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.OH only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.O only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y31.C only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)T32.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)E30.C and (T0309)T32.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)T32.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)T32.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)T32.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)T32.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)T32.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)T32.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)T32.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)T32.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)T32.N only 0.000 apart, marking (T0309)T32.N as missing WARNING: atoms too close: (T0309)T32.N and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)T32.CA only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.N and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)T32.CB only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)T32.CG2 only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)T32.OG1 only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.N and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)T32.O only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.O and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.N and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)T32.C only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.N only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.N only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.N only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.N only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.N only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.N only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.N only 0.000 apart, marking (T0309)T32.N as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.N only 0.000 apart, marking (T0309)Y33.N as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CA only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CB only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CG only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CD1 only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CD2 only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CE1 only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CE2 only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.CZ only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.OH only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.O only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)T32.C and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)T32.N and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)Y33.C only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.N only 0.000 apart, marking (T0309)Y33.N as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.N only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.N only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.N only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.N only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.N only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.N only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.N only 0.000 apart, marking (T0309)T32.N as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.N only 0.000 apart, marking (T0309)D34.N as missing WARNING: atoms too close: (T0309)D34.N and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.CA only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)D34.N and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.CB only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)D34.N and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.CG only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.OD1 only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.OD2 only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.N and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.O only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.O and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.N and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)T32.C and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)T32.N and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)D34.C only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.N only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.N only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.N only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.N only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.N only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.N only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.N only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.N only 0.000 apart, marking (T0309)D34.N as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.N only 0.000 apart, marking (T0309)Y33.N as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.N only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.N only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.N only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.N only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.N only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.N only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.N only 0.000 apart, marking (T0309)T32.N as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.N only 0.000 apart, marking (T0309)F35.N as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CA only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CB only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CG only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CD1 only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CD2 only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CE1 only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CE2 only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.CZ only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.O only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.O and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.N and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.C and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)D34.N and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)T32.C and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)T32.N and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)F35.C only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.N only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.N only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.N only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.N only 0.000 apart, marking (T0309)F35.N as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.N only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.N only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.N only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.N only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.N only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.N only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.N only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.N only 0.000 apart, marking (T0309)D34.N as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.N only 0.000 apart, marking (T0309)Y33.N as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.N only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.N only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.N only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.N only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.N only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.N only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.N only 0.000 apart, marking (T0309)T32.N as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.N only 0.000 apart, marking (T0309)K36.N as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.CA only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.CB only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.CG only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.CD only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.CE only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.NZ only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.O only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.O and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.N and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.C and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.O and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)F35.N and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.C and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)D34.N and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)T32.C and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)T32.N and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)K36.C only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.N only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.N only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.N only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.N only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.N only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.N only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.N only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.N only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.N only 0.000 apart, marking (T0309)K36.N as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.N only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.N only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.N only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.N only 0.000 apart, marking (T0309)F35.N as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.N only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.N only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.N only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.N only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.N only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.N only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.N only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.N only 0.000 apart, marking (T0309)D34.N as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.N only 0.000 apart, marking (T0309)Y33.N as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.N only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.N only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.N only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.N only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.N only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.N only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.N only 0.000 apart, marking (T0309)T32.N as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.N only 0.000 apart, marking (T0309)E37.N as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.CA only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.CB only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.CG only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.CD only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.OE1 only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.OE2 only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.O only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)K36.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)F35.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)D34.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)T32.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)T32.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)E37.C only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.N only 0.000 apart, marking (T0309)E37.C as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.N only 0.000 apart, marking (T0309)E37.O as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.N only 0.000 apart, marking (T0309)E37.OE2 as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.N only 0.000 apart, marking (T0309)E37.OE1 as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.N only 0.000 apart, marking (T0309)E37.CD as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.N only 0.000 apart, marking (T0309)E37.CG as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.N only 0.000 apart, marking (T0309)E37.CB as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.N only 0.000 apart, marking (T0309)E37.CA as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.N only 0.000 apart, marking (T0309)E37.N as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.N only 0.000 apart, marking (T0309)K36.C as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.N only 0.000 apart, marking (T0309)K36.O as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.N only 0.000 apart, marking (T0309)K36.NZ as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.N only 0.000 apart, marking (T0309)K36.CE as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.N only 0.000 apart, marking (T0309)K36.CD as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.N only 0.000 apart, marking (T0309)K36.CG as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.N only 0.000 apart, marking (T0309)K36.CB as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.N only 0.000 apart, marking (T0309)K36.CA as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.N only 0.000 apart, marking (T0309)K36.N as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.N only 0.000 apart, marking (T0309)F35.C as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.N only 0.000 apart, marking (T0309)F35.O as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CZ as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CE2 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CE1 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CD2 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CD1 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CG as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CB as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.N only 0.000 apart, marking (T0309)F35.CA as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.N only 0.000 apart, marking (T0309)F35.N as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.N only 0.000 apart, marking (T0309)D34.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.N only 0.000 apart, marking (T0309)D34.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.N only 0.000 apart, marking (T0309)D34.OD2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.N only 0.000 apart, marking (T0309)D34.OD1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.N only 0.000 apart, marking (T0309)D34.CG as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.N only 0.000 apart, marking (T0309)D34.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.N only 0.000 apart, marking (T0309)D34.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.N only 0.000 apart, marking (T0309)D34.N as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.OH as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CZ as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CE2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CE1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CD2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CG as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.N only 0.000 apart, marking (T0309)Y33.N as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.N only 0.000 apart, marking (T0309)T32.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.N only 0.000 apart, marking (T0309)T32.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.N only 0.000 apart, marking (T0309)T32.OG1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.N only 0.000 apart, marking (T0309)T32.CG2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.N only 0.000 apart, marking (T0309)T32.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.N only 0.000 apart, marking (T0309)T32.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.N only 0.000 apart, marking (T0309)T32.N as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.OH as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CZ as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CE2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CE1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CD2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CG as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.N only 0.000 apart, marking (T0309)Y31.N as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.N only 0.000 apart, marking (T0309)E30.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.N only 0.000 apart, marking (T0309)E30.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.N only 0.000 apart, marking (T0309)E30.OE2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.N only 0.000 apart, marking (T0309)E30.OE1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.N only 0.000 apart, marking (T0309)E30.CD as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.N only 0.000 apart, marking (T0309)E30.CG as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.N only 0.000 apart, marking (T0309)E30.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.N only 0.000 apart, marking (T0309)E30.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.N only 0.000 apart, marking (T0309)E30.N as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.N only 0.000 apart, marking (T0309)I38.N as missing WARNING: atoms too close: (T0309)I38.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.CA only 0.000 apart, marking (T0309)I38.CA as missing WARNING: atoms too close: (T0309)I38.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)I38.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.CB only 0.000 apart, marking (T0309)I38.CB as missing WARNING: atoms too close: (T0309)I38.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)I38.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)I38.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.CG1 only 0.000 apart, marking (T0309)I38.CG1 as missing WARNING: atoms too close: (T0309)I38.CG1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)I38.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)I38.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)I38.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.CG2 only 0.000 apart, marking (T0309)I38.CG2 as missing WARNING: atoms too close: (T0309)I38.CG2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)I38.CG1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)I38.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)I38.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)I38.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.CD1 only 0.000 apart, marking (T0309)I38.CD1 as missing WARNING: atoms too close: (T0309)I38.CD1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)I38.CG2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)I38.CG1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)I38.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)I38.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)I38.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.O only 0.000 apart, marking (T0309)I38.O as missing WARNING: atoms too close: (T0309)I38.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)I38.CD1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)I38.CG2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)I38.CG1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)I38.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)I38.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)I38.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.OE2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.OE1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.CD and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.CG and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E37.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.NZ and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.CE and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.CD and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.CG and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)K36.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CZ and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CE2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CE1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CD2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CD1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CG and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)F35.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.OD2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.OD1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.CG and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)D34.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.OH and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CZ and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CE2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CE1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CD2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CD1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CG and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y33.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)T32.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)T32.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)T32.OG1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)T32.CG2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)T32.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)T32.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)T32.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.OH and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CZ and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CE2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CE1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CD2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CD1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CG and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)Y31.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.O and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.OE2 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.OE1 and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.CD and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.CG and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.CB and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.CA and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)E30.N and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing WARNING: atoms too close: (T0309)A29.C and (T0309)I38.C only 0.000 apart, marking (T0309)I38.C as missing # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # Found a chain break before 58 # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # Found a chain break before 64 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # Found a chain break before 68 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 74 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # Found a chain break before 68 # copying to AlignedFragments data structure # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 64 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 17 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 63 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 40 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 41 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 17 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 52 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 45 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 57 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # Found a chain break before 21 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # Found a chain break before 45 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 69 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 64 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 66 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 13 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # Found a chain break before 64 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # Found a chain break before 49 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # Found a chain break before 31 # copying to AlignedFragments data structure # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 55 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 14 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 74 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # Found a chain break before 31 # copying to AlignedFragments data structure # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS1.pdb.gz looking for model 1 # Found a chain break before 70 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS2.pdb.gz looking for model 1 # Found a chain break before 33 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS2 # ReadConformPDB reading from PDB file servers/POMYSL_TS3.pdb.gz looking for model 1 # Found a chain break before 23 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS3 # ReadConformPDB reading from PDB file servers/POMYSL_TS4.pdb.gz looking for model 1 # Found a chain break before 15 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS4 # ReadConformPDB reading from PDB file servers/POMYSL_TS5.pdb.gz looking for model 1 # naming current conformation POMYSL_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # Found a chain break before 70 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # Found a chain break before 70 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # Found a chain break before 68 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 21 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 27 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 69 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 74 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 27 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 54 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 34 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 74 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 58 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 32 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 58 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 8 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 71 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 68 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 73 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 74 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 61 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 33 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 # Found a chain break before 73 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 # Found a chain break before 73 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 # Found a chain break before 71 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 # Found a chain break before 73 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # Found a chain break before 54 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # Found a chain break before 67 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # Found a chain break before 73 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/panther2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation panther2_TS1 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0309 can't currently be optimized by undertaker # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score 1.1125 model score 1.2285 model score 1.2291 model score 1.1410 model score 1.9640 model score 1.7621 model score 2.1667 model score 2.2024 model score 1.6382 model score 1.3917 model score 1.5938 model score 1.6116 model score 1.5035 model score 1.5035 model score 2.1984 model score 1.6128 model score 2.2486 model score 1.3519 model score 1.2868 model score 1.1350 model score 1.5553 model score 1.4382 model score 1.0532 model score 1.4480 model score 1.1350 model score 1.4382 model score 1.0525 model score 1.0229 model score 1.1718 model score 1.6088 model score 1.6893 model score 1.6962 model score 1.5695 model score 1.7012 model score 1.7095 model score 1.6540 model score 1.6386 model score 1.5652 model score 1.6587 model score 2.1122 model score 1.5478 model score 1.9268 model score 1.7902 model score 1.3411 model score 2.2379 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.6509 model score 1.4052 model score 1.7148 model score 1.3965 model score 2.3661 model score 1.4949 model score 1.6386 model score 1.6587 model score 1.6540 model score 1.6974 model score 1.3992 model score 1.6197 model score 1.3992 model score 1.7151 model score 1.4742 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.9647 model score 1.5938 model score 2.0220 model score 1.9216 model score 2.0737 model score 2.3857 model score 1.6661 model score 1.9844 model score 1.4617 model score 2.0961 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.6307 model score 2.3145 model score 1.6299 model score 1.6974 model score 1.3319 model score 1.9153 model score 1.9352 model score 1.5350 model score 1.5390 model score 1.7491 model score 3.1648 model score 3.1648 model score 3.1648 model score 1.4443 model score 1.5737 model score 1.2995 model score 1.2626 model score 1.6168 model score 1.4864 model score 1.3714 model score 1.4584 model score 1.6061 model score 1.7275 model score 1.6705 model score 2.4959 model score 1.5467 model score 1.9319 model score 1.3975 model score 1.4661 model score 1.5276 model score 1.5841 model score 1.4243 model score 1.5997 model score 1.4864 model score 1.8442 model score 2.0211 model score 1.6646 model score 2.3295 model score 1.7210 model score 1.2886 model score 1.2595 model score 1.3623 model score 1.3674 model score 1.4049 model score 0.8493 model score 1.3623 model score 1.3442 model score 1.2903 model score 1.2886 model score 1.4941 model score 1.4941 model score 1.4941 model score 1.5143 model score 1.7476 model score 1.5424 model score 1.5597 model score 1.4749 model score 1.4792 model score 1.4176 model score 1.5245 model score 1.0488 model score 1.7476 model score 1.9242 model score 1.4475 model score 1.5143 model score 1.7294 model score 1.5281 model score 1.6385 model score 1.5967 model score 1.7655 model score 1.6353 model score 1.6527 model score 1.5466 model score 1.2226 model score 1.4414 model score 1.6150 model score 1.6320 model score 1.4932 model score 1.5752 model score 1.2339 model score 1.5818 model score 1.7207 model score 1.6384 model score 1.7887 model score 1.5638 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.7096 model score 2.2016 model score 1.8929 model score 1.2063 model score 1.3426 model score 1.4747 model score 1.4607 model score 1.3837 model score 1.7843 model score 1.7655 model score 1.4359 model score 2.0795 model score 1.7309 model score 1.9098 model score 1.4874 model score 1.9145 model score 2.2083 model score 2.2362 model score 2.1403 model score 1.9606 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.3610 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.1121 model score 1.1786 model score 1.1096 model score 1.5743 model score 1.2269 model score 1.3858 model score 1.4010 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.4731 model score 1.5562 model score 1.1330 model score 1.5946 model score 2.3984 model score 1.8851 model score 1.8592 model score 1.5228 model score 1.6656 model score 1.7844 model score 1.5515 model score 1.2829 model score 1.1040 model score 1.1794 model score 1.1441 model score 1.9330 model score 2.2818 model score 2.1908 model score 1.2646 model score 1.2135 model score 1.2605 model score 1.7580 model score 1.7751 model score 1.7620 model score 1.7751 model score 1.7657 model score 1.2916 model score 1.4064 USE_META, weight: 0.8977 cost: 1.1125 min: 0.8493 max: 3.1648 USE_META, weight: 0.8526 cost: 1.2285 min: 0.8493 max: 3.1648 USE_META, weight: 0.8524 cost: 1.2291 min: 0.8493 max: 3.1648 USE_META, weight: 0.8866 cost: 1.1410 min: 0.8493 max: 3.1648 USE_META, weight: 0.5667 cost: 1.9640 min: 0.8493 max: 3.1648 USE_META, weight: 0.6452 cost: 1.7621 min: 0.8493 max: 3.1648 USE_META, weight: 0.4879 cost: 2.1667 min: 0.8493 max: 3.1648 USE_META, weight: 0.4740 cost: 2.2024 min: 0.8493 max: 3.1648 USE_META, weight: 0.6933 cost: 1.6382 min: 0.8493 max: 3.1648 USE_META, weight: 0.7891 cost: 1.3917 min: 0.8493 max: 3.1648 USE_META, weight: 0.7106 cost: 1.5938 min: 0.8493 max: 3.1648 USE_META, weight: 0.7037 cost: 1.6116 min: 0.8493 max: 3.1648 USE_META, weight: 0.7457 cost: 1.5035 min: 0.8493 max: 3.1648 USE_META, weight: 0.7457 cost: 1.5035 min: 0.8493 max: 3.1648 USE_META, weight: 0.4756 cost: 2.1984 min: 0.8493 max: 3.1648 USE_META, weight: 0.7032 cost: 1.6128 min: 0.8493 max: 3.1648 USE_META, weight: 0.4561 cost: 2.2486 min: 0.8493 max: 3.1648 USE_META, weight: 0.8046 cost: 1.3519 min: 0.8493 max: 3.1648 USE_META, weight: 0.8299 cost: 1.2868 min: 0.8493 max: 3.1648 USE_META, weight: 0.8889 cost: 1.1350 min: 0.8493 max: 3.1648 USE_META, weight: 0.7256 cost: 1.5553 min: 0.8493 max: 3.1648 USE_META, weight: 0.7711 cost: 1.4382 min: 0.8493 max: 3.1648 USE_META, weight: 0.9207 cost: 1.0532 min: 0.8493 max: 3.1648 USE_META, weight: 0.7673 cost: 1.4480 min: 0.8493 max: 3.1648 USE_META, weight: 0.8889 cost: 1.1350 min: 0.8493 max: 3.1648 USE_META, weight: 0.7711 cost: 1.4382 min: 0.8493 max: 3.1648 USE_META, weight: 0.9210 cost: 1.0525 min: 0.8493 max: 3.1648 USE_META, weight: 0.9325 cost: 1.0229 min: 0.8493 max: 3.1648 USE_META, weight: 0.8746 cost: 1.1718 min: 0.8493 max: 3.1648 USE_META, weight: 0.7048 cost: 1.6088 min: 0.8493 max: 3.1648 USE_META, weight: 0.6735 cost: 1.6893 min: 0.8493 max: 3.1648 USE_META, weight: 0.6708 cost: 1.6962 min: 0.8493 max: 3.1648 USE_META, weight: 0.7200 cost: 1.5695 min: 0.8493 max: 3.1648 USE_META, weight: 0.6689 cost: 1.7012 min: 0.8493 max: 3.1648 USE_META, weight: 0.6656 cost: 1.7095 min: 0.8493 max: 3.1648 USE_META, weight: 0.6872 cost: 1.6540 min: 0.8493 max: 3.1648 USE_META, weight: 0.6932 cost: 1.6386 min: 0.8493 max: 3.1648 USE_META, weight: 0.7217 cost: 1.5652 min: 0.8493 max: 3.1648 USE_META, weight: 0.6854 cost: 1.6587 min: 0.8493 max: 3.1648 USE_META, weight: 0.5091 cost: 2.1122 min: 0.8493 max: 3.1648 USE_META, weight: 0.7285 cost: 1.5478 min: 0.8493 max: 3.1648 USE_META, weight: 0.5812 cost: 1.9268 min: 0.8493 max: 3.1648 USE_META, weight: 0.6343 cost: 1.7902 min: 0.8493 max: 3.1648 USE_META, weight: 0.8088 cost: 1.3411 min: 0.8493 max: 3.1648 USE_META, weight: 0.4603 cost: 2.2379 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.6884 cost: 1.6509 min: 0.8493 max: 3.1648 USE_META, weight: 0.7839 cost: 1.4052 min: 0.8493 max: 3.1648 USE_META, weight: 0.6636 cost: 1.7148 min: 0.8493 max: 3.1648 USE_META, weight: 0.7873 cost: 1.3965 min: 0.8493 max: 3.1648 USE_META, weight: 0.4104 cost: 2.3661 min: 0.8493 max: 3.1648 USE_META, weight: 0.7491 cost: 1.4949 min: 0.8493 max: 3.1648 USE_META, weight: 0.6932 cost: 1.6386 min: 0.8493 max: 3.1648 USE_META, weight: 0.6854 cost: 1.6587 min: 0.8493 max: 3.1648 USE_META, weight: 0.6872 cost: 1.6540 min: 0.8493 max: 3.1648 USE_META, weight: 0.6703 cost: 1.6974 min: 0.8493 max: 3.1648 USE_META, weight: 0.7862 cost: 1.3992 min: 0.8493 max: 3.1648 USE_META, weight: 0.7005 cost: 1.6197 min: 0.8493 max: 3.1648 USE_META, weight: 0.7862 cost: 1.3992 min: 0.8493 max: 3.1648 USE_META, weight: 0.6635 cost: 1.7151 min: 0.8493 max: 3.1648 USE_META, weight: 0.7571 cost: 1.4742 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.5664 cost: 1.9647 min: 0.8493 max: 3.1648 USE_META, weight: 0.7106 cost: 1.5938 min: 0.8493 max: 3.1648 USE_META, weight: 0.5442 cost: 2.0220 min: 0.8493 max: 3.1648 USE_META, weight: 0.5832 cost: 1.9216 min: 0.8493 max: 3.1648 USE_META, weight: 0.5241 cost: 2.0737 min: 0.8493 max: 3.1648 USE_META, weight: 0.4028 cost: 2.3857 min: 0.8493 max: 3.1648 USE_META, weight: 0.6825 cost: 1.6661 min: 0.8493 max: 3.1648 USE_META, weight: 0.5588 cost: 1.9844 min: 0.8493 max: 3.1648 USE_META, weight: 0.7619 cost: 1.4617 min: 0.8493 max: 3.1648 USE_META, weight: 0.5154 cost: 2.0961 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.6963 cost: 1.6307 min: 0.8493 max: 3.1648 USE_META, weight: 0.4305 cost: 2.3145 min: 0.8493 max: 3.1648 USE_META, weight: 0.6966 cost: 1.6299 min: 0.8493 max: 3.1648 USE_META, weight: 0.6703 cost: 1.6974 min: 0.8493 max: 3.1648 USE_META, weight: 0.8124 cost: 1.3319 min: 0.8493 max: 3.1648 USE_META, weight: 0.5856 cost: 1.9153 min: 0.8493 max: 3.1648 USE_META, weight: 0.5779 cost: 1.9352 min: 0.8493 max: 3.1648 USE_META, weight: 0.7334 cost: 1.5350 min: 0.8493 max: 3.1648 USE_META, weight: 0.7319 cost: 1.5390 min: 0.8493 max: 3.1648 USE_META, weight: 0.6502 cost: 1.7491 min: 0.8493 max: 3.1648 USE_META, weight: 0.1000 cost: 3.1648 min: 0.8493 max: 3.1648 USE_META, weight: 0.1000 cost: 3.1648 min: 0.8493 max: 3.1648 USE_META, weight: 0.1000 cost: 3.1648 min: 0.8493 max: 3.1648 USE_META, weight: 0.7687 cost: 1.4443 min: 0.8493 max: 3.1648 USE_META, weight: 0.7184 cost: 1.5737 min: 0.8493 max: 3.1648 USE_META, weight: 0.8250 cost: 1.2995 min: 0.8493 max: 3.1648 USE_META, weight: 0.8394 cost: 1.2626 min: 0.8493 max: 3.1648 USE_META, weight: 0.7017 cost: 1.6168 min: 0.8493 max: 3.1648 USE_META, weight: 0.7523 cost: 1.4864 min: 0.8493 max: 3.1648 USE_META, weight: 0.7970 cost: 1.3714 min: 0.8493 max: 3.1648 USE_META, weight: 0.7632 cost: 1.4584 min: 0.8493 max: 3.1648 USE_META, weight: 0.7058 cost: 1.6061 min: 0.8493 max: 3.1648 USE_META, weight: 0.6586 cost: 1.7275 min: 0.8493 max: 3.1648 USE_META, weight: 0.6808 cost: 1.6705 min: 0.8493 max: 3.1648 USE_META, weight: 0.3600 cost: 2.4959 min: 0.8493 max: 3.1648 USE_META, weight: 0.7289 cost: 1.5467 min: 0.8493 max: 3.1648 USE_META, weight: 0.5792 cost: 1.9319 min: 0.8493 max: 3.1648 USE_META, weight: 0.7869 cost: 1.3975 min: 0.8493 max: 3.1648 USE_META, weight: 0.7602 cost: 1.4661 min: 0.8493 max: 3.1648 USE_META, weight: 0.7363 cost: 1.5276 min: 0.8493 max: 3.1648 USE_META, weight: 0.7144 cost: 1.5841 min: 0.8493 max: 3.1648 USE_META, weight: 0.7765 cost: 1.4243 min: 0.8493 max: 3.1648 USE_META, weight: 0.7083 cost: 1.5997 min: 0.8493 max: 3.1648 USE_META, weight: 0.7523 cost: 1.4864 min: 0.8493 max: 3.1648 USE_META, weight: 0.6133 cost: 1.8442 min: 0.8493 max: 3.1648 USE_META, weight: 0.5445 cost: 2.0211 min: 0.8493 max: 3.1648 USE_META, weight: 0.6831 cost: 1.6646 min: 0.8493 max: 3.1648 USE_META, weight: 0.4246 cost: 2.3295 min: 0.8493 max: 3.1648 USE_META, weight: 0.6612 cost: 1.7210 min: 0.8493 max: 3.1648 USE_META, weight: 0.8292 cost: 1.2886 min: 0.8493 max: 3.1648 USE_META, weight: 0.8405 cost: 1.2595 min: 0.8493 max: 3.1648 USE_META, weight: 0.8006 cost: 1.3623 min: 0.8493 max: 3.1648 USE_META, weight: 0.7986 cost: 1.3674 min: 0.8493 max: 3.1648 USE_META, weight: 0.7840 cost: 1.4049 min: 0.8493 max: 3.1648 USE_META, weight: 1.0000 cost: 0.8493 min: 0.8493 max: 3.1648 USE_META, weight: 0.8006 cost: 1.3623 min: 0.8493 max: 3.1648 USE_META, weight: 0.8076 cost: 1.3442 min: 0.8493 max: 3.1648 USE_META, weight: 0.8286 cost: 1.2903 min: 0.8493 max: 3.1648 USE_META, weight: 0.8292 cost: 1.2886 min: 0.8493 max: 3.1648 USE_META, weight: 0.7494 cost: 1.4941 min: 0.8493 max: 3.1648 USE_META, weight: 0.7494 cost: 1.4941 min: 0.8493 max: 3.1648 USE_META, weight: 0.7494 cost: 1.4941 min: 0.8493 max: 3.1648 USE_META, weight: 0.7415 cost: 1.5143 min: 0.8493 max: 3.1648 USE_META, weight: 0.6508 cost: 1.7476 min: 0.8493 max: 3.1648 USE_META, weight: 0.7306 cost: 1.5424 min: 0.8493 max: 3.1648 USE_META, weight: 0.7239 cost: 1.5597 min: 0.8493 max: 3.1648 USE_META, weight: 0.7568 cost: 1.4749 min: 0.8493 max: 3.1648 USE_META, weight: 0.7552 cost: 1.4792 min: 0.8493 max: 3.1648 USE_META, weight: 0.7791 cost: 1.4176 min: 0.8493 max: 3.1648 USE_META, weight: 0.7375 cost: 1.5245 min: 0.8493 max: 3.1648 USE_META, weight: 0.9225 cost: 1.0488 min: 0.8493 max: 3.1648 USE_META, weight: 0.6508 cost: 1.7476 min: 0.8493 max: 3.1648 USE_META, weight: 0.5822 cost: 1.9242 min: 0.8493 max: 3.1648 USE_META, weight: 0.7675 cost: 1.4475 min: 0.8493 max: 3.1648 USE_META, weight: 0.7415 cost: 1.5143 min: 0.8493 max: 3.1648 USE_META, weight: 0.6579 cost: 1.7294 min: 0.8493 max: 3.1648 USE_META, weight: 0.7361 cost: 1.5281 min: 0.8493 max: 3.1648 USE_META, weight: 0.6933 cost: 1.6385 min: 0.8493 max: 3.1648 USE_META, weight: 0.7095 cost: 1.5967 min: 0.8493 max: 3.1648 USE_META, weight: 0.6439 cost: 1.7655 min: 0.8493 max: 3.1648 USE_META, weight: 0.6945 cost: 1.6353 min: 0.8493 max: 3.1648 USE_META, weight: 0.6877 cost: 1.6527 min: 0.8493 max: 3.1648 USE_META, weight: 0.7289 cost: 1.5466 min: 0.8493 max: 3.1648 USE_META, weight: 0.8549 cost: 1.2226 min: 0.8493 max: 3.1648 USE_META, weight: 0.7698 cost: 1.4414 min: 0.8493 max: 3.1648 USE_META, weight: 0.7024 cost: 1.6150 min: 0.8493 max: 3.1648 USE_META, weight: 0.6958 cost: 1.6320 min: 0.8493 max: 3.1648 USE_META, weight: 0.7497 cost: 1.4932 min: 0.8493 max: 3.1648 USE_META, weight: 0.7178 cost: 1.5752 min: 0.8493 max: 3.1648 USE_META, weight: 0.8505 cost: 1.2339 min: 0.8493 max: 3.1648 USE_META, weight: 0.7153 cost: 1.5818 min: 0.8493 max: 3.1648 USE_META, weight: 0.6613 cost: 1.7207 min: 0.8493 max: 3.1648 USE_META, weight: 0.6933 cost: 1.6384 min: 0.8493 max: 3.1648 USE_META, weight: 0.6349 cost: 1.7887 min: 0.8493 max: 3.1648 USE_META, weight: 0.7223 cost: 1.5638 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.6656 cost: 1.7096 min: 0.8493 max: 3.1648 USE_META, weight: 0.4744 cost: 2.2016 min: 0.8493 max: 3.1648 USE_META, weight: 0.5944 cost: 1.8929 min: 0.8493 max: 3.1648 USE_META, weight: 0.8612 cost: 1.2063 min: 0.8493 max: 3.1648 USE_META, weight: 0.8082 cost: 1.3426 min: 0.8493 max: 3.1648 USE_META, weight: 0.7569 cost: 1.4747 min: 0.8493 max: 3.1648 USE_META, weight: 0.7623 cost: 1.4607 min: 0.8493 max: 3.1648 USE_META, weight: 0.7923 cost: 1.3837 min: 0.8493 max: 3.1648 USE_META, weight: 0.6365 cost: 1.7843 min: 0.8493 max: 3.1648 USE_META, weight: 0.6439 cost: 1.7655 min: 0.8493 max: 3.1648 USE_META, weight: 0.7720 cost: 1.4359 min: 0.8493 max: 3.1648 USE_META, weight: 0.5218 cost: 2.0795 min: 0.8493 max: 3.1648 USE_META, weight: 0.6573 cost: 1.7309 min: 0.8493 max: 3.1648 USE_META, weight: 0.5878 cost: 1.9098 min: 0.8493 max: 3.1648 USE_META, weight: 0.7520 cost: 1.4874 min: 0.8493 max: 3.1648 USE_META, weight: 0.5859 cost: 1.9145 min: 0.8493 max: 3.1648 USE_META, weight: 0.4717 cost: 2.2083 min: 0.8493 max: 3.1648 USE_META, weight: 0.4609 cost: 2.2362 min: 0.8493 max: 3.1648 USE_META, weight: 0.4982 cost: 2.1403 min: 0.8493 max: 3.1648 USE_META, weight: 0.5681 cost: 1.9606 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8011 cost: 1.3610 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8978 cost: 1.1121 min: 0.8493 max: 3.1648 USE_META, weight: 0.8720 cost: 1.1786 min: 0.8493 max: 3.1648 USE_META, weight: 0.8988 cost: 1.1096 min: 0.8493 max: 3.1648 USE_META, weight: 0.7182 cost: 1.5743 min: 0.8493 max: 3.1648 USE_META, weight: 0.8532 cost: 1.2269 min: 0.8493 max: 3.1648 USE_META, weight: 0.7915 cost: 1.3858 min: 0.8493 max: 3.1648 USE_META, weight: 0.7856 cost: 1.4010 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.8337 cost: 1.2771 min: 0.8493 max: 3.1648 USE_META, weight: 0.7575 cost: 1.4731 min: 0.8493 max: 3.1648 USE_META, weight: 0.7252 cost: 1.5562 min: 0.8493 max: 3.1648 USE_META, weight: 0.8897 cost: 1.1330 min: 0.8493 max: 3.1648 USE_META, weight: 0.7103 cost: 1.5946 min: 0.8493 max: 3.1648 USE_META, weight: 0.3979 cost: 2.3984 min: 0.8493 max: 3.1648 USE_META, weight: 0.5974 cost: 1.8851 min: 0.8493 max: 3.1648 USE_META, weight: 0.6074 cost: 1.8592 min: 0.8493 max: 3.1648 USE_META, weight: 0.7382 cost: 1.5228 min: 0.8493 max: 3.1648 USE_META, weight: 0.6827 cost: 1.6656 min: 0.8493 max: 3.1648 USE_META, weight: 0.6365 cost: 1.7844 min: 0.8493 max: 3.1648 USE_META, weight: 0.7271 cost: 1.5515 min: 0.8493 max: 3.1648 USE_META, weight: 0.8315 cost: 1.2829 min: 0.8493 max: 3.1648 USE_META, weight: 0.9010 cost: 1.1040 min: 0.8493 max: 3.1648 USE_META, weight: 0.8717 cost: 1.1794 min: 0.8493 max: 3.1648 USE_META, weight: 0.8854 cost: 1.1441 min: 0.8493 max: 3.1648 USE_META, weight: 0.5788 cost: 1.9330 min: 0.8493 max: 3.1648 USE_META, weight: 0.4432 cost: 2.2818 min: 0.8493 max: 3.1648 USE_META, weight: 0.4786 cost: 2.1908 min: 0.8493 max: 3.1648 USE_META, weight: 0.8386 cost: 1.2646 min: 0.8493 max: 3.1648 USE_META, weight: 0.8584 cost: 1.2135 min: 0.8493 max: 3.1648 USE_META, weight: 0.8402 cost: 1.2605 min: 0.8493 max: 3.1648 USE_META, weight: 0.6468 cost: 1.7580 min: 0.8493 max: 3.1648 USE_META, weight: 0.6401 cost: 1.7751 min: 0.8493 max: 3.1648 USE_META, weight: 0.6452 cost: 1.7620 min: 0.8493 max: 3.1648 USE_META, weight: 0.6401 cost: 1.7751 min: 0.8493 max: 3.1648 USE_META, weight: 0.6438 cost: 1.7657 min: 0.8493 max: 3.1648 USE_META, weight: 0.8281 cost: 1.2916 min: 0.8493 max: 3.1648 USE_META, weight: 0.7835 cost: 1.4064 min: 0.8493 max: 3.1648 USE_EVALUE, weight: 0.4461 eval: 18.4120 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.4461 eval: 18.4120 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.4461 eval: 18.4120 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3526 eval: 21.3540 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3526 eval: 21.3540 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3526 eval: 21.3540 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8286 eval: 6.3775 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8286 eval: 6.3775 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8286 eval: 6.3775 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7487 eval: 8.8919 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7487 eval: 8.8919 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7487 eval: 8.8919 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6753 eval: 11.2000 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6753 eval: 11.2000 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6753 eval: 11.2000 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3957 eval: 19.9980 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3957 eval: 19.9980 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3957 eval: 19.9980 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6358 eval: 12.4410 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6358 eval: 12.4410 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6358 eval: 12.4410 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5481 eval: 15.2030 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5481 eval: 15.2030 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5481 eval: 15.2030 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5676 eval: 14.5890 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5676 eval: 14.5890 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5676 eval: 14.5890 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7481 eval: 8.9100 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7481 eval: 8.9100 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7481 eval: 8.9100 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5272 eval: 15.8600 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5272 eval: 15.8600 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5272 eval: 15.8600 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6363 eval: 12.4270 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6363 eval: 12.4270 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6363 eval: 12.4270 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 1.0000 eval: 0.9840 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 1.0000 eval: 0.9840 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 1.0000 eval: 0.9840 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.4866 eval: 17.1380 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.4866 eval: 17.1380 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.4866 eval: 17.1380 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6650 eval: 11.5230 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6650 eval: 11.5230 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6650 eval: 11.5230 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6026 eval: 13.4860 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6026 eval: 13.4860 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6026 eval: 13.4860 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8164 eval: 6.7600 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8164 eval: 6.7600 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8164 eval: 6.7600 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7322 eval: 9.4100 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7322 eval: 9.4100 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7322 eval: 9.4100 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7532 eval: 8.7500 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7532 eval: 8.7500 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7532 eval: 8.7500 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8580 eval: 5.4519 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8580 eval: 5.4519 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8580 eval: 5.4519 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6556 eval: 11.8190 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6556 eval: 11.8190 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.6556 eval: 11.8190 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8825 eval: 4.6800 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8825 eval: 4.6800 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.8825 eval: 4.6800 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7965 eval: 7.3857 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7965 eval: 7.3857 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.7965 eval: 7.3857 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3990 eval: 19.8940 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3990 eval: 19.8940 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.3990 eval: 19.8940 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5760 eval: 14.3240 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5760 eval: 14.3240 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.5760 eval: 14.3240 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.1000 eval: 29.3000 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.1000 eval: 29.3000 min: 0.9840 max: 29.3000 USE_EVALUE, weight: 0.1000 eval: 29.3000 min: 0.9840 max: 29.3000 Number of contacts in models: 257 Number of contacts in alignments: 78 NUMB_ALIGNS: 78 Adding 2161 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -146.0498, CN propb: -146.0498 weights: 0.3799 constraints: 158 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 158 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 158 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 2003 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 2003 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 2161 # command: